BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy8079
(135 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CIH|A Chain A, Crystal Structure Of A Putative Alpha-Rhamnosidase From
Bacteroides Thetaiotaomicron
Length = 739
Score = 26.9 bits (58), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 5/62 (8%)
Query: 18 TPATILQQDTQVNPDGSYQYSFQTSNGIAAQESGFLKNAGNPEAEVQVAQGAYTYTGADG 77
TP TI + VN D S++ +++ I ESG A + A + G + + GA
Sbjct: 115 TPPTIYVKGKTVNSDSSWRVTYEDKEWI--DESG---KASDTSATIYXDAGCWNFDGATQ 169
Query: 78 NP 79
P
Sbjct: 170 RP 171
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.310 0.131 0.381
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,197,753
Number of Sequences: 62578
Number of extensions: 181789
Number of successful extensions: 303
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 299
Number of HSP's gapped (non-prelim): 11
length of query: 135
length of database: 14,973,337
effective HSP length: 88
effective length of query: 47
effective length of database: 9,466,473
effective search space: 444924231
effective search space used: 444924231
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 46 (22.3 bits)