BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy8079
         (135 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CIH|A Chain A, Crystal Structure Of A Putative Alpha-Rhamnosidase From
           Bacteroides Thetaiotaomicron
          Length = 739

 Score = 26.9 bits (58), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 18  TPATILQQDTQVNPDGSYQYSFQTSNGIAAQESGFLKNAGNPEAEVQVAQGAYTYTGADG 77
           TP TI  +   VN D S++ +++    I   ESG    A +  A +    G + + GA  
Sbjct: 115 TPPTIYVKGKTVNSDSSWRVTYEDKEWI--DESG---KASDTSATIYXDAGCWNFDGATQ 169

Query: 78  NP 79
            P
Sbjct: 170 RP 171


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.131    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,197,753
Number of Sequences: 62578
Number of extensions: 181789
Number of successful extensions: 303
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 299
Number of HSP's gapped (non-prelim): 11
length of query: 135
length of database: 14,973,337
effective HSP length: 88
effective length of query: 47
effective length of database: 9,466,473
effective search space: 444924231
effective search space used: 444924231
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 46 (22.3 bits)