RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8090
         (242 letters)



>gnl|CDD|193602 cd09827, PET_Prickle, The PET domain of Prickle.  The PET domain
          of Prickle: Prickle contains an N-terminal PET domain
          and three C-terminal LIM domains. Prickle has been
          implicated in regulation of cell movement in the planar
          cell polarity (PCP) pathway which   requires the
          conserved Frizzled/Dishevelled (Dsh); Prickle interacts
          with Dishevelled, thereby modulating the activity of
          Frizzled/Dishevelled and the PCP signaling. Two forms
          of Prickle have been identified, namely Prickle 1 and
          Prickle 2. These are differentially expressed; Prickle
          1 is found in fetal heart and hematological
          malignancies, while Prickle 2 is expressed in fetal
          brain, adult cartilage, pancreatic islet, and some
          types of timorous cells. The PET domain is a
          protein-protein interaction domain, usually found in
          conjunction with the LIM domain, which is also involved
          in protein-protein interactions. The PET containing
          proteins serve as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 97

 Score =  146 bits (371), Expect = 2e-45
 Identities = 61/74 (82%), Positives = 69/74 (93%)

Query: 10 MVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQ 69
           VH YFS LPEDKVPYVNSPGE+YRI+QLLHQLPPHDNEVRYC++LSE+E++ELRLFSAQ
Sbjct: 23 QVHAYFSCLPEDKVPYVNSPGEKYRIKQLLHQLPPHDNEVRYCNSLSEEEKRELRLFSAQ 82

Query: 70 RKREALGRGFVKQL 83
          RKREALGRG V+ L
Sbjct: 83 RKREALGRGIVRPL 96


>gnl|CDD|191489 pfam06297, PET, PET Domain.  This domain is suggested to be
           involved in protein-protein interactions. The family is
           found in conjunction with pfam00412.
          Length = 106

 Score =  134 bits (340), Expect = 1e-40
 Identities = 48/75 (64%), Positives = 54/75 (72%)

Query: 9   SMVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSA 68
            +VH Y   LPE+KVP V S GE+YR RQLLHQLPPHD + RYCH LSE+E KEL  F  
Sbjct: 31  ELVHRYMELLPEEKVPVVGSEGEKYRRRQLLHQLPPHDQDPRYCHGLSEEEVKELEDFVK 90

Query: 69  QRKREALGRGFVKQL 83
           QRK EALG G+VK  
Sbjct: 91  QRKEEALGVGYVKLP 105


>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle.  The first
           LIM domain of Prickle: Prickle contains three C-terminal
           LIM domains and a N-terminal PET domain.  Prickles have
           been implicated in roles of regulating tissue polarity
           or planar cell polarity (PCP).  PCP establishment
           requires the conserved Frizzled/Dishevelled PCP pathway.
           Prickle interacts with Dishevelled, thereby modulating
           Frizzled/Dishevelled activity and PCP signaling. Four
           forms of prickles have been identified: prickle 1-4. The
           best characterized is prickle 1 and prickle 2 which are
           differentially expressed. While prickle 1 is expressed
           in fetal heart and hematological malignancies, prickle 2
           is found in fetal brain, adult cartilage, pancreatic
           islet, and some types of timorous cells.  Mutations in
           prickle 1 have been linked to progressive myoclonus
           epilepsy. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score =  121 bits (305), Expect = 6e-36
 Identities = 39/59 (66%), Positives = 47/59 (79%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHA 147
           CE C +++   D++VFASRAGP +CWHP CF CS C ELLVDLIYFY+  K+YCGRHHA
Sbjct: 1   CEQCGEQISGGDIAVFASRAGPGACWHPACFVCSTCKELLVDLIYFYQDGKVYCGRHHA 59


>gnl|CDD|193601 cd09027, PET, PET ((Prickle Espinas Testin) domain is involved in
          protein-protein interactions.  PET domain is involved
          in protein-protein interactions and is usually found in
          conjunction with LIM domain, which is also a
          protein-protein interaction domain. The PET containing
          proteins serve as adaptors or scaffolds to support the
          assembly of multimeric protein complexes. The PET
          domain has been found at the N-terminal of four known
          groups of proteins: prickle, testin, LIMPETin/LIM-9 and
          overexpressed breast tumor protein (OEBT). Prickle has
          been implicated in regulation of cell movement through
          its association with the Dishevelled (Dsh) protein in
          the planar cell polarity (PCP) pathway. Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at cell contact
          areas, and at focal adhesion plaques. It interacts with
          a variety of cytoskeletal proteins, including zyxin,
          mena, VASP, talin, and actin, and is involved in cell
          motility and adhesion events. Knockout mice experiments
          reveal tumor repressor function of Testin.
          LIMPETin/LIM-9 contains an N-terminal PET domain and 6
          LIM domains at the C-terminal.  In Schistosoma mansoni,
          where LIMPETin was first identified, it is down
          regulated in sexually mature adult females compared to
          sexually immature adult females and adult males. Its
          differential expression indicates that it is a
          transcription regulator.  In C. elegans, LIM-9 may play
          a role in regulating the assembly and maintenance of
          the muscle A-band by forming a protein complex with
          SCPL-1 and UNC-89 and other proteins. OEBT displays a
          PET domain with two LIM domains, and is predicted to be
          localized in the nucleus with a possible role in cancer
          differentiation.
          Length = 82

 Score =  114 bits (288), Expect = 4e-33
 Identities = 41/75 (54%), Positives = 51/75 (68%)

Query: 4  PSKRCSMVHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKEL 63
          P    S++  YF  LP++KVP + S G +YR RQLL+QLP HD + RYC ALSE+ER E 
Sbjct: 8  PGLNASLIEQYFECLPKEKVPRLGSEGAKYRRRQLLYQLPAHDLDPRYCDALSEEERAEF 67

Query: 64 RLFSAQRKREALGRG 78
            F A RK+EALG G
Sbjct: 68 EDFVAARKQEALGVG 82


>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like
           family.  The first LIM domain of Testin_like family:
           This family includes testin, prickle, dyxin and
           LIMPETin. Structurally, testin and prickle proteins
           contain three LIM domains at C-terminal; LIMPETin has
           six LIM domains; and dyxin presents only two LIM
           domains. However, all members of the family contain a
           PET protein-protein interaction domain.  Testin is a
           cytoskeleton associated focal adhesion protein that
           localizes along actin stress fibers, at
           cell-cell-contact areas, and at focal adhesion plaques.
           Testin interacts with a variety of cytoskeletal
           proteins, including zyxin, mena, VASP, talin, and actin
           and it is involved in cell motility and adhesion events.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  Dyxin
           involves in lung and heart development by interaction
           with GATA6 and blocking GATA6 activated target genes.
           LIMPETin might be the recombinant product of genes
           coding testin and four and half LIM proteins and its
           function is not well understood. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 58

 Score =  109 bits (276), Expect = 1e-31
 Identities = 35/58 (60%), Positives = 45/58 (77%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           CE C++ +   +++VFA RAG ++CWHPGCF C  CNELLVDLIYFY   K+YCGRH+
Sbjct: 1   CEKCKEPINPGEVAVFAERAGEDACWHPGCFVCETCNELLVDLIYFYHDGKIYCGRHY 58


>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3.  The
           first LIM domain of Prickle 3/LIM domain only 6 (LM06):
           Prickle contains three C-terminal LIM domains and a
           N-terminal PET domain.  Prickles have been implicated in
           roles of regulating tissue polarity or planar cell
           polarity (PCP).  PCP establishment requires the
           conserved Frizzled/Dishevelled PCP pathway. Prickle
           interacts with Dishevelled, thereby modulating
           Frizzled/Dishevelled activity and PCP signaling. Four
           forms of prickles have been identified: prickle 1-4. The
           best characterized is prickle 1 and prickle 2 which are
           differentially expressed. While prickle 1 is expressed
           in fetal heart and hematological malignancies, prickle 2
           is found in fetal brain, adult cartilage, pancreatic
           islet, and some types of timorous cells. Mutations in
           prickle 1 have been linked to progressive myoclonus
           epilepsy. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score =  101 bits (252), Expect = 4e-28
 Identities = 36/59 (61%), Positives = 45/59 (76%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHA 147
           C+ C  ++   D++VFASRAG  +CWHP CF C+ C ELLVDLIYFY+  K+YCGRHHA
Sbjct: 1   CQQCGRQICGGDIAVFASRAGLGACWHPQCFQCASCQELLVDLIYFYQDGKIYCGRHHA 59


>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2.  The
           first LIM domain of Prickle 2: Prickle contains three
           C-terminal LIM domains and a N-terminal PET domain.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  PCP
           establishment requires the conserved
           Frizzled/Dishevelled PCP pathway. Prickle interacts with
           Dishevelled, thereby modulating Frizzled/Dishevelled
           activity and PCP signaling. Four forms of prickles have
           been identified: prickle 1-4. The best characterized is
           prickle 1 and prickle 2 which are differentially
           expressed. While prickle 1 is expressed in fetal heart
           and hematological malignancies, prickle 2 is found in
           fetal brain, adult cartilage, pancreatic islet, and some
           types of timorous cells. Mutations in prickle 1 have
           been linked to progressive myoclonus epilepsy. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 98.9 bits (246), Expect = 3e-27
 Identities = 40/59 (67%), Positives = 46/59 (77%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHA 147
           CE C  ++   D++VFASRAG   CWHP CF CSVCNELLVDLIYFY+  K+YCGRHHA
Sbjct: 1   CEQCGGQINGGDIAVFASRAGHGVCWHPQCFVCSVCNELLVDLIYFYQDGKIYCGRHHA 59


>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1.  The
           first LIM domain of Prickle 1. Prickle contains three
           C-terminal LIM domains and a N-terminal PET domain
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  PCP
           establishment requires the conserved
           Frizzled/Dishevelled PCP pathway. Prickle interacts with
           Dishevelled, thereby modulating Frizzled/Dishevelled
           activity and PCP signaling. Four forms of prickles have
           been identified: prickle 1-4. The best characterized is
           prickle 1 and prickle 2 which are differentially
           expressed. While prickle 1 is expressed in fetal heart
           and hematological malignancies, prickle 2 is found in
           mainly expressed in fetal brain, adult cartilage,
           pancreatic islet, and some types of timorous cells. In
           addition, Prickle 1 regulates cell movements during
           gastrulation and neuronal migration through interaction
           with the noncanonical Wnt11/Wnt5 pathway in zebrafish.
           Mutations in prickle 1 have been linked to progressive
           myoclonus epilepsy.  LIM domains are 50-60 amino acids
           in size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score = 98.1 bits (244), Expect = 6e-27
 Identities = 37/59 (62%), Positives = 45/59 (76%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHA 147
           CE C  ++   +++VFASRAGP  CWHP CF C  CNELLVDLIYFY+  K++CGRHHA
Sbjct: 1   CEQCGIKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCGRHHA 59


>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin.  The first
           LIM domain of Testin: Testin contains three C-terminal
           LIM domains and a PET protein-protein interaction domain
           at the N-terminal.   Testin is a cytoskeleton associated
           focal adhesion protein that localizes along actin stress
           fibers, at cell-cell-contact areas, and at focal
           adhesion plaques. Testin interacts with a variety of
           cytoskeletal proteins, including zyxin, mena, VASP,
           talin, and actin and it is involved in cell motility and
           adhesion events. Knockout mice experiments reveal that
           tumor repressor function of Testin. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 58

 Score = 83.3 bits (206), Expect = 3e-21
 Identities = 31/58 (53%), Positives = 41/58 (70%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           C  C+  ++  D +V+A RAG +  WHP CF CS C ELLVD+IYF++  KLYCGRH+
Sbjct: 1   CYCCKQPMKEGDPAVYAERAGYDKLWHPACFVCSTCGELLVDMIYFWKNGKLYCGRHY 58


>gnl|CDD|193604 cd09829, PET_testin, The PET domain of Testin.  The PET domain of
          Testin: Testin contains a PET domain at the N-terminus
          and three C-terminal LIM domains. Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at cell-cell
          contact areas, and at focal adhesion plaques. Testin
          interacts with a variety of cytoskeletal proteins,
          including zyxin, mena, VASP, talin, and actin and is
          involved in cell motility and adhesion events. Knockout
          mice experiments reveal a tumor repressor function of
          Testin. The PET domain is a protein-protein interaction
          domain and is usually found in conjunction with LIM
          domain, which is also involved in protein-protein
          interactions. The PET containing proteins serve as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 88

 Score = 80.0 bits (198), Expect = 1e-19
 Identities = 32/70 (45%), Positives = 41/70 (58%)

Query: 14 YFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQRKRE 73
          Y   LP++K P   S G QYR +QL  QLP HD +   CH LSE+E K++  F  + K E
Sbjct: 18 YMELLPKEKQPIAGSEGAQYRKKQLQKQLPLHDQDPSLCHELSENEVKQMEQFVKKYKEE 77

Query: 74 ALGRGFVKQL 83
          ALG G V + 
Sbjct: 78 ALGVGKVIEP 87


>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin.
           The first LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the Testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 58

 Score = 74.0 bits (182), Expect = 1e-17
 Identities = 26/58 (44%), Positives = 36/58 (62%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           C  C + L+  +++V A + G +  WHP CF CS C ELLVDL Y    D++YC RH+
Sbjct: 1   CGGCSEPLKYGELAVTAPKFGESLLWHPACFRCSTCEELLVDLTYCVHDDQIYCERHY 58


>gnl|CDD|193605 cd09830, PET_LIMPETin_LIM-9, The PET domain of protein LIMPETin
          and LIM-9.  The PET domain of protein LIMPETin and
          LIM-9: Members of this family contain an N-terminal
          PETdomain and five to six LIM domains at the
          C-terminus. Four of the six LIM domains are highly
          homologous to the four-and-half LIM (FHL) domain family
          while the other two show sequence similarity to LIM
          domains of the Testin family. Thus, proteins of this
          family may be the recombinant product of genes coding
          testin and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Thus, proteins of this family may be the
          recombinant product of genes coding Testin and FHL
          proteins.  SmLIMPETin is down regulated in sexually
          mature adult Schistosoma females compared to sexually
          immature adult females and adult males. Its
          differential expression indicates that it is a
          transcription regulator. In C. elegans, LIM-9 binds to
          UNC-97 and UNC-96, components of sarcomeric muscle
          M-lines.  LIM-9 also forms a complex with SCPL-1 and
          UNC-89, whose function is to organize sarcomeric
          A-bands, especially the M-line of muscle. Thus, it
          might play a role in regulating the assembly and
          maintenance of muscle A-band. The PET domain is a
          protein-protein interaction domain and is usually found
          in conjunction with LIM domain, which is also involved
          in protein-protein interactions. The PET containing
          proteins serve as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 83

 Score = 69.7 bits (171), Expect = 8e-16
 Identities = 32/68 (47%), Positives = 41/68 (60%)

Query: 11 VHLYFSSLPEDKVPYVNSPGEQYRIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQR 70
          +  Y SSLP +KVP + SPGE+YR +QL+ QLP  D  + YC  L EDE++    F   R
Sbjct: 15 IDDYMSSLPNEKVPKLGSPGERYREKQLILQLPKQDLSLAYCKHLEEDEKRSFEDFVNAR 74

Query: 71 KREALGRG 78
             ALG G
Sbjct: 75 NEIALGIG 82


>gnl|CDD|193603 cd09828, PET_OEBT, The PET domain of overexpressed breast tumor
           protein (OEBT).  The PET domain of overexpressed breast
           tumor protein (OEBT): OEBT contains an N-terminal PET
           domain and two C-terminal LIM domains, and is predicted
           to be localized in the nucleus. The expression pattern
           of OEBT in malignant tissues indicates a possible role
           of OEBT in cancer differentiation. The PET domain is a
           protein-protein interaction domain and is usually found
           in conjunction with LIM domain, which is also involved
           in protein-protein interactions. PET containing proteins
           serve as adaptors or scaffolds to support the assembly
           of multimeric protein complexes.
          Length = 116

 Score = 65.3 bits (159), Expect = 9e-14
 Identities = 28/48 (58%), Positives = 38/48 (79%)

Query: 34  RIRQLLHQLPPHDNEVRYCHALSEDERKELRLFSAQRKREALGRGFVK 81
            +R LL QLPP D++ RYC AL+E+ER +LRLF A+RK+EALG+G  +
Sbjct: 66  GLRTLLQQLPPQDSDERYCLALAEEERAQLRLFCARRKQEALGQGVAR 113


>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1,
           Mec-3.  Zinc-binding domain family. Some LIM domains
           bind protein partners via tyrosine-containing motifs.
           LIM domains are found in many key regulators of
           developmental pathways.
          Length = 54

 Score = 52.8 bits (127), Expect = 8e-10
 Identities = 16/57 (28%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           C  C   +  ++  + A        WHP CF C+ C + L    +F +  KLYC   
Sbjct: 2   CAGCGKPIYGTERVLRA----LGKVWHPECFKCATCGKPLSGDTFFEKDGKLYCKDC 54


>gnl|CDD|215907 pfam00412, LIM, LIM domain.  This family represents two copies of
           the LIM structural domain.
          Length = 58

 Score = 49.3 bits (118), Expect = 2e-08
 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 4/58 (6%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           C  C   +          R      WHP CF C+VC + L    +F +  KLYC   +
Sbjct: 1   CAGCGKPIY----DRELVRRALGKVWHPECFRCAVCGKPLGPGDFFEKDGKLYCKHDY 54


>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain,
           containing two zinc fingers.  LIM domains are identified
           in a diverse group of proteins with wide variety of
           biological functions, including gene expression
           regulation, cell fate determination, cytoskeleton
           organization, tumor formation and development. LIM
           domains function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes. They perform
           their functions through interactions with other protein
           partners. LIM domains are 50-60 amino acids in size and
           share two characteristic highly conserved zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. The consensus
           sequence of LIM domain has been defined as
           C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
           21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 53

 Score = 47.7 bits (114), Expect = 6e-08
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
              WHP CF CSVC + L    ++ +  K YC + +
Sbjct: 18  GKKWHPECFKCSVCGKPLGGDSFYEKDGKPYCEKCY 53


>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated
           LIM protein) family.  This family represents the LIM
           domain of ALP (actinin-associated LIM protein) family.
           Four proteins: ALP, CLP36, RIL, and Mystique have been
           classified into the ALP subfamily of LIM domain
           proteins. Each member of the subfamily contains an
           N-terminal PDZ domain and a C-terminal LIM domain.
           Functionally, these proteins bind to alpha-actinin
           through their PDZ domains and bind or other signaling
           molecules through their LIM domains. ALP proteins have
           been implicated in cardiac and skeletal muscle
           structure, function and disease, platelet, and
           epithelial cell motility. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 40.8 bits (96), Expect = 2e-05
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 115 HPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           HP CF C+ C   L +  YF+  D+LYC  H
Sbjct: 21  HPECFVCADCGLNLKNKGYFFIEDELYCETH 51


>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH)
           family.  The third LIM domain of the Enigma Homolog
           (ENH) family: ENH was initially identified in rat brain.
           Same as enigma, it contains three LIM domains at the
           C-terminus and a PDZ domain at N-terminus. ENH is
           implicated in signal transduction processes involving
           protein kinases.  It has also been shown that ENH
           interacts with protein kinase D1 (PKD1) via its LIM
           domains and forms a complex with PKD1 and the alpha1C
           subunit of cardiac L-type voltage-gated calcium channel
           in rat neonatal cardiomyocytes. The N-terminal PDZ
           domain interacts with alpha-actinin at the Z-line. ENH
           is expressed in multiple tissues, such as skeletal
           muscle, heart, bone, and brain. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 39.9 bits (93), Expect = 4e-05
 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           C  CE  ++  D  + A        WH  CF CSVC E L    +F + DK  C +H
Sbjct: 1   CHGCEFPIEAGDRFLEAL----GHTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKH 53


>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin.
           The third LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 59

 Score = 39.9 bits (93), Expect = 5e-05
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           WH  CF CS C   LVD  +  + D++YCG 
Sbjct: 26  WHEACFLCSKCKISLVDKPFGSKADRIYCGN 56


>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain
           Kinase 2).  The first LIM domain of LIMK2 (LIM domain
           Kinase 2): LIMK2 is a member of the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, altering the rate of actin depolymerization.
           LIMK activity is activated by phosphorylation of a
           threonine residue within the activation loop of the
           kinase by p21-activated kinases 1 and 4 and by Rho
           kinase. LIMKs can function in both cytoplasm and
           nucleus. Both LIMK1 and LIMK2 can act in the nucleus to
           suppress Rac/Cdc42-dependent cyclin D1 expression. LIMK2
           is expressed in all tissues. While LIMK1 localizes
           mainly at focal adhesions, LIMK2 is found in cytoplasmic
           punctae, suggesting that they may have different
           cellular functions. The activity of LIM kinase 2 to
           regulate cofilin phosphorylation is inhibited by the
           direct binding of Par-3. LIMK2 activation promotes cell
           cycle progression. The phenotype of Limk2 knockout mice
           shows a defect in spermatogenesis. The LIM domains have
           been shown to play an important role in regulating
           kinase activity and likely also contribute to LIMK
           function by acting as sites of protein-to-protein
           interactions. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 39.1 bits (91), Expect = 9e-05
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           C  C   +Q S              WH  CF CSVC +LL +  Y+ +  KLYC +H+
Sbjct: 1   CTGCGGRIQDSFHYRVV-----QEAWHNSCFQCSVCQDLLTNW-YYEKDGKLYCHKHY 52


>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH.  The
           second LIM domain of protein PINCH: PINCH plays a
           pivotal role in the assembly of focal adhesions (FAs),
           regulating diverse functions in cell adhesion, growth,
           and differentiation through LIM-mediated protein-protein
           interactions. PINCH comprises an array of five LIM
           domains that interact with integrin-linked kinase (ILK),
           Nck2 (also called Nckbeta or Grb4) and other interaction
           partners.  These interactions are essential for
           triggering the FA assembly and for relaying diverse
           mechanical and biochemical signals between
           Cell-extracellular matrix and the actin cytoskeleton.
           LIM domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 38.5 bits (90), Expect = 1e-04
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 111 NSCWHPGCFTCSVCNELLVDL 131
           N+ WHP CF C +CN+ L D+
Sbjct: 17  NNNWHPDCFRCEICNKELADI 37


>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like
           family.  The third LIM domain of Enigma-like family: The
           Enigma LIM domain family is comprised of three members:
           Enigma, ENH, and Cypher (mouse)/ZASP (human). These
           subfamily members contain a single PDZ domain at the
           N-terminus and three LIM domains at the C-terminus.
           Enigma was initially characterized in humans and is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone, and brain. The third LIM domain
           specifically interacts with the insulin receptor and the
           second LIM domain interacts with the receptor tyrosine
           kinase Ret and the adaptor protein APS.  Thus Enigma is
           implicated in signal transduction processes, such as
           mitogenic activity, insulin related actin organization,
           and glucose metabolism. The second member, ENH protein,
           was first identified in rat brain.  It has been shown
           that ENH interacts with protein kinase D1 (PKD1) via its
           LIM domains and forms a complex with PKD1 and the
           alpha1C subunit of cardiac L-type voltage-gated calcium
           channel in rat neonatal cardiomyocytes. The N-terminal
           PDZ domain interacts with alpha-actinin at the Z-line.
           ZASP/Cypher is required for maintenance of Z-line
           structure during muscle contraction, but not required
           for Z-line assembly. In heart, Cypher/ZASP plays a
           structural role through its interaction with
           cytoskeletal Z-line proteins. In addition, there is
           increasing evidence that Cypher/ZASP also performs
           signaling functions. Studies reveal that Cypher/ZASP
           interacts with and directs PKC to the Z-line, where PKC
           phosphorylates downstream signaling targets. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 38.2 bits (89), Expect = 2e-04
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 4/57 (7%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           C  C+  ++  D  + A        WH  CF C+VC+  L    ++ + DK  C  H
Sbjct: 1   CHGCDFPIEAGDRFLEAL----GHTWHDTCFVCAVCHVNLEGQTFYSKKDKPLCKNH 53


>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b.  The first LIM
           domain of Lmx1b: Lmx1b belongs to the LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  In mouse, Lmx1b
           functions in the developing limbs and eyes, the kidneys,
           the brain, and in cranial mesenchyme. The disruption of
           Lmx1b gene results kidney and limb defects. In the
           brain, Lmx1b is important for generation of
           mesencephalic dopamine neurons and the differentiation
           of serotonergic neurons. In the mouse eye, Lmx1b
           regulates anterior segment (cornea, iris, ciliary body,
           trabecular meshwork, and lens) development. As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 34.7 bits (80), Expect = 0.003
 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
             WH  C  CSVC + L    YF R  KLYC
Sbjct: 19  RSWHEECLQCSVCQQPLTTSCYF-RDRKLYC 48


>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase
           ).  The first LIM domain of LIMK (LIM domain Kinase ):
           LIMK protein family is  comprised of two members LIMK1
           and LIMK2. LIMK contains two LIM domains, a PDZ domain
           and a kinase domain. LIMK is involved in the regulation
           of actin polymerization and microtubule disassembly.
           LIMK influences architecture of the actin cytoskeleton
           by regulating the activity of the cofilin family
           proteins cofilin1, cofilin2, and destrin. The mechanism
           of the activation is to phosphorylates cofilin on serine
           3 and inactivates its actin-severing activity, and
           altering the rate of actin depolymerisation. LIMKs can
           function in both cytoplasm and nucleus and are expressed
           in all tissues. Both LIMK1 and LIMK2 can act in the
           nucleus to suppress Rac/Cdc42-dependent cyclin D1
           expression. However, LIMK1 and LIMk2 have different
           cellular locations. While LIMK1 localizes mainly at
           focal adhesions, LIMK2 is found in cytoplasmic punctae,
           suggesting that they may have different cellular
           functions. The LIM domains of LIMK have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 53

 Score = 34.4 bits (79), Expect = 0.004
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           N  WH  CF CSVC++ L +  YF +  KLYC + +
Sbjct: 18  NQDWHCDCFRCSVCSDSLSNW-YFEKDGKLYCRKDY 52


>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like
           family.  The first LIM domain of Enigma-like family: The
           Enigma LIM domain family is comprised of three members:
           Enigma, ENH, and Cypher (mouse)/ZASP (human). These
           subfamily members contain a single PDZ domain at the
           N-terminus and three LIM domains at the C-terminus.
           Enigma was initially characterized in humans and is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone, and brain. The third LIM domain
           specifically interacts with the insulin receptor and the
           second LIM domain interacts with the receptor tyrosine
           kinase Ret and the adaptor protein APS.  Thus Enigma is
           implicated in signal transduction processes, such as
           mitogenic activity, insulin related actin organization,
           and glucose metabolism. The second member, ENH protein,
           was first identified in rat brain. It has been shown
           that ENH interacts with protein kinase D1 (PKD1) via its
           LIM domains and forms a complex with PKD1 and the
           alpha1C subunit of cardiac L-type voltage-gated calcium
           channel in rat neonatal cardiomyocytes. The N-terminal
           PDZ domain interacts with alpha-actinin at the Z-line.
           ZASP/Cypher is required for maintenance of Z-line
           structure during muscle contraction, but not required
           for Z-line assembly. In heart, Cypher/ZASP plays a
           structural role through its interaction with
           cytoskeletal Z-line proteins. In addition, there is
           increasing evidence that Cypher/ZASP also performs
           signaling functions. Studies reveal that Cypher/ZASP
           interacts with and directs PKC to the Z-line, where PKC
           phosphorylates downstream signaling targets. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 33.9 bits (78), Expect = 0.005
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 113 CWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
            WHP  FTCS C+  L ++ +      LYC   +
Sbjct: 19  SWHPEEFTCSHCHCSLAEIGFVEEKGSLYCELCY 52


>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function.  The
           first Lim domain of a LIM domain containing protein: The
           functions of the proteins are unknown. The members of
           this family contain two copies of LIM domain. The LIM
           domain is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 58

 Score = 34.2 bits (79), Expect = 0.005
 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 114 WHPGCFTCSVCNELLVDLIYFY-RGDKLYCGRH 145
           WH  CF C+ C       +  Y   DK YC +H
Sbjct: 24  WHRECFVCTTCGCPFQFSVPCYVLDDKPYCQQH 56


>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM
           domains protein (FHL).  The second LIM domain of Four
           and a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 34.2 bits (79), Expect = 0.005
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
             WH  CFTCS C + +    +  + DK+YC
Sbjct: 20  KFWHEKCFTCSECKKPIGTKSFIPKDDKIYC 50


>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1.  The Lim domain of DA1:
           DA1 contains one copy of LIM domain and a domain of
           unknown function. DA1 is predicted as an ubiquitin
           receptor, which sets final seed and organ size by
           restricting the period of cell proliferation. The LIM
           domain is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 53

 Score = 33.8 bits (78), Expect = 0.006
 Identities = 9/31 (29%), Positives = 15/31 (48%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLY 141
            + WHP CF C  C + + +  +   G+  Y
Sbjct: 18  GAVWHPECFRCHACRKPIAEHEFSVSGNDPY 48


>gnl|CDD|188833 cd09449, LIM_Mystique, The LIM domain of Mystique, a subfamily of
           ALP LIM domain proteins.  The LIM domain of Mystique, a
           subfamily of ALP LIM domain proteins: Mystique is the
           most recently identified member of the ALP protein
           family. It also interacts with alpha-actinin, as other
           ALP proteins do. Mystique promotes cell attachment and
           migration and suppresses anchorage-independent growth.
           The LIM domain of Mystique is required for the
           suppression function. Moreover, Mystique functions as an
           ubiquitin E3 ligase acting on STAT proteins to cause
           their proteosome mediated degradation. As in all LIM
           domains, this domain is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 33.7 bits (77), Expect = 0.007
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           CE C   + T      A R       HPGC+TC+ C   L    +F+ G+K++C +H
Sbjct: 1   CEKCGTSIVTQ-----AVRIQEGRYRHPGCYTCTDCGLNLKMRGHFWAGEKMFCEKH 52


>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM
           domains protein 1 (FHL1).  The second LIM domain of Four
           and a half LIM domains protein 1 (FHL1):  FHL1 is
           heavily expressed in skeletal and cardiac muscles. It
           plays important roles in muscle growth, differentiation,
           and sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 58

 Score = 34.0 bits (78), Expect = 0.007
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           + WH  CFTCS C + +    +F +G+  YC   H
Sbjct: 20  NVWHKDCFTCSNCKQPIGTKSFFPKGEDFYCVPCH 54


>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM
           domains protein (FHL).  The first LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and  an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 33.6 bits (77), Expect = 0.009
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCG 143
           WH GCF C  C   LVD  +  + + L C 
Sbjct: 26  WHEGCFKCFKCQRSLVDKPFAAKDEDLLCT 55


>gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP,
           actinin-associated LIM protein.  This family represents
           the LIM domain of ALP, actinin-associated LIM protein.
           ALP contains an N-terminal PDZ domain, a C-terminal LIM
           domain and an ALP-subfamily-specific 34-amino-acid motif
           termed ALP-like motif (AM), which contains a putative
           consensus protein kinase C (PKC) phosphorylation site
           and two alpha-helices. ALP proteins are found in heart
           and in skeletal muscle. ALP may act as a signaling
           molecule which is regulated by PKC-dependent signaling.
           ALP plays an essential role in the development of RV
           (right ventricle) chamber. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 33.3 bits (76), Expect = 0.010
 Identities = 15/31 (48%), Positives = 17/31 (54%)

Query: 115 HPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           HP CF CS CN  L    YF+   +LYC  H
Sbjct: 21  HPECFVCSDCNLNLKQKGYFFVEGQLYCEAH 51


>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM
           domains protein 3 (FHL3).  The fourth LIM domain of Four
           and a half LIM domains protein 3 (FHL3):  FHL3 is highly
           expressed in the skeleton and cardiac muscles and
           possesses the transactivation and repression activities.
           FHL3 interacts with many transcription factors, such as
           CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. Moreover, FHL3
           interacts with alpha- and beta-subunits of the muscle
           alpha7beta1 integrin receptor. FHL3 was also proved to
           possess the auto-activation ability and was confirmed
           that the second zinc finger motif in fourth LIM domain
           was responsible for the auto-activation of FHL3. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 56

 Score = 33.2 bits (76), Expect = 0.011
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           WH  CF CS C+  LV   +F  GD++ C  
Sbjct: 24  WHQPCFKCSRCSVSLVGAGFFPDGDQILCRD 54


>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like
           proteins.  The second LIM domain of Ajuba-like proteins:
           Ajuba like LIM protein family includes three highly
           homologous proteins Ajuba, Limd1, and WTIP. Members of
           the family contain three tandem C-terminal LIM domains
           and a proline-rich N-terminal region. This family of
           proteins functions as scaffolds, participating in the
           assembly of numerous protein complexes. In the
           cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated
           ERK activation. Ajuba also recruits the TNF
           receptor-associated factor 6 (TRAF6) to p62 and
           activates PKCKappa activity. Ajuba interacts with
           alpha-catenin and F-actin to contribute to the formation
           or stabilization of adheren junctions by linking
           adhesive receptors to the actin cytoskeleton. Although
           Ajuba is a cytoplasmic protein, it can shuttle into the
           nucleus. In nucleus, Ajuba functions as a corepressor
           for the zinc finger-protein Snail. It binds to the SNAG
           repression domain of Snail through its LIM region.
           Arginine methyltransferase-5 (Prmt5), a protein in the
           complex, is recruited to Snai l through an interaction
           with Ajuba. This ternary complex functions to repress
           E-cadherin, a Snail target gene. In addition, Ajuba
           contains functional nuclear-receptor interacting motifs
           and selectively interacts with retinoic acid receptors
           (RARs) and rexinoid receptor (RXRs) to negatively
           regulate retinoic acid signaling. Wtip, the
           Wt1-interacting protein, was originally identified as an
           interaction partner of the Wilms tumour protein 1 (WT1).
           Wtip is involved in kidney and neural crest development.
           Wtip interacts with the receptor tyrosine kinase Ror2
           and inhibits canonical Wnt signaling. LIMD1 was reported
           to inhibit cell growth and metastases. The inhibition
           may be mediated through an interaction with the protein
           barrier-to-autointegration (BAF), a component of SWI/SNF
           chromatin-remodeling protein; or through the interaction
           with retinoblastoma protein (pRB), resulting in
           inhibition of E2F-mediated transcription, and expression
           of the majority of genes with E2F1- responsive elements.
           Recently, Limd1 was shown to interact with the
           p62/sequestosome protein and influence IL-1 and RANKL
           signaling by facilitating the assembly of a
           p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62
           interaction affects both NF-kappaB and AP-1 activity in
           epithelial cells and osteoclasts. Moreover, LIMD1
           functions as tumor repressor to block lung tumor cell
           line in vitro and in vivo. Recent studies revealed that
           LIM proteins Wtip, LIMD1 and Ajuba interact with
           components of RNA induced silencing complexes (RISC) as
           well as eIF4E and the mRNA m7GTP cap-protein complex and
           are required for microRNA-mediated gene silencing.  As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 32.7 bits (75), Expect = 0.014
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 114 WHPGCFTCSVCNELLVDLIYFY--RGDKLYC 142
           +HPGCF C VCNE L D + F     + +YC
Sbjct: 20  YHPGCFRCCVCNECL-DGVPFTVDVENNIYC 49


>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL.  The LIM domain of RIL:
           RIL contains an N-terminal PDZ domain, a LIM domain, and
           a short consensus C-terminal region. It is the smallest
           molecule in the ALP LIM domain containing protein
           family. RIL was identified in rat fibroblasts and in
           human lymphocytes. The LIM domain interacts with the
           AMPA glutamate receptor in dendritic spines. The
           consensus C-terminus interacts with PTP-BL, a
           submembranous protein tyrosine phosphatase and the PDZ
           domain is responsible to interact with alpha-actinin
           molecules. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 32.6 bits (74), Expect = 0.015
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           +HP CF C  C   L    YF+  ++LYC  H
Sbjct: 20  YHPECFMCDDCGLNLKQRGYFFIDEQLYCETH 51


>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin.
           The fifth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 32.4 bits (74), Expect = 0.017
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           N  WH  CFTC+ C++ L    +  R +K YC
Sbjct: 17  NEPWHRECFTCTNCSKSLAGQRFTSRDEKPYC 48


>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin
           like protein family.  The first LIM domain of the
           paxillin like protein family: This family consists of
           paxillin, leupaxin, Hic-5 (ARA55), and other related
           proteins. There are four LIM domains in the C-terminal
           of the proteins and leucine-rich LD-motifs in the
           N-terminal region.  Members of this family are adaptor
           proteins to recruit key components of
           signal-transduction machinery to specific sub-cellular
           locations. Paxillin is found at the interface between
           the plasma membrane and the actin cytoskeleton. Paxillin
           serves as a platform for the recruitment of numerous
           regulatory and structural proteins that together control
           the dynamic changes in cell adhesion, cytoskeletal
           reorganization and gene expression that are necessary
           for cell migration and survival. Leupaxin is a
           cytoskeleton adaptor protein, which is preferentially
           expressed in hematopoietic cells. It associates with
           focal adhesion kinases PYK2 and pp125FAK and identified
           to be a component of the osteoclast pososomal signaling
           complex. Hic-5 controls cell proliferation, migration
           and senescence by functioning as coactivator for steroid
           receptors such as androgen receptor, glucocorticoid
           receptor and progesterone receptor. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 32.7 bits (75), Expect = 0.017
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WHP  F C+ C   L    +F R  + YC
Sbjct: 20  WHPEHFVCAECKTELGTKNFFERDGQPYC 48


>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule
           interacting with CasL) like family.  The LIM domain of
           Mical (molecule interacting with CasL) like family:
           Known members of this family includes  LIM domain
           containing proteins; Mical (molecule interacting with
           CasL), pollen specific protein SF3, Eplin, xin
           actin-binding repeat-containing protein 2 (XIRP2) and
           Ltd-1. The members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth and mobility.  Eplin has
           also found to be tumor suppressor. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs.. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 32.6 bits (75), Expect = 0.018
 Identities = 14/34 (41%), Positives = 16/34 (47%)

Query: 113 CWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
            +H  CF CS CN+ L    Y     KLYC  H 
Sbjct: 20  LFHKSCFRCSHCNKTLRLGNYASLEGKLYCKPHF 53


>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9
           family.  The second LIM domain of Lhx2 and Lhx9 family:
           Lhx2 and Lhx9 are highly homologous LHX regulatory
           proteins. They belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Although Lhx2 and
           Lhx9 are highly homologous, they seems to play
           regulatory roles in different organs.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. Lhx9 is expressed in several regions of the
           developing mouse brain, the spinal cord, the pancreas,
           in limb mesenchyme, and in the urogenital region. Lhx9
           plays critical roles in gonad development.  Homozygous
           mice lacking functional Lhx9 alleles exhibit numerous
           urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           are phenotypically female, even those that are
           genotypically male. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 59

 Score = 31.9 bits (73), Expect = 0.032
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYF-YRGDKLYCGRH 145
           C  C   +  S++ V  +R   +  +H  CFTC+ CN+ L    +F  R   +YC  H
Sbjct: 5   CARCHLGISASEL-VMRAR---DLVFHLNCFTCATCNKPLTKGDHFGMRDGLVYCRLH 58


>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM
           (abLIM) proteins.  The first LIM domain of actin binding
           LIM (abLIM) proteins:  Three homologous members of the
           abLIM protein family have been identified; abLIM-1,
           abLIM-2 and abLIM-3. The N-terminal of abLIM consists of
           four tandem repeats of LIM domains and the C-terminal of
           acting binding LIM protein is a villin headpiece domain,
           which has strong actin binding activity. The abLIM-1,
           which is expressed in retina, brain, and muscle tissue,
           has been indicated to function as a tumor suppressor.
           AbLIM-2 and -3, mainly expressed in muscle and neuronal
           tissue, bind to F-actin strongly.  They may serve as a
           scaffold for signaling modules of the actin cytoskeleton
           and thereby modulate transcription. It has shown that
           LIM domains of abLIMs interact with STARS (striated
           muscle activator of Rho signaling), which directly binds
           actin and stimulates serum-response factor
           (SRF)-dependent transcription. All LIM domains are 50-60
           amino acids in size and share two characteristic highly
           conserved zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 31.5 bits (72), Expect = 0.034
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 115 HPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           H  CFTC VC   L    +F +  + YC
Sbjct: 21  HIKCFTCKVCGCDLAQGGFFVKEGEYYC 48


>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin
           like protein family.  The third LIM domain of the
           paxillin like protein family: This family consists of
           paxillin, leupaxin, Hic-5 (ARA55), and other related
           proteins. There are four LIM domains in the C-terminal
           of the proteins and leucine-rich LD-motifs in the
           N-terminal region.  Members of this family are adaptor
           proteins to recruit key components of
           signal-transduction machinery to specific sub-cellular
           locations. Paxillin is found at the interface between
           the plasma membrane and the actin cytoskeleton. Paxillin
           serves as a platform for the recruitment of numerous
           regulatory and structural proteins that together control
           the dynamic changes in cell adhesion, cytoskeletal
           reorganization and gene expression that are necessary
           for cell migration and survival. Leupaxin is a
           cytoskeleton adaptor protein, which is preferentially
           expressed in hematopoietic cells. It associates with
           focal adhesion kinases PYK2 and pp125FAK and identified
           to be a component of the osteoclast pososomal signaling
           complex. Hic-5 controls cell proliferation, migration
           and senescence by functioning as coactivator for steroid
           receptors such as androgen receptor, glucocorticoid
           receptor and progesterone receptor. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 31.2 bits (71), Expect = 0.046
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           N+ WHP CF C  C++  ++  +F      YC  H
Sbjct: 17  NTQWHPECFVCRECHKPFINGSFFEHEGLPYCETH 51


>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known
           as Lim1) and Lhx5.  The second LIM domain of Lhx1 (also
           known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
           related members of LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Lhx1 is required for regulating
           the vertebrate head organizer, the nervous system, and
           female reproductive tract development. During
           embryogenesis in the mouse, Lhx1 is expressed early in
           mesodermal tissue, then later during urogenital, kidney,
           liver, and nervous system development. In the adult,
           expression is restricted to the kidney and brain. A
           mouse embryos with Lhx1 gene knockout cannot grow normal
           anterior head structures, kidneys, and gonads, but with
           normally developed trunk and tail morphology. In the
           developing nervous system, Lhx1 is required to direct
           the trajectories of motor axons in the limb. Lhx1 null
           female mice lack the oviducts and uterus.  Lhx5 protein
           may play complementary or overlapping roles with Lhx1.
           The expression of Lhx5 in the anterior portion of the
           mouse neural tube suggests a role in patterning of the
           forebrain. All LIM domains are 50-60 amino acids in size
           and share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 31.2 bits (71), Expect = 0.053
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 10/53 (18%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLY 141
           C  C+  +  +D+     R   +  +H  CFTC VC + L        G++LY
Sbjct: 1   CAGCDQGISPNDLV----RRARDKVFHLNCFTCMVCRKQLS------TGEELY 43


>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2.  The second LIM
           domain of Lhx2: Lhx2 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. The Lhx2 protein has been shown to bind to
           the mouse M71 olfactory receptor promoter. Similar to
           other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 59

 Score = 31.2 bits (70), Expect = 0.061
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKL-YCGRH 145
           C  C   +  S+M + A     +  +H  CFTC+ CN++L    +F   D L YC  H
Sbjct: 5   CARCHLGISASEMVMRAR----DLVYHLNCFTCTTCNKMLTTGDHFGMKDNLVYCRLH 58


>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher
           family.  The third LIM domain of ZASP/Cypher family:
           ZASP was identified in human heart and skeletal muscle
           and Cypher is a mice ortholog of ZASP. ZASP/Cyppher
           contains three LIM domains at the C-terminus and a PDZ
           domain at N-terminus.  ZASP/Cypher is required for
           maintenance of Z-line structure during muscle
           contraction, but not required for Z-line assembly. In
           heart, Cypher/ZASP plays a structural role through its
           interaction with cytoskeletal Z-line proteins. In
           addition, there is increasing evidence that Cypher/ZASP
           also performs signaling functions. Studies reveal that
           Cypher/ZASP interacts with and directs PKC to the
           Z-line, where PKC phosphorylates downstream signaling
           targets. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 31.2 bits (70), Expect = 0.062
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           C  C+  ++  D  + A        WH  CF C+VC+  L    ++ + DK  C +H
Sbjct: 1   CHGCDFPVEAGDKFIEAL----GHTWHDTCFICAVCHVNLEGQPFYSKKDKPLCKKH 53


>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma
           subfamily with unknown function.  The third LIM domain
           of an Enigma subfamily with unknown function: The Enigma
           LIM domain family is comprised of three characterized
           members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
           These subfamily members contain a single PDZ domain at
           the N-terminus and three LIM domains at the C-terminus.
           They serve as adaptor proteins, where the PDZ domain
           tethers the protein to the cytoskeleton and the LIM
           domains, recruit signaling proteins to implement
           corresponding functions. The members of the enigma
           family have been implicated in regulating or organizing
           cytoskeletal structure, as well as involving multiple
           signaling pathways. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 31.0 bits (70), Expect = 0.063
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           N+ +H  CF C+ CN  L    ++ +G + +C  H
Sbjct: 19  NNNYHSQCFNCTRCNVNLEGQSFYAKGGRPFCKLH 53


>gnl|CDD|188832 cd09448, LIM_CLP36, This family represents the LIM domain of CLP36.
            This family represents the LIM domain of CLP36.  CLP36
           has also been named as CLIM1, Elfin, or PDLIM1. CLP36
           contains a C-terminal LIM domain and an N-terminal PDZ
           domain. CLP36 is highly expressed in heart and is
           present in many other tissues including lung, liver,
           spleen, and blood. CLP36 has been implicated in many
           processes including hypoxia and regulation of actin
           stress fibers. CLP36 co-localizes with alpha-actinin-2
           at the Z-lines in myocardium. In addition, CLP36 binds
           to alpha-actinin-1 and alpha-actinin-4, and associates
           with F-actin filaments and stress fibers. CLP36 might be
           involved in not only the function of sarcomeres in
           muscle cells, but also in actin stress fiber-mediated
           cellular processes, such as cell shape, migration,
           polarit, and cytokinesis in non-muscle cells. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 30.7 bits (69), Expect = 0.083
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 115 HPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           HP C+ C+ C   L    +F+  D++YC +H
Sbjct: 21  HPECYVCTDCGTNLKQKGHFFVEDQIYCEKH 51


>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9.  The second LIM
           domain of Lhx9: Lhx9 belongs to the LHX protein family,
           which features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx9 is highly
           homologous to Lhx2. It is expressed in several regions
           of the developing mouse brain, the spinal cord, the
           pancreas, in limb mesenchyme, and in the urogenital
           region. Lhx9 plays critical roles in gonad development. 
           Homozygous mice lacking functional Lhx9 alleles exhibit
           numerous urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           have reduced levels of the Sf1 nuclear receptor that is
           required for gonadogenesis, and recent studies have
           shown that Lhx9 is able to activate the Sf1/FtzF1 gene.
           Lhx9 null mice are phenotypically female, even those
           that are genotypically male.  As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 59

 Score = 30.8 bits (69), Expect = 0.089
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKL-YCGRH 145
           C  C   +  S+M + A      S +H  CFTC+ CN+ L    +F   D L YC  H
Sbjct: 5   CARCHLGISASEMVMRAR----ESVYHLSCFTCTTCNKTLTTGDHFGMKDNLVYCRAH 58


>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM
           domains protein (FHL).  The fourth LIM domain of Four
           and a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 interacts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 56

 Score = 30.4 bits (69), Expect = 0.091
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCG 143
           WH  CF C  C+  LV   +  + D++ C 
Sbjct: 24  WHSDCFNCGKCSVSLVGQGFLTQRDEILCP 53


>gnl|CDD|185140 PRK15218, PRK15218, fimbrial chaperone protein PegB; Provisional.
          Length = 226

 Score = 33.0 bits (75), Expect = 0.091
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 21/92 (22%)

Query: 1   MLKPSKRCSMVHLYF----SSLPEDK--VPYVNSP---------GEQYRIRQLLHQLPPH 45
           ++   KR S++  +     +SLP +K  VP++ +P         G+Q +I++L + LP  
Sbjct: 40  LMNDGKRSSLIQAWIDNGDTSLPPEKLQVPFIMTPPVIRVAANSGQQLKIKKLANNLPGD 99

Query: 46  DNEVRYCHAL------SEDERKELRLFSAQRK 71
              + Y + L       E++ K +  F+ Q +
Sbjct: 100 RESLFYLNVLDIPPNSDENKDKNIIKFALQNR 131


>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a.  The first LIM
           domain of Lmx1a: Lmx1a belongs to the LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Mouse Lmx1a is
           expressed in multiple tissues, including the roof plate
           of the neural tube, the developing brain, the otic
           vesicles, the notochord, and the pancreas. Human Lmx1a
           can be found in pancreas, skeletal muscle, adipose
           tissue, developing brain, mammary glands, and pituitary.
            The functions of Lmx1a in the developing nervous system
           were revealed by studies of mutant mouse. In mouse,
           mutations in Lmx1a result in failure of the roof plate
           to develop.  Lmx1a may act upstream of other roof plate
           markers such as MafB, Gdf7, Bmp 6, and Bmp7. Further
           characterization of these mice reveals numerous defects
           including disorganized cerebellum, hippocampus, and
           cortex; altered pigmentation; female sterility; skeletal
           defects; and behavioral abnormalities. Within pancreatic
           cells, the Lmx1a protein interacts synergistically with
           the bHLH transcription factor E47 to activate the
           insulin gene enhancer/promoter. As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 52

 Score = 30.5 bits (69), Expect = 0.095
 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           +S WH  C  C+ C E L     FYR  KLYC   +
Sbjct: 18  DSLWHERCLQCASCKEPLETTC-FYRDKKLYCKEDY 52


>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin.  The
           second LIM domain of Leupaxin: Leupaxin is a
           cytoskeleton adaptor protein, which is preferentially
           expressed in hematopoietic cells. Leupaxin belongs to
           the paxillin focal adhesion protein family. Same as
           other members of the family, it has four leucine-rich
           LD-motifs in the N-terminus and four LIM domains in the
           C-terminus. It may function in cell type-specific
           signaling by associating with interaction partners PYK2,
           FAK, PEP and p95PKL.  When expressed in human leukocytic
           cells, leupaxin significantly suppressed
           integrin-mediated cell adhesion to fibronectin and the
           tyrosine phosphorylation of paxillin. These findings
           indicate that leupaxin may negatively regulate the
           functions of paxillin during integrin signaling. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 30.2 bits (68), Expect = 0.11
 Identities = 15/34 (44%), Positives = 17/34 (50%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           +  WHP  F CS C EL  D  +  R  K YC R
Sbjct: 17  DQTWHPEHFFCSHCGELFGDEGFLERDGKPYCRR 50


>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM
           domains protein 1.  The first LIM domain of Four and a
           half LIM domains protein 1 (FHL1):  FHL1 is heavily
           expressed in skeletal and cardiac muscles. It plays
           important roles in muscle growth, differentiation, and
           sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes. .
          Length = 54

 Score = 30.1 bits (68), Expect = 0.12
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           N  WH  CF C+ C + L +  +  + +K+ CG+
Sbjct: 19  NRYWHETCFRCAKCYKPLANEPFVAKDNKILCGK 52


>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP).
           The LIM domain of LIM and SH3 Protein (LASP):  LASP
           family contains two highly homologous members, LASP-1
           and LASP-2. LASP contains a LIM motif at its amino
           terminus, a src homology 3 (SH3) domains at its
           C-terminal part, and a nebulin-like region in the
           middle. LASP-1 and -2 are highly conserved in their LIM,
           nebulin-like, and SH3 domains ,but differ significantly
           at their linker regions. Both proteins are ubiquitously
           expressed and involved in cytoskeletal architecture,
           especially in the organization of focal adhesions.
           LASP-1 and LASP-2, are important during early embryo-
           and fetogenesis and are highly expressed in the central
           nervous system of the adult. However, only LASP-1 seems
           to participate significantly in neuronal differentiation
           and plays an important functional role in migration and
           proliferation of certain cancer cells while the role of
           LASP-2 is more structural. The expression of LASP-1 in
           breast tumors is increased significantly. As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 30.0 bits (68), Expect = 0.13
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRG-DKL-YCGRHH 146
           WH GCF C VC   L   +  Y+G +K  YC  H+
Sbjct: 21  WHKGCFKCEVCGMTLN--MKNYKGYNKKPYCNAHY 53


>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin.  The
           third LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 53

 Score = 30.2 bits (68), Expect = 0.13
 Identities = 13/36 (36%), Positives = 18/36 (50%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           N+ WHP CF C  C    V+  +F    + YC  H+
Sbjct: 17  NTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEAHY 52


>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein
           (CRP) family.  The LIM domains of Cysteine Rich Protein
           (CRP) family: Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to a short glycine-rich repeats (GRRs). The known CRP
           family members include CRP1, CRP2, and CRP3/MLP. CRP1,
           CRP2 and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription control, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network. CRP1, CRP2, and CRP3/MLP are involved in
           promoting protein assembly along the actin-based
           cytoskeleton. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 29.9 bits (68), Expect = 0.14
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 102 SVFAS--RAGPNSCWHPGCFTCSVCN 125
           SV+A+         WH  CFTC+VCN
Sbjct: 7   SVYAAEEVIAAGKSWHKSCFTCAVCN 32


>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX
           protein family.  The first LIM domain of Isl: Isl is a
           member of LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Isl1 and Isl2 are the two conserved members
           of this family. Proteins in this group are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Isl-1 is one of the LHX proteins
           isolated originally by virtue of its ability to bind DNA
           sequences from the 5'-flanking region of the rat insulin
           gene in pancreatic insulin-producing cells. Mice
           deficient in Isl-1 fail to form the dorsal exocrine
           pancreas and islet cells fail to differentiate. On the
           other hand, Isl-1 takes part in the pituitary
           development by activating the gonadotropin-releasing
           hormone receptor gene together with LHX3 and
           steroidogenic factor 1. Mouse Is l2 is expressed in the
           retinal ganglion cells and the developing spinal cord
           where it plays a role in motor neuron development. Same
           as Isl1, Isl2 may also be able to bind to the insulin
           gene enhancer to promote gene activation. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 30.0 bits (68), Expect = 0.14
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 107 RAGPNSCWHPGCFTCSVCNELLVD-LIYFYRGDKLYCGRHH 146
           R  P+  WH  C  C+ C + L +    F R  K YC R +
Sbjct: 15  RVAPDLEWHAACLKCAECGQYLDETCTCFVRDGKTYCKRDY 55


>gnl|CDD|188785 cd09401, LIM_TLP_like, The  LIM domains of thymus LIM protein
           (TLP).  The LIM domain of thymus LIM protein (TLP) like
           proteins:  This family includes the LIM domains of TLP
           and CRIP (Cysteine-Rich Intestinal Protein). TLP is the
           distant member of the CRP family of proteins. TLP has
           two isomers (TLP-A and TLP-B) and sharing approximately
           30% with each of the three other CRPs.  Like CRP1, CRP2
           and CRP3/MLP, TLP has two LIM domains, connected by a
           flexible linker region. Unlike the CRPs, TLP lacks the
           nuclear targeting signal (K/R-K/R-Y-G-P-K) and is
           localized solely in the cytoplasm. TLP is specifically
           expressed in the thymus in a subset of cortical
           epithelial cells.  TLP has a role in development of
           normal thymus and in controlling the development and
           differentiation of thymic epithelial cells. CRIP is a
           short LIM protein with only one LIM domain. CRIP gene is
           developmentally regulated and can be induced by
           glucocorticoid hormones during the first three postnatal
           weeks. The domain shows close sequence homology to LIM
           domain of thymus LIM protein. However, unlike the TLP
           proteins which have two LIM domains, the members of this
           family have only one LIM domain. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 30.0 bits (68), Expect = 0.15
 Identities = 9/29 (31%), Positives = 11/29 (37%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  C  C  C + L    +     K YC
Sbjct: 21  WHKPCLRCEKCKKTLTPGQHSEHEGKPYC 49


>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH.  The
           first LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 30.0 bits (68), Expect = 0.15
 Identities = 13/54 (24%), Positives = 22/54 (40%), Gaps = 4/54 (7%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           CE C +     D  +  S       +H  CF C+ C +   D +++    + YC
Sbjct: 1   CERCREGF-EPDEKIVNSNG---ELYHEQCFVCAQCFQPFPDGLFYEFEGRKYC 50


>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4
           family.  The first LIM domain of Lhx3-Lhx4 family: Lhx3
           and Lhx4 belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. The LHX3 and LHX4
           LIM-homeodomain transcription factors play essential
           roles in pituitary gland and nervous system development.
           Although LHX3 and LHX4 share marked sequence homology,
           the genes have different expression patterns. They play
           overlapping, but distinct functions during the
           establishment of the specialized cells of the mammalian
           pituitary gland and the nervous system. Lhx3 proteins
           have been demonstrated the ability to directly bind to
           the promoters/enhancers of several pituitary hormone
           gene promoters to cause increased transcription. Lhx3a
           and Lhx3b, whose mRNAs have distinct temporal expression
           profiles during development, are two isoforms of Lhx3.
           LHX4 plays essential roles in pituitary gland and
           nervous system development. In mice, the lhx4 gene is
           expressed in the developing hindbrain, cerebral cortex,
           pituitary gland, and spinal cord. LHX4 shows significant
           sequence similarity to LHX3, particularly to isoforms
           Lhx3a. In gene regulation experiments, the LHX4 protein
           exhibits regulation roles towards pituitary genes,
           acting on their promoters/enhancers. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 52

 Score = 29.7 bits (67), Expect = 0.17
 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 1/30 (3%)

Query: 113 CWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
            WH  C  C+ C   L D   F R   +YC
Sbjct: 20  TWHAKCLKCNDCGAQLTDKC-FARNGHVYC 48


>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM
           (abLIM) proteins.  The third LIM domain of actin binding
           LIM (abLIM) proteins: Three homologous members of the
           abLIM protein family have been identified; abLIM-1,
           abLIM-2 and abLIM-3. The N-terminal of abLIM consists of
           four tandem repeats of LIM domains and the C-terminal of
           acting binding LIM protein is a villin headpiece domain,
           which has strong actin binding activity. The abLIM-1,
           which is expressed in retina, brain, and muscle tissue,
           has been indicated to function as a tumor suppressor.
           AbLIM-2 and -3, mainly expressed in muscle and neuronal
           tissue, bind to F-actin strongly.  They may serve as a
           scaffold for signaling modules of the actin cytoskeleton
           and thereby modulate transcription. It has shown that
           LIM domains of abLIMs interact with STARS (striated
           muscle activator of Rho signaling), which directly binds
           actin and stimulates serum-response factor
           (SRF)-dependent transcription. All LIM domains are 50-60
           amino acids in size and share two characteristic highly
           conserved zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 29.6 bits (67), Expect = 0.20
 Identities = 7/15 (46%), Positives = 9/15 (60%)

Query: 114 WHPGCFTCSVCNELL 128
           WH  CF C  C ++L
Sbjct: 21  WHVWCFKCKECGKVL 35


>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin.  The
           first LIM domain of Leupaxin: Leupaxin is a cytoskeleton
           adaptor protein, which is preferentially expressed in
           hematopoietic cells.  Leupaxin belongs to the paxillin
           focal adhesion protein family. Same as other members of
           the family, it has four leucine-rich LD-motifs in the
           N-terminus and four LIM domains in the C-terminus. It
           may function in cell type-specific signaling by
           associating with interaction partners PYK2, FAK, PEP and
           p95PKL.  When expressed in human leukocytic cells,
           leupaxin significantly suppressed integrin-mediated cell
           adhesion to fibronectin and the tyrosine phosphorylation
           of paxillin. These findings indicate that leupaxin may
           negatively regulate the functions of paxillin during
           integrin signaling. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 29.5 bits (66), Expect = 0.20
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WHP  F C  C + L    +F R  + YC
Sbjct: 22  WHPEHFVCCQCGKELGSRPFFERNGQAYC 50


>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher
           family.  The first LIM domain of ZASP/Cypher family:
           ZASP was identified in human heart and skeletal muscle
           and Cypher is a mice ortholog of ZASP. ZASP/Cyppher
           contains three LIM domains at the C-terminus and a PDZ
           domain at N-terminus.  ZASP/Cypher is required for
           maintenance of Z-line structure during muscle
           contraction, but not required for Z-line assembly. In
           heart, Cypher/ZASP plays a structural role through its
           interaction with cytoskeletal Z-line proteins. In
           addition, there is increasing evidence that Cypher/ZASP
           also performs signaling functions. Studies reveal that
           Cypher/ZASP interacts with and directs PKC to the
           Z-line, where PKC phosphorylates downstream signaling
           targets. LIM domains are 50-60 amino acids in size and
           share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 52

 Score = 29.2 bits (65), Expect = 0.23
 Identities = 11/31 (35%), Positives = 16/31 (51%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           WHP  FTC  C+  L D+ +    + +YC  
Sbjct: 20  WHPEEFTCHYCHTSLADVSFVEEQNNVYCEN 50


>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase
           domains protein (Ltd-1).  The LIM domain of LIM and
           transglutaminase domains protein (Ltd-1): This family
           includes mouse Ky protein and Caenorhabditis elegans
           Ltd-1 protein. The members of this family consists a
           N-terminal  Lim domain and a C-terminal transglutaminase
           domain. The mouse Ky protein has  putative function in
           muscle development. The mouse with ky mutant exhibits
           combined posterior and lateral curvature of the spine.
           The Ltd-1 gene in C. elegans is expressed in developing
           hypodermal cells from the twofold stage embryo through
           adulthood. These data define the ltd-1 gene as a novel
           marker for C. elegans epithelial cell development. As in
           other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 29.3 bits (66), Expect = 0.28
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 114 WHPGCFTCSVCN-ELLVDLIYFYRGDK-LYCGRH 145
           +H GCF C  C   L +    F +GD  +YC RH
Sbjct: 21  YHKGCFKCRECGTRLSLKTFTFVQGDGEVYCARH 54


>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and
           RhoGap domain containing protein.  The third LIM domain
           of Lrg1p, a LIM and RhoGap domain containing protein:
           The members of this family contain three tandem repeats
           of LIM domains and a Rho-type GTPase activating protein
           (RhoGap) domain. Lrg1p is a Rho1 GTPase-activating
           protein required for efficient cell fusion in yeast.
           Lrg1p-GAP domain strongly and specifically stimulates
           the GTPase activity of Rho1p, a regulator of beta
           (1-3)-glucan synthase in vitro. The LIM domain is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 56

 Score = 29.2 bits (66), Expect = 0.30
 Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 4/35 (11%)

Query: 114 WHPGCFTCSVCNEL----LVDLIYFYRGDKLYCGR 144
           WH  CFTCS C+      L D  +  +  ++ C  
Sbjct: 20  WHLKCFTCSRCHREISSELSDAAFNNKDQRILCSN 54


>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin.  The
           third LIM domain of Leupaxin: Leupaxin is a cytoskeleton
           adaptor protein, which is preferentially expressed in
           hematopoietic cells. Leupaxin belongs to the paxillin
           focal adhesion protein family. Same as other members of
           the family, it has four leucine-rich LD-motifs in the
           N-terminus and four LIM domains in the C-terminus. It
           may function in cell type-specific signaling by
           associating with interaction partners PYK2, FAK, PEP and
           p95PKL.  When expressed in human leukocytic cells,
           leupaxin significantly suppressed integrin-mediated cell
           adhesion to fibronectin and the tyrosine phosphorylation
           of paxillin. These findings indicate that leupaxin may
           negatively regulate the functions of paxillin during
           integrin signaling. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 53

 Score = 29.0 bits (65), Expect = 0.31
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 6/58 (10%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           C  C   ++ + +S        N  WHP CF CS C +   D  +F    +  C  H+
Sbjct: 1   CSGCGRPVKENYLSAA------NGVWHPECFVCSDCLKPFTDGSFFELDGRPLCELHY 52


>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only
           protein 4).  The second LIM domain of LMO4 (LIM domain
           only protein 4): LMO4 is a nuclear protein that plays
           important roles in transcriptional regulation and
           development. LMO4 is involved in various functions in
           tumorigenesis and cellular differentiation. LMO4
           proteins regulate gene expression by interacting with a
           wide variety of transcription factors and cofactors to
           form large transcription complexes. It can interact with
           Smad proteins, and associate with the promoter of the
           PAI-1 (plasminogen activator inhibitor-1) gene in a
           TGFbeta (transforming growth factor beta)-dependent
           manner. LMO4 can also form a complex with transcription
           regulator CREB (cAMP response element-binding protein)
           and interact with CLIM1 and CLIM2. In breast tissue,
           LMO4 interacts with multiple proteins, including the
           cofactor CtIP [CtBP (C-terminal binding
           protein)-interacting protein], the breast and ovarian
           tumor suppressor BRCA1 (breast-cancer susceptibility
           gene 1) and the LIM-domain-binding protein LDB1.
           Functionally, LMO4 is shown to repress BRCA1-mediated
           transcription activation, thus invoking a potential role
           for LMO4 as a negative regulator of BRCA1 in sporadic
           breast cancer.  LMO4 also forms complex to both ERa
           (oestrogen receptor alpha), MTA1 (metastasis tumor
           antigen 1), and HDACs (histone deacetylases), implying
           that LMO4 is also a component of the MTA1 corepressor
           complex. Over-expressed LMO4 represses ERa
           transactivation functions in an HDAC-dependent manner,
           and contributes to the process of breast cancer
           progression by allowing the development of Era-negative
           phenotypes. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 29.0 bits (65), Expect = 0.37
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLV--DLIYFYRGDKLYCGRHH 146
           C  C   +  S++ +   RA  N  +H  CFTCS C+  LV  D  ++  G  L+C    
Sbjct: 1   CSACGQSIPASELVM---RAQGN-VYHLKCFTCSTCHNQLVPGDRFHYVNG-SLFCEHDR 55


>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma.  The third
           LIM domain of Enigma: Enigma was initially characterized
           in humans as a protein containing three LIM domains at
           the C-terminus and a PDZ domain at N-terminus.  The
           third LIM domain specifically interacts with the insulin
           receptor and the second LIM domain interacts with the
           receptor tyrosine kinase Ret and the adaptor protein
           APS.  Thus Enigma is implicated in signal transduction
           processes such as mitogenic activity, insulin related
           actin organization, and glucose metabolism. Enigma is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone, and brain.  LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 55

 Score = 28.9 bits (64), Expect = 0.38
 Identities = 11/32 (34%), Positives = 16/32 (50%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           WH  CF C++C   L    ++ + DK  C  H
Sbjct: 22  WHDTCFVCAICQINLEGKTFYSKKDKPLCKSH 53


>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein
           (CRP).  The second LIM domain of Cysteine Rich Protein
           (CRP): Cysteine-rich proteins (CRPs) are characterized
           by the presence of two LIM domains linked to a short
           glycine-rich repeats (GRRs). The CRP family members
           include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
           a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
           which supports the fact that these proteins function not
           only in the cytoplasm but also in the nucleus. CRPs
           control regulatory pathways during cellular
           differentiation, and involve in complex transcription
           control, and the organization as well as the arrangement
           of the myofibrillar/cytoskeletal network. It is evident
           that CRP1, CRP2, and CRP3/MLP are involved in promoting
           protein assembly along the actin-based cytoskeleton.
           Although members of the CRP family share common binding
           partners, they are also capable of recognizing different
           and specific targets. LIM domains are 50-60 amino acids
           in size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residu es,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 54

 Score = 28.7 bits (64), Expect = 0.38
 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 9/56 (16%)

Query: 89  CENCEDELQTSDMSVFASRA--GPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           C  C         SV+A+    G    WH  CF C+ C + L       +  ++YC
Sbjct: 1   CPRCGK-------SVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLADKDGEIYC 49


>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid
           receptor-interacting protein 6 (TRIP6).  The second LIM
           domain of Thyroid receptor-interacting protein 6
           (TRIP6): TRIP6 is a member of the zyxin LIM protein
           family and contains three LIM zinc-binding domains at
           the C-terminal. TRIP6 protein localizes to focal
           adhesion sites and along actin stress fibers.
           Recruitment of this protein to the plasma membrane
           occurs in a lysophosphatidic acid (LPA)-dependent
           manner. TRIP6 recruits a number of molecules involved in
           actin assembly, cell motility, survival and
           transcriptional control. The function of TRIP6 in cell
           motility is regulated by Src-dependent phosphorylation
           at a Tyr residue. The phosphorylation activates the
           coupling to the Crk SH2 domain, which is required for
           the function of TRIP6 in promoting lysophosphatidic acid
           (LPA)-induced cell migration. TRIP6 can shuttle to the
           nucleus to serve as a coactivator of AP-1 and NF-kappaB
           transcriptional factors. Moreover, TRIP6 can form a
           ternary complex with the NHERF2 PDZ protein and LPA2
           receptor to regulate LPA-induced activation of ERK and
           AKT, rendering cells resistant to chemotherapy. Recent
           evidence shows that TRIP6 antagonizes Fas-Induced
           apoptosis by enhancing the antiapoptotic effect of LPA
           in cells. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 28.7 bits (64), Expect = 0.38
 Identities = 9/15 (60%), Positives = 11/15 (73%)

Query: 114 WHPGCFTCSVCNELL 128
           +HP CFTC VC+  L
Sbjct: 20  YHPHCFTCVVCHRSL 34


>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein
           (LASP)-like proteins.  The LIM domain of LIM and SH3
           Protein (LASP) like proteins:  This family contains two
           types of LIM containing proteins; LASP and N-RAP. LASP
           family contains two highly homologous members, LASP-1
           and LASP-2. LASP contains a LIM motif at its amino
           terminus, a src homology 3 (SH3) domains at its
           C-terminal part, and a nebulin-like region in the
           middle. LASP-1 and -2 are highly conserved in their LIM,
           nebulin-like, and SH3 domains, but differ significantly
           at their linker regions. Both proteins are ubiquitously
           expressed and involved in cytoskeletal architecture,
           especially in the organization of focal adhesions.
           LASP-1 and LASP-2, are important during early embryo-
           and fetogenesis and are highly expressed in the central
           nervous system of the adult. However, only LASP-1 seems
           to participate significantly in neuronal differentiation
           and plays an important functional role in migration and
           proliferation of certain cancer cells while the role of
           LASP-2 is more structural. The expression of LASP-1 in
           breast tumors is increased significantly.  N-RAP is a
           muscle-specific protein concentrated at myotendinous
           junctions in skeletal muscle and intercalated disks in
           cardiac muscle. LIM domain is found at the N-terminus of
           N-RAP and the C-terminal of N-RAP contains a region with
           multiple of nebulin repeats. N-RAP functions as a
           scaffolding protein that organizes alpha-actinin and
           actin into symmetrical I-Z-I structures in developing
           myofibrils. Nebulin repeat is known as actin binding
           domain. The N-RAP is hypothesized to form antiparallel
           dimerization via its LIM domain. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 28.8 bits (64), Expect = 0.39
 Identities = 13/33 (39%), Positives = 14/33 (42%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           WH  CF C VC   L    Y     K YC  H+
Sbjct: 21  WHKACFHCEVCKMTLNMNNYKGYQKKPYCNAHY 53


>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP.  The LIM domain of
           N-RAP:  N-RAP is a muscle-specific protein concentrated
           at myotendinous junctions in skeletal muscle and
           intercalated disks in cardiac muscle. LIM domain is
           found at the N-terminus of N-RAP and the C-terminal of
           N-RAP contains a region with multiple of nebulin
           repeats. N-RAP functions as a scaffolding protein that
           organizes alpha-actinin and actin into symmetrical I-Z-I
           structures in developing myofibrils. Nebulin repeat is
           known as actin binding domain. The N-RAP is hypothesized
           to form antiparallel dimerization via its LIM domain. As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 28.7 bits (64), Expect = 0.41
 Identities = 12/33 (36%), Positives = 15/33 (45%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           WH  CF C VC  +L    +     K YC  H+
Sbjct: 21  WHKACFHCEVCKMMLTVNNFVSHQKKPYCQAHN 53


>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like
           family.  The second LIM domain of Testin-like family:
           This family includes testin, prickle, dyxin and
           LIMPETin. Structurally, testin and prickle proteins
           contain three LIM domains at C-terminal; LIMPETin has
           six LIM domains; and dyxin presents only two LIM
           domains. However, all members of the family contain a
           PET protein-protein interaction domain.  Testin is a
           cytoskeleton associated focal adhesion protein that
           localizes along actin stress fibers, at
           cell-cell-contact areas, and at focal adhesion plaques.
           Testin interacts with a variety of cytoskeletal
           proteins, including zyxin, mena, VASP, talin, and actin
           and it is involved in cell motility and adhesion events.
           Prickles have been implicated in roles of regulating
           tissue polarity or planar cell polarity (PCP).  Dyxin
           involves in lung and heart development by interaction
           with GATA6 and blocking GATA6 activated target genes.
           LIMPETin might be the recombinant product of genes
           coding testin and four and half LIM proteins and its
           function is not well understood. As in other LIM
           domains, this domain family is 50-60 amino acids in size
           and shares two characteristic zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 28.7 bits (65), Expect = 0.46
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH   F C  C+E L    Y  R  K YC
Sbjct: 23  WHLKHFCCFQCDEPLGGQRYVLREGKPYC 51


>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b.  The first LIM
           domain of Lhx3b. Lhx3b is a member of LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx3b is one of
           the two isoforms of Lhx3. The Lhx3 gene is expressed in
           the ventral spinal cord, the pons, the medulla
           oblongata, and the pineal gland of the developing
           nervous system during mouse embryogenesis, and
           transcripts are found in the emergent pituitary gland.
           Lhx3 functions in concert with other transcription
           factors to specify interneuron and motor neuron fates
           during development. Lhx3 proteins have been demonstrated
           to directly bind to the promoters of several pituitary
           hormone gene promoters. The Lhx3 gene encodes two
           isoforms, LHX3a and LHX3b that differ in their
           amino-terminal sequences, where Lhx3a has longer
           N-terminal.  They show differential activation of
           pituitary hormone genes and distinct DNA binding
           properties. In human, Lhx3a trans-activated the
           alpha-glycoprotein subunit promoter and genes containing
           a high-affinity Lhx3 binding site more effectively than
           the hLhx3b isoform. In addition, hLhx3a induce
           transcription of the TSHbeta-subunit gene by acting on
           pituitary POU domain factor, Pit-1, while hLhx3b does
           not. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 55

 Score = 28.7 bits (64), Expect = 0.47
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  C  CS C   L +   F RGD +YC
Sbjct: 24  WHSKCLKCSDCQTQLAEKC-FSRGDSVYC 51


>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX
           protein family.  The second LIM domain of Isl: Isl is a
           member of LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Isl1 and Isl2 are the two conserved members
           of this family. Proteins in this group are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Isl-1 is one of the LHX proteins
           isolated originally by virtue of its ability to bind DNA
           sequences from the 5'-flanking region of the rat insulin
           gene in pancreatic insulin-producing cells. Mice
           deficient in Isl-1 fail to form the dorsal exocrine
           pancreas and islet cells fail to differentiate. On the
           other hand, Isl-1 takes part in the pituitary
           development by activating the gonadotropin-releasing
           hormone receptor gene together with LHX3 and
           steroidogenic factor 1. Mouse Isl2 is expressed in the
           retinal ganglion cells and the developing spinal cord
           where it plays a role in motor neuron development. Same
           as Isl1, Isl2 may also be able to bind to the insulin
           gene enhancer to promote gene activation. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 28.6 bits (64), Expect = 0.47
 Identities = 19/59 (32%), Positives = 25/59 (42%), Gaps = 5/59 (8%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYF-YRGDKLYCGRHH 146
           C  C+     +D   F  RA     +H  CF CS C+  L+    F  R D L+C   H
Sbjct: 1   CAKCQQSFSKND---FVMRAR-TKIYHIECFRCSACSRQLIPGDEFALRDDGLFCKADH 55


>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH.  The
           fourth LIM domain of protein PINCH: PINCH plays a
           pivotal role in the assembly of focal adhesions (FAs),
           regulating diverse functions in cell adhesion, growth,
           and differentiation through LIM-mediated protein-protein
           interactions. PINCH comprises an array of five LIM
           domains that interact with integrin-linked kinase (ILK),
           Nck2 (also called Nckbeta or Grb4) and other interaction
           partners. These interactions are essential for
           triggering the FA assembly and for relaying diverse
           mechanical and biochemical signals between
           Cell-extracellular matrix and the actin cytoskeleton.
           The PINCH LIM4 domain recognizes the third SH3 domain of
           another adaptor protein, Nck2. This step is an important
           component of integrin signaling event. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the assem
           bly of multimeric protein complexes.
          Length = 54

 Score = 28.5 bits (64), Expect = 0.53
 Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 6/57 (10%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           C  C   ++     V A        WH   F C+ C +  +   ++ +    YC  H
Sbjct: 3   CGACRRPIE--GRVVTAL----GKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETH 53


>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM
           domains protein 1 (FHL1).  The fourth LIM domain of Four
           and a half LIM domains protein 1 (FHL1):  FHL1 is
           heavily expressed in skeletal and cardiac muscles. It
           plays important roles in muscle growth, differentiation,
           and sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 64

 Score = 28.6 bits (64), Expect = 0.57
 Identities = 10/31 (32%), Positives = 16/31 (51%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           S WH  CF C  C+  L +  + +   ++YC
Sbjct: 27  SSWHDYCFNCKKCSLNLANKRFVFHNGQIYC 57


>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin. 
           The fourth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the Testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 28.2 bits (63), Expect = 0.66
 Identities = 9/30 (30%), Positives = 14/30 (46%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCG 143
           WH  CF C  C + +    +  + D +YC 
Sbjct: 22  WHEKCFCCCECKQPIGTKSFIPKDDDVYCV 51


>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM
           domains protein (FHL).  The third LIM domain of Four and
           a half LIM domains protein (FHL): LIM-only protein
           family consists of five members, designated FHL1, FHL2,
           FHL3, FHL5 and LIMPETin. The first four members are
           composed of four complete LIM domains arranged in tandem
           and an N-terminal single zinc finger domain with a
           consensus sequence equivalent to the C-terminal half of
           a LIM domain. LIMPETin is an exception, containing six
           LIM domains. FHL1, 2 and 3 are predominantly expressed
           in muscle tissues, and FHL5 is highly expressed in male
           germ cells.  FHL proteins exert their roles as
           transcription co-activators or co-repressors through a
           wide array of interaction partners. For example, FHL1
           binds to Myosin-binding protein C, regulating myosin
           filament formation and sarcomere assembly. FHL2 has
           shown to interact with more than 50 different proteins,
           including receptors, structural proteins, transcription
           factors and cofactors, signal transducers, splicing
           factors, DNA replication and repair enzymes, and
           metabolic enzymes. FHL3 int eracts with many
           transcription factors, such as CREB, BKLF/KLF3, CtBP2,
           MyoD, and MZF_1. FHL5 is a tissue-specific coactivator
           of CREB/CREM family transcription factors. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 27.7 bits (62), Expect = 0.75
 Identities = 10/29 (34%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  CF C+ C + L    +  R +  YC
Sbjct: 20  WHKECFVCTGCKKQLAGQRFTSRDEYPYC 48


>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like
           proteins.  The first LIM domain of Ajuba-like proteins:
           Ajuba like LIM protein family includes three highly
           homologous proteins Ajuba, Limd1, and WTIP. Members of
           the family contain three tandem C-terminal LIM domains
           and a proline-rich N-terminal region. This family of
           proteins functions as scaffolds, participating in the
           assembly of numerous protein complexes. In the
           cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated
           ERK activation. Ajuba also recruits the TNF
           receptor-associated factor 6 (TRAF6) to p62 and
           activates PKCKappa activity. Ajuba interacts with
           alpha-catenin and F-actin to contribute to the formation
           or stabilization of adheren junctions by linking
           adhesive receptors to the actin cytoskeleton. Although
           Ajuba is a cytoplasmic protein, it can shuttle into the
           nucleus. In nucleus, Ajuba functions as a corepressor
           for the zinc finger-protein Snail. It binds to the SNAG
           repression domain of Snail through its LIM region.
           Arginine methyltransferase-5 (Prmt5), a protein in the
           complex, is recruited to Snai l through an interaction
           with Ajuba. This ternary complex functions to repress
           E-cadherin, a Snail target gene. In addition, Ajuba
           contains functional nuclear-receptor interacting motifs
           and selectively interacts with retinoic acid receptors
           (RARs) and rexinoid receptor (RXRs) to negatively
           regulate retinoic acid signaling. Wtip, the
           Wt1-interacting protein, was originally identified as an
           interaction partner of the Wilms tumour protein 1 (WT1).
           Wtip is involved in kidney and neural crest development.
           Wtip interacts with the receptor tyrosine kinase Ror2
           and inhibits canonical Wnt signaling. LIMD1 was reported
           to inhibit cell growth and metastases. The inhibition
           may be mediated through an interaction with the protein
           barrier-to-autointegration (BAF), a component of SWI/SNF
           chromatin-remodeling protein; or through the interaction
           with retinoblastoma protein (pRB), resulting in
           inhibition of E2F-mediated transcription, and expression
           of the majority of genes with E2F1- responsive elements.
           Recently, Limd1 was shown to interact with the
           p62/sequestosome protein and influence IL-1 and RANKL
           signaling by facilitating the assembly of a
           p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62
           interaction affects both NF-kappaB and AP-1 activity in
           epithelial cells and osteoclasts. Moreover, LIMD1
           functions as tumor repressor to block lung tumor cell
           line in vitro and in vivo. Recent studies revealed that
           LIM proteins Wtip, LIMD1 and Ajuba interact with
           components of RNA induced silencing complexes (RISC) as
           well as eIF4E and the mRNA m7GTP cap-protein complex and
           are required for microRNA-mediated gene silencing.  As
           in other LIM domains, this domain family is 50-60 amino
           acids in size and shares two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 27.8 bits (62), Expect = 0.78
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           + +H  CFTC  C   L    ++    K+YC
Sbjct: 20  NLYHTNCFTCCSCGRTLRGKAFYNVNGKVYC 50


>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH.  The
           fifth LIM domain of protein PINCH:  PINCH plays pivotal
           roles in the assembly of focal adhesions (FAs),
           regulating diverse functions in cell adhesion, growth,
           and differentiation through LIM-mediated protein-protein
           interactions. PINCH comprises an array of five LIM
           domains that interact with integrin-linked kinase (ILK),
           Nck2 (also called Nckbeta or Grb4) and other interaction
           partners.  These interactions are essential for
           triggering the FA assembly and for relaying diverse
           mechanical and biochemical signals between
           Cell-extracellular matrix and the actin cytoskeleton.
           LIM domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 27.7 bits (62), Expect = 0.80
 Identities = 14/47 (29%), Positives = 17/47 (36%), Gaps = 11/47 (23%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETLKPRCSAC 157
           N  W    F+CS C+  L     FY  D           +KP C  C
Sbjct: 17  NKTWCVDHFSCSFCDTKLTLKSKFYEFD-----------MKPVCKKC 52


>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A.
           The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A
           belong to the CRP LIM domain protein family. The Mlp84B
           protein contains five copies of the LIM domains, each
           followed by a Glycin Rich Region (GRR). However, only
           the first LIM domain of Mlp84B is in this family. Mlp60A
           exhibits only one LIM domain linked to a glycin-rich
           region. Mlp84B and Mlp60A are muscle specific proteins
           and have been implicated in muscle differentiation.
           While Mlp84B transcripts are enriched at the terminal
           ends of muscle fibers, Mlp60A transcripts are found
           throughout the muscle fibers. All LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 27.8 bits (62), Expect = 0.88
 Identities = 9/15 (60%), Positives = 11/15 (73%)

Query: 114 WHPGCFTCSVCNELL 128
           WH  CF C +CN+LL
Sbjct: 22  WHKMCFKCGMCNKLL 36


>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8.
           The first LIM domain of Lhx7 and Lhx8:  Lhx7 and Lhx8
           belong to the LHX protein family, which features two
           tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs such as the pituitary
           gland and the pancreas.  Studies using mutant mice have
           revealed roles for Lhx7 and Lhx8 in the development of
           cholinergic neurons in the telencephalon and in basal
           forebrain development. Mice lacking alleles of the
           LIM-homeobox gene Lhx7 or Lhx8 display dramatically
           reduced number of forebrain cholinergic neurons. In
           addition, Lhx7 mutation affects male and female mice
           differently, with females appearing more affected than
           males. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 56

 Score = 27.6 bits (61), Expect = 0.96
 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 113 CWHPGCFTCSVCNELLVDLIYFYRGDK-LYC 142
           CWH  C +CSVC   L      Y  DK ++C
Sbjct: 21  CWHVRCLSCSVCRTSLGRHTSCYIKDKDIFC 51


>gnl|CDD|188751 cd09365, LIM2_LIMK, The second LIM domain of LIMK (LIM domain
           Kinase ).  The second LIM domain of LIMK (LIM domain
           Kinase ): LIMK protein family is  comprised of two
           members LIMK1 and LIMK2. LIMK contains two LIM domains,
           a PDZ domain and a kinase domain. LIMK is involved in
           the regulation of actin polymerization and microtubule
           disassembly. LIMK influences architecture of the actin
           cytoskeleton by regulating the activity of the cofilin
           family proteins cofilin1, cofilin2, and destrin. The
           mechanism of the activation is to phosphorylates cofilin
           on serine 3 and inactivates its actin-severing activity,
           and altering the rate of actin depolymerization. LIMKs
           can function in both cytoplasm and nucleus and are
           expressed in all tissues. Both LIMK1 and LIMK2 can act
           in the nucleus to suppress Rac/Cdc42-dependent cyclin D1
           expression. However, LIMK1 and LIMk2 have different
           cellular locations. While LIMK1 localizes mainly at
           focal adhesions, LIMK2 is found in cytoplasmic punctae,
           suggesting that they may have different cellular
           functions. The LIM domains of LIMK have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 27.3 bits (61), Expect = 1.1
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%)

Query: 114 WHPGCFTCSVCNELLVD--LIYFYRGDKLYCG 143
           +HP CF+CS C   + D          KLYCG
Sbjct: 20  FHPECFSCSSCKAFIGDGDSYALVERSKLYCG 51


>gnl|CDD|215938 pfam00481, PP2C, Protein phosphatase 2C.  Protein phosphatase 2C is
           a Mn++ or Mg++ dependent protein serine/threonine
           phosphatase.
          Length = 252

 Score = 29.6 bits (67), Expect = 1.1
 Identities = 19/93 (20%), Positives = 25/93 (26%), Gaps = 28/93 (30%)

Query: 50  RYCHALSEDERKELRLFSAQRKREALGRGFVKQLVAPMFCENCEDELQTSDMSVFASRAG 109
           +Y     E      R F    K +AL + F                L+  +     S A 
Sbjct: 50  KYAGKHLETILALRRSFLTLDKLDALRKSF----------------LEADEE--LRSDAA 91

Query: 110 PNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
            +     G  T  V            RG KLY 
Sbjct: 92  NHEDLSSGS-TAVVA---------LIRGQKLYV 114


>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM
           (abLIM) proteins.  The second LIM domain of actin
           binding LIM (abLIM) proteins:  Three homologous members
           of the abLIM protein family have been identified;
           abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
           consists of four tandem repeats of LIM domains and the
           C-terminal of acting binding LIM protein is a villin
           headpiece domain, which has strong actin binding
           activity. The abLIM-1, which is expressed in retina,
           brain, and muscle tissue, has been indicated to function
           as a tumor suppressor. AbLIM-2 and -3, mainly expressed
           in muscle and neuronal tissue, bind to F-actin strongly.
            They may serve as a scaffold for signaling modules of
           the actin cytoskeleton and thereby modulate
           transcription. It has shown that LIM domains of abLIMs
           interact with STARS (striated muscle activator of Rho
           signaling), which directly binds actin and stimulates
           serum-response factor (SRF)-dependent transcription. All
           LIM domains are 50-60 amino acids in size and share two
           characteristic highly conserved zinc finger motifs. The
           two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 56

 Score = 27.3 bits (61), Expect = 1.2
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 7/33 (21%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDK-LYCGRH 145
           +HP CF CSVC +       F  GD+  + G+ 
Sbjct: 23  YHPKCFVCSVCRQP------FPPGDRVTFNGKE 49


>gnl|CDD|180659 PRK06690, PRK06690, acetyl-CoA acetyltransferase; Provisional.
          Length = 361

 Score = 29.7 bits (67), Expect = 1.3
 Identities = 13/74 (17%), Positives = 27/74 (36%), Gaps = 15/74 (20%)

Query: 53  HALSEDERKELRLFSAQRKREALGRGFVKQLVAPMFCENCEDE--LQTSDMSVFASRAGP 110
           + ++ + + E    S +R  +AL +G++ + +         DE   +  +      R  P
Sbjct: 144 YNITREMQDEYACLSYKRTLQALEKGYIHEEILS--FNGLLDESIKKEMNYERIIKRTKP 201

Query: 111 -----------NSC 113
                      NSC
Sbjct: 202 AFLHNGTVTAGNSC 215


>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding
           LIM protein-1 (FBLP-1).  The second LIM domain of the
           filamin-binding LIM protein-1 (FBLP-1): Fblp-1 contains
           a proline-rich domain near its N terminus and two LIM
           domains at its C terminus. FBLP-1 mRNA was detected in a
           variety of tissues and cells including platelets and
           endothelial cells. FBLP-1 binds to Filamins. The
           association between filamin B and FBLP-1 may play an
           unknown role in cytoskeletal function, cell adhesion,
           and cell motility. As in other LIM domains, this domain
           family is 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 53

 Score = 27.0 bits (60), Expect = 1.5
 Identities = 7/11 (63%), Positives = 8/11 (72%)

Query: 114 WHPGCFTCSVC 124
           +HP CFTC  C
Sbjct: 20  YHPPCFTCVTC 30


>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM
           domains protein 1 (FHL1).  The third LIM domain of Four
           and a half LIM domains protein 1 (FHL1):  FHL1 is
           heavily expressed in skeletal and cardiac muscles. It
           plays important roles in muscle growth, differentiation,
           and sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 53

 Score = 27.1 bits (60), Expect = 1.5
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  CF CS C++ L    +    D+ YC
Sbjct: 20  WHSECFVCSSCSKKLAGQRFTAVEDQYYC 48


>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma.  The first
           LIM domain of Enigma: Enigma was initially characterized
           in humans as a protein containing three LIM domains at
           the C-terminus and a PDZ domain at N-terminus.  The
           third LIM domain specifically interacts with the insulin
           receptor and the second LIM domain interacts with the
           receptor tyrosine kinase Ret and the adaptor protein
           APS. Thus Enigma is implicated in signal transduction
           processes such as mitogenic activity, insulin related
           actin organization, and glucose metabolism. Enigma is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone and brain.  LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 27.1 bits (60), Expect = 1.5
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           +HP  FTCS C ++L +  +F     ++C
Sbjct: 20  YHPEEFTCSQCKKVLDEGGFFEEKGSIFC 48


>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma.  The second
           LIM domain of Enigma: Enigma was initially characterized
           in humans as a protein containing three LIM domains at
           the C-terminus and a PDZ domain at N-terminus.  The
           third LIM domain specifically interacts with the insulin
           receptor and the second LIM domain interacts with the
           receptor tyrosine kinase Ret and the adaptor protein
           APS.  Thus Enigma is implicated in signal transduction
           processes, such as mitogenic activity, insulin related
           actin organization, and glucose metabolism. Enigma is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone and brain.  LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 26.9 bits (59), Expect = 1.6
 Identities = 10/33 (30%), Positives = 16/33 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           WH  CFTC+ C   + +  ++      YC R +
Sbjct: 20  WHVHCFTCAACKTPIRNRAFYMEEGAPYCERDY 52


>gnl|CDD|236167 PRK08154, PRK08154, anaerobic benzoate catabolism transcriptional
           regulator; Reviewed.
          Length = 309

 Score = 29.5 bits (67), Expect = 1.6
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 5/49 (10%)

Query: 28  SPGEQYRIRQLLHQLPPHD-NEVRYCHALSEDERKELRLFSAQRKREAL 75
           S  +   IR+LL Q  P     VR   ALS       R   A+R+R AL
Sbjct: 94  SSPDWLLIRELLEQASPAQLARVRD--ALSGMLGAGRRA--ARRRRIAL 138


>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin.
           The sixth LIM domain of protein LIMPETin: LIMPETin
           contains 6 LIM domains at the C-terminal and an
           N-terminal PET domain. Four of the six LIM domains are
           highly homologous to the four and half LIM domain
           protein family and two of them show sequence similarity
           to the LIM domains of the testin family. Thus, LIMPETin
           may be the recombinant product of genes coding testin
           and FHL proteins.  In Schistosoma mansoni, where
           LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 27.1 bits (60), Expect = 1.7
 Identities = 10/29 (34%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  CF C+ C   LV   +   G ++ C
Sbjct: 24  WHNDCFNCAGCRTSLVGKGFITDGGRILC 52


>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL) like proteins.  The LIM domain on proteins of
           unknown function: This domain belongs to the LIM domain
           family which are found on Mical (molecule interacting
           with CasL)-like proteins. Known members of the
           Mical-like family includes single LIM domain containing
           proteins, Mical (molecule interacting with CasL), pollen
           specific protein SF3, Eplin, xin actin-binding
           repeat-containing protein 2 (XIRP2), and Ltd-1. The
           members of this family function mainly at the
           cytoskeleton and focal adhesions. They interact with
           transcription factors or other signaling molecules to
           play roles in muscle development, neuronal
           differentiation, cell growth, and mobility.  As in other
           LIM domains, this domain family is 50-60 amino acids in
           size and shares two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 26.7 bits (59), Expect = 1.8
 Identities = 12/32 (37%), Positives = 14/32 (43%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
           +H  CF C  CN+ L    Y      LYC  H
Sbjct: 21  YHKNCFRCKDCNKQLKVDNYQSHEGNLYCKVH 52


>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin.  The
           first LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight cons erved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 54

 Score = 26.9 bits (59), Expect = 1.9
 Identities = 11/38 (28%), Positives = 17/38 (44%)

Query: 109 GPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
                WHP  F C+ C E +    +F R  + YC + +
Sbjct: 16  AMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDY 53


>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein
           LIMPETin and related proteins.  The second LIM domain of
           protein LIMPETin: LIMPETin contains 6 LIM domains at the
           C-terminal and an N-terminal PET domain. Four of the six
           LIM domains are highly homologous to the four and half
           LIM domain protein family and two of them show sequence
           similarity to the LIM domains of the testin family.
           Thus, LIMPETin may be the recombinant product of genes
           coding testin and FHL proteins.  In Schistosoma mansoni,
           where LIMPETin was first identified, LIMPETin is down
           regulated in sexually mature adult Schistosoma females
           compared to sexually immature adult females and adult
           male. Its differential expression indicates that it is a
           transcription regulator. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 26.7 bits (59), Expect = 2.0
 Identities = 13/32 (40%), Positives = 15/32 (46%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           N  WH G F C  C+E L    Y  R +  YC
Sbjct: 20  NKDWHSGHFCCWQCDESLTGQRYVLRDEHPYC 51


>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein
           3 (CRP3/MLP).  The second LIM domain of Cysteine Rich
           Protein 3 (CRP3/MLP):  Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to short glycine-rich repeats (GRRs). The CRP family
           members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
           and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network.CRP3 also called Muscle LIM Protein (MLP), which
           is a striated muscle-specific factor that enhances
           myogenic differentiation. The second LIM domain of
           CRP3/MLP interacts with cytoskeletal protein
           beta-spectrin. CRP3/MLP also interacts with the basic
           helix-loop-helix myogenic transcription factors MyoD,
           myogenin, and MRF4 thereby increasing their affinity for
           specific DNA regulatory elements. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 26.9 bits (59), Expect = 2.0
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 102 SVFASR--AGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           SV+A+    G    WH  CF C++C + L       +  +LYC
Sbjct: 7   SVYAAEKVMGGGKPWHKTCFRCAICGKSLESTTVTDKDGELYC 49


>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a.  The first LIM
           domain of Lhx3a: Lhx3a is a member of LHX protein
           family, which features two tandem N-terminal LIM domains
           and a C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas. Lhx3a is one of
           the two isoforms of Lhx3. The Lhx3 gene is expressed in
           the ventral spinal cord, the pons, the medulla
           oblongata, and the pineal gland of the developing
           nervous system during mouse embryogenesis, and
           transcripts are found in the emergent pituitary gland.
           Lhx3 functions in concert with other transcription
           factors to specify interneuron and motor neuron fates
           during development. Lhx3 proteins have been demonstrated
           to directly bind to the promoters of several pituitary
           hormone gene promoters. The Lhx3 gene encodes two
           isoforms, LHX3a and LHX3b that differ in their
           amino-terminal sequences, where Lhx3a has longer
           N-terminal.  They show differential activation of
           pituitary hormone genes and distinct DNA binding
           properties. In human, Lhx3a trans-activated the
           alpha-glycoprotein subunit promoter and genes containing
           a high-affinity Lhx3 binding site more effectively than
           the hLhx3b isoform. In addition, hLhx3a induce
           transcription of the TSHbeta-subunit gene by acting on
           pituitary POU domain factor, Pit-1, while hLhx3b does
           not. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 56

 Score = 26.7 bits (59), Expect = 2.1
 Identities = 11/29 (37%), Positives = 14/29 (48%), Gaps = 1/29 (3%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  C  C  C   L D  +  RG ++YC
Sbjct: 24  WHSKCLKCVDCQAQLTDKCF-SRGGQVYC 51


>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The first LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung at
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 62

 Score = 26.8 bits (59), Expect = 2.3
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  CF C  C   LVD  +  + + L C
Sbjct: 26  WHESCFHCFQCKNSLVDKPFAAKEEHLLC 54


>gnl|CDD|188849 cd09465, LIM2_LIMK2, The second LIM domain of LIMK2 (LIM domain
           Kinase 2).  The second LIM domain of LIMK2 (LIM domain
           Kinase 2): LIMK2 is a member of the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, altering the rate of actin depolymerisation.
           LIMK activity is activated by phosphorylation of a
           threonine residue within the activation loop of the
           kinase by p21-activated kinases 1 and 4 and by Rho
           kinase. LIMKs can function in both cytoplasm and
           nucleus. Both LIMK1 and LIMK2 can act in the nucleus to
           suppress Rac/Cdc42-dependent cyclin D1 expression. LIMK2
           is expressed in all tissues. While LIMK1 localizes
           mainly at focal adhesions, LIMK2 is found in cytoplasmic
           punctae, suggesting that they may have different
           cellular functions. The activity of LIM kinase 2 to
           regulate cofilin phosphorylation is inhibited by the
           direct binding of Par-3. LIMK2 activation promotes cell
           cycle progression. The phenotype of Limk2 knockout mice
           shows a defect in spermatogenesis. The LIM domains have
           been shown to play an important role in regulating
           kinase activity and likely also contribute to LIMK
           function by acting as sites of protein-to-protein
           interactions. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 59

 Score = 26.8 bits (59), Expect = 2.3
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%)

Query: 114 WHPGCFTCSVCNELLV--DLIYFYRGDKLYCGRHH 146
           +HP CF C  C  ++   D     +   LYCG+ H
Sbjct: 25  YHPECFACMSCKVIIEDGDTYALVQHTTLYCGKCH 59


>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred
           partner (LPP).  The second LIM domain of lipoma
           preferred partner (LPP): LPP is a member of the zyxin
           LIM protein family and contains three LIM zinc-binding
           domains at the C-terminal and proline-rich region at the
           N-terminal.  LPP initially identified as the most
           frequent translocation partner of HMGA2 (High Mobility
           Group A2) in a subgroup of benign tumors of adipose
           tissue (lipomas). It was also shown to be rearranged in
           a number of other soft tissues, as well as in a case of
           acute monoblastic leukemia. In addition to its
           involvement in tumors, LPP was inedited as a smooth
           muscle restricted LIM protein that plays an important
           role in SMC migration. LPP is localized at sites of cell
           adhesion, cell-cell contacts and transiently in the
           nucleus. In nucleus, it acts as a coactivator for the
           ETS domain transcription factor PEA3. In addition to
           PEA3, it interacts with alpha-actinin,vasodilator
           stimulated phosphoprotein (VASP),Palladin, and Scrib.
           The  LIM domains are the main focal adhesion targeting
           elements and that the proline- rich region, which
           harbors binding sites for alpha-actinin and vasodilator-
           stimulated phosphoprotein (VASP), has a weak targeting
           capacity. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 60

 Score = 26.7 bits (59), Expect = 2.4
 Identities = 9/15 (60%), Positives = 11/15 (73%)

Query: 114 WHPGCFTCSVCNELL 128
           +HP CFTC VC + L
Sbjct: 20  YHPQCFTCVVCGKSL 34


>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain
           Kinase 1).  The first LIM domain of LIMK1 (LIM domain
           Kinase 1): LIMK1 belongs to the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, and altering the rate of actin
           depolymerization. LIMKs can function in both cytoplasm
           and nucleus. Both LIMK1 and LIMK2 can act in the nucleus
           to suppress Rac/Cdc42-dependent cyclin D1 expression.
           LIMK1 is expressed in all tissues and is localized to
           focal adhesions in the cell. LIMK1 can form homodimers
           upon binding of HSP90 and is activated by Rho effector
           Rho kinase and MAPKAPK2. LIMK1 is important for normal
           central nervous system development, and its deletion has
           been implicated in the development of the human genetic
           disorder Williams syndrome. Moreover, LIMK1 up-regulates
           the promoter activity of urokinase type plasminogen
           activator and induces its mRNA and protein expression in
           breast cancer cells. The LIM domains have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 74

 Score = 26.8 bits (59), Expect = 2.7
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHH 146
           NS WH  CF C  C   L    Y+ +  +L+C + +
Sbjct: 39  NSDWHADCFRCCECGASLSHW-YYEKDGRLFCKKDY 73


>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only
           protein 4).  The first LIM domain of LMO4 (LIM domain
           only protein 4): LMO4 is a nuclear protein that plays
           important roles in transcriptional regulation and
           development. LMO4 is involved in various functions in
           tumorigenesis and cellular differentiation. LMO4
           proteins regulate gene expression by interacting with a
           wide variety of transcription factors and cofactors to
           form large transcription complexes. It can interact with
           Smad proteins, and associate with the promoter of the
           PAI-1 (plasminogen activator inhibitor-1) gene in a
           TGFbeta (transforming growth factor beta)-dependent
           manner. LMO4 can also form a complex with transcription
           regulator CREB (cAMP response element-binding protein)
           and interact with CLIM1 and CLIM2. In breast tissue,
           LMO4 interacts with multiple proteins, including the
           cofactor CtIP [CtBP (C-terminal binding
           protein)-interacting protein], the breast and ovarian
           tumor suppressor BRCA1 (breast-cancer susceptibility
           gene 1) and the LIM-domain-binding protein LDB1.
           Functionally, LMO4 is shown to repress BRCA1-mediated
           transcription activation, thus invoking a potential role
           for LMO4 as a negative regulator of BRCA1 in sporadic
           breast cancer.  LMO4 also forms complex to both ERa
           (oestrogen receptor alpha), MTA1 (metastasis tumor
           antigen 1), and HDACs (histone deacetylases), implying
           that LMO4 is also a component of the MTA1 corepressor
           complex. Over-expressed LMO4 represses ERa
           transactivation functions in an HDAC-dependent manner,
           and contributes to the process of breast cancer
           progression by allowing the development of Era-negative
           phenotypes. All LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 55

 Score = 26.2 bits (58), Expect = 3.0
 Identities = 8/18 (44%), Positives = 10/18 (55%)

Query: 114 WHPGCFTCSVCNELLVDL 131
           WH GC  CS C   L ++
Sbjct: 21  WHNGCLKCSCCQAQLGEI 38


>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein
           2 (CRP2).  The second LIM domain of Cysteine Rich
           Protein 2 (CRP2):  Cysteine-rich proteins (CRPs) are
           characterized by the presence of two LIM domains linked
           to short glycine-rich repeats (GRRs). The CRP family
           members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
           and CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network.CRP3 also called Muscle LIM Protein (MLP), which
           is a striated muscle-specific factor that enhances
           myogenic differentiation. The second LIM domain of
           CRP3/MLP interacts with cytoskeletal protein
           beta-spectrin. CRP3/MLP also interacts with the basic
           helix-loop-helix myogenic transcription factors MyoD,
           myogenin, and MRF4 thereby increasing their affinity for
           specific DNA regulatory elements. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 54

 Score = 26.2 bits (57), Expect = 3.0
 Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           C  C D +  ++  + A +      WH  CF C+ C + L       +  ++YC
Sbjct: 1   CSRCGDSVYAAEKIMGAGKP-----WHKNCFRCAKCGKSLESTTLTEKEGEIYC 49


>gnl|CDD|225221 COG2344, COG2344, AT-rich DNA-binding protein [General function
          prediction only].
          Length = 211

 Score = 28.0 bits (63), Expect = 3.1
 Identities = 6/24 (25%), Positives = 10/24 (41%)

Query: 5  SKRCSMVHLYFSSLPEDKVPYVNS 28
          +KR  + +     L    V  V+S
Sbjct: 12 AKRLPLYYRVLERLHASGVERVSS 35


>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain
           Kinase 1).  The second LIM domain of LIMK1 (LIM domain
           Kinase 1): LIMK1 belongs to the LIMK protein family,
           which comprises LIMK1 and LIMK2. LIMK contains two LIM
           domains, a PDZ domain, and a kinase domain. LIMK is
           involved in the regulation of actin polymerization and
           microtubule disassembly. LIMK influences architecture of
           the actin cytoskeleton by regulating the activity of the
           cofilin family proteins cofilin1, cofilin2, and destrin.
           The mechanism of the activation is to phosphorylates
           cofilin on serine 3 and inactivates its actin-severing
           activity, and altering the rate of actin
           depolymerization. LIMKs can function in both cytoplasm
           and nucleus. Both LIMK1 and LIMK2 can act in the nucleus
           to suppress Rac/Cdc42-dependent cyclin D1 expression.
           LIMK1 is expressed in all tissues and is localized to
           focal adhesions in the cell. LIMK1 can form homodimers
           upon binding of HSP90 and is activated by Rho effector
           Rho kinase and MAPKAPK2. LIMK1 is important for normal
           central nervous system development, and its deletion has
           been implicated in the development of the human genetic
           disorder Williams syndrome. Moreover, LIMK1 up-regulates
           the promoter activity of urokinase type plasminogen
           activator and induces its mRNA and protein expression in
           breast cancer cells. The LIM domains have been shown to
           play an important role in regulating kinase activity and
           likely also contribute to LIMK function by acting as
           sites of protein-to-protein interactions. All LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 55

 Score = 26.4 bits (58), Expect = 3.2
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 7/57 (12%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELL--VDLIYFYRGDKLYCG 143
           C  C + + T  + V    AG    +HP CF+C  C   +   D        KLYCG
Sbjct: 1   CHGCSETITTGLVMV----AGEQK-YHPECFSCLRCGAFIGDGDTYALVEHSKLYCG 52


>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and
           RhoGap domain containing protein.  The second LIM domain
           of Lrg1p, a LIM and RhoGap domain containing protein:
           The members of this family contain three tandem repeats
           of LIM domains and a Rho-type GTPase activating protein
           (RhoGap) domain. Lrg1p is a Rho1 GTPase-activating
           protein required for efficient cell fusion in yeast.
           Lrg1p-GAP domain strongly and specifically stimulates
           the GTPase activity of Rho1p, a regulator of beta
           (1-3)-glucan synthase in vitro. The LIM domain is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 26.2 bits (58), Expect = 3.4
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 119 FTCSVCNELLV--DLIYFYRGDKLYCGRHH 146
           FTCSVC  +    D  Y + G K+YC  H+
Sbjct: 25  FTCSVCPTVFGPNDSYYEHEG-KIYCHYHY 53


>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The third LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung to a
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to s upport the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 26.1 bits (57), Expect = 3.8
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  CF C+ C + L    +  R D  YC
Sbjct: 20  WHKECFVCTGCKKQLSGQRFTSRDDFAYC 48


>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH).  The
           first LIM domain of Arrowhead (AWH): Arrowhead belongs
           to the LHX protein family, which features two tandem
           N-terminal LIM domains and a C-terminal DNA binding
           homeodomain. Members of LHX family are found in the
           nucleus and act as transcription factors or cofactors.
           LHX proteins are critical for the development of
           specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. During embryogenesis of
           Drosophila, Arrowhead is expressed in each abdominal
           segment and in the labial segment. Late in embryonic
           development, expression of arrowhead is refined to the
           abdominal histoblasts and salivary gland imaginal ring
           cells themselves. The Arrowhead gene required for
           establishment of a subset of imaginal tissues: the
           abdominal histoblasts and the salivary gland imaginal
           rings. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 25.8 bits (57), Expect = 4.1
 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 1/30 (3%)

Query: 114 WHPGCFTCSVCNELLVDLIY-FYRGDKLYC 142
           WH  C  C VC   L      F R  ++YC
Sbjct: 21  WHVSCLRCCVCQTPLERQPSCFTRDRQIYC 50


>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A
            (vWA) domain [General function prediction only].
          Length = 4600

 Score = 28.4 bits (63), Expect = 4.2
 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 6/43 (13%)

Query: 62   ELRLFSAQRK------REALGRGFVKQLVAPMFCENCEDELQT 98
              RLF+ Q        R+ L R F  + +   F +  EDEL+ 
Sbjct: 999  NFRLFATQNPPGGYGGRKGLSRAFRNRFLEMHFDDIPEDELEE 1041


>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin
           like protein family.  The second LIM domain of the
           paxillin like protein family: This family consists of
           paxillin, leupaxin, Hic-5 (ARA55), and other related
           proteins. There are four LIM domains in the C-terminal
           of the proteins and leucine-rich LD-motifs in the
           N-terminal region.  Members of this family are adaptor
           proteins to recruit key components of
           signal-transduction machinery to specific sub-cellular
           locations. Paxillin is found at the interface between
           the plasma membrane and the actin cytoskeleton. Paxillin
           serves as a platform for the recruitment of numerous
           regulatory and structural proteins that together control
           the dynamic changes in cell adhesion, cytoskeletal
           reorganization and gene expression that are necessary
           for cell migration and survival. Leupaxin is a
           cytoskeleton adaptor protein, which is preferentially
           expressed in hematopoietic cells. It associates with
           focal adhesion kinases PYK2 and pp125FAK and identified
           to be a component of the osteoclast pososomal signaling
           complex. Hic-5 controls cell proliferation, migration
           and senescence by functioning as coactivator for steroid
           receptors such as androgen receptor, glucocorticoid
           receptor and progesterone receptor. LIM domains are
           50-60 amino acids in size and share two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 52

 Score = 25.4 bits (56), Expect = 5.1
 Identities = 10/29 (34%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WHP  F C+ C +   D  +  +  K YC
Sbjct: 20  WHPEHFFCAQCGKPFGDEGFHEKDGKPYC 48


>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin.  The second
           LIM domain of Zyxin: Zyxin exhibits three copies of the
           LIM domain, an extensive proline-rich domain and a
           nuclear export signal.  Localized at sites of
           cellsubstratum adhesion in fibroblasts, Zyxin interacts
           with alpha-actinin, members of the cysteine-rich protein
           (CRP) family, proteins that display Src homology 3 (SH3)
           domains and Ena/VASP family members. Zyxin and its
           partners have been implicated in the spatial control of
           actin filament assembly as well as in pathways important
           for cell differentiation. In addition to its functions
           at focal adhesion plaques, recent work has shown that
           zyxin moves from the sites of cell contacts to the
           nucleus, where it directly participates in the
           regulation of gene expression. As in other LIM domains,
           this domain family is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors o r
           scaffolds to support the assembly of multimeric protein.
          Length = 60

 Score = 25.7 bits (56), Expect = 5.1
 Identities = 8/11 (72%), Positives = 9/11 (81%)

Query: 114 WHPGCFTCSVC 124
           +HP CFTC VC
Sbjct: 20  YHPQCFTCVVC 30


>gnl|CDD|188781 cd09395, LIM2_Rga, The second LIM domain of  Rga GTPase-Activating
           Proteins.  The second LIM domain of  Rga
           GTPase-Activating Proteins: The members of this family
           contain two tandem repeats of LIM domains and a Rho-type
           GTPase activating protein (RhoGap) domain. Rga activates
           GTPases during polarized morphogenesis. In yeast, a
           known regulating target of Rga is CDC42p, a small
           GTPase. The LIM domain is 50-60 amino acids in size and
           shares two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein.
          Length = 53

 Score = 25.5 bits (56), Expect = 5.6
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 89  CENCEDELQTSDMSVFASRAGPNSCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           C+NC  ++   D ++  S    +  +   CF C  C+  + DL Y      L+C
Sbjct: 1   CKNCGKKI--DDTAILLSS---DEAYCSDCFRCRRCSRDITDLKYAKTKRGLFC 49


>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known
           as Lim1) and Lhx5.  The first LIM domain of Lhx1 (also
           known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
           related members of LHX protein family, which features
           two tandem N-terminal LIM domains and a C-terminal DNA
           binding homeodomain. Members of LHX family are found in
           the nucleus and act as transcription factors or
           cofactors. LHX proteins are critical for the development
           of specialized cells in multiple tissue types, including
           the nervous system, skeletal muscle, the heart, the
           kidneys, and endocrine organs, such as the pituitary
           gland and the pancreas. Lhx1 is required for regulating
           the vertebrate head organizer, the nervous system, and
           female reproductive tract development. During
           embryogenesis in the mouse, Lhx1 is expressed early in
           mesodermal tissue, then later during urogenital, kidney,
           liver, and nervous system development. In the adult,
           expression is restricted to the kidney and brain. A
           mouse embryos with Lhx1 gene knockout cannot grow normal
           anterior head structures, kidneys, and gonads, but with
           normally developed trunk and tail morphology. In the
           developing nervous system, Lhx1 is required to direct
           the trajectories of motor axons in the limb. Lhx1 null
           female mice lack the oviducts and uterus.  Lhx5 protein
           may play complementary or overlapping roles with Lhx1.
           The expression of Lhx5 in the anterior portion of the
           mouse neural tube suggests a role in patterning of the
           forebrain. All LIM domains are 50-60 amino acids in size
           and share two characteristic zinc finger motifs. The two
           zinc fingers contain eight conserved residues, mostly
           cysteines and histidines, which coordinately bond to two
           zinc atoms. LIM domains function as adaptors or
           scaffolds to support the assembly of multimeric protein
           complexes.
          Length = 52

 Score = 25.5 bits (56), Expect = 6.0
 Identities = 12/29 (41%), Positives = 13/29 (44%), Gaps = 1/29 (3%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           WH  C  C  C   L +   F R  KLYC
Sbjct: 21  WHAKCVQCCDCKCPLTEKC-FSREGKLYC 48


>gnl|CDD|218153 pfam04570, DUF581, Protein of unknown function (DUF581).  Family of
           uncharacterized proteins.
          Length = 59

 Score = 25.3 bits (56), Expect = 6.3
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 2/24 (8%)

Query: 121 CSVCNELLVDL--IYFYRGDKLYC 142
           C +C + L     IY YRG+K +C
Sbjct: 20  CFLCKKKLGPGKDIYMYRGEKAFC 43


>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9
           family.  The first LIM domain of Lhx2 and Lhx9 family:
           Lhx2 and Lhx9 are highly homologous LHX regulatory
           proteins. They belong to the LHX protein family, which
           features two tandem N-terminal LIM domains and a
           C-terminal DNA binding homeodomain. Members of LHX
           family are found in the nucleus and act as transcription
           factors or cofactors. LHX proteins are critical for the
           development of specialized cells in multiple tissue
           types, including the nervous system, skeletal muscle,
           the heart, the kidneys, and endocrine organs, such as
           the pituitary gland and the pancreas.  Although Lhx2 and
           Lhx9 are highly homologous, they seems to play
           regulatory roles in different organs.  In animals, Lhx2
           plays important roles in eye, cerebral cortex, limb, the
           olfactory organs, and erythrocyte development. Lhx2 gene
           knockout mice exhibit impaired patterning of the
           cortical hem and the telencephalon of the developing
           brain, and a lack of development in olfactory
           structures. Lhx9 is expressed in several regions of the
           developing mouse brain , the spinal cord, the pancreas,
           in limb mesenchyme, and in the urogenital region. Lhx9
           plays critical roles in gonad development.  Homozygous
           mice lacking functional Lhx9 alleles exhibit numerous
           urogenital defects, such as gonadal agenesis,
           infertility, and undetectable levels of testosterone and
           estradiol coupled with high FSH levels. Lhx9 null mice
           are phenotypically female, even those that are
           genotypically male. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 54

 Score = 25.4 bits (56), Expect = 6.7
 Identities = 11/30 (36%), Positives = 12/30 (40%), Gaps = 1/30 (3%)

Query: 114 WHPGCFTCSVCNELLVD-LIYFYRGDKLYC 142
           WH  C  C  C   L   L  F R   +YC
Sbjct: 21  WHASCLKCCECRLPLDSELSCFSRDGNIYC 50


>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein
           Lost in Neoplasm (Eplin).  The Lim domain of Epithelial
           Protein Lost in Neoplasm (Eplin): Epithelial Protein
           Lost in Neoplasm is a cytoskeleton-associated tumor
           suppressor whose expression inversely correlates with
           cell growth, motility, invasion and cancer mortality.
           Eplin interacts and stabilizes F-actin filaments and
           stress fibers, which correlates with its ability to
           suppress anchorage independent growth. In epithelial
           cells, Eplin is required for formation of the F-actin
           adhesion belt by binding to the E-cadherin-catenin
           complex through alpha-catenin. Eplin is expressed in two
           isoforms, a longer Eplin-beta and a shorter Eplin-alpha.
           Eplin-alpha mRNA is detected in various tissues and cell
           lines, but is absent or down regulated in cancer cells.
           As in other LIM domains, this domain family is 50-60
           amino acids in size and shares two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 53

 Score = 25.2 bits (55), Expect = 6.9
 Identities = 12/35 (34%), Positives = 14/35 (40%)

Query: 111 NSCWHPGCFTCSVCNELLVDLIYFYRGDKLYCGRH 145
              +H  CF CS CN  L    Y      +YC  H
Sbjct: 18  QQIYHNSCFRCSYCNTKLSLGTYASLHGNIYCKPH 52


>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein
           SF3.  The first Lim domain of pollen specific protein
           SF3: SF3 is a Lim protein that is found exclusively in
           mature plant pollen grains. It contains two LIM domains.
           The exact function of SF3 is unknown. It may be a
           transcription factor required for the expression of late
           pollen genes. It is possible that SF3 protein is
           involved in controlling pollen-specific processes such
           as male gamete maturation, pollen tube formation, or
           even fertilization. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 63

 Score = 25.5 bits (56), Expect = 7.2
 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGRHHAETL 150
           +H  CF CS C   L    Y      LYC + H E L
Sbjct: 25  YHKSCFRCSHCKGTLKLSNYSSMEGVLYC-KPHFEQL 60


>gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS.  [DNA
           metabolism, DNA replication, recombination, and repair].
          Length = 840

 Score = 27.4 bits (61), Expect = 7.7
 Identities = 14/52 (26%), Positives = 19/52 (36%)

Query: 48  EVRYCHALSEDERKELRLFSAQRKREALGRGFVKQLVAPMFCENCEDELQTS 99
           EV     LSE E  ELR F       +L   F  + +  +   N    L  +
Sbjct: 168 EVLLAEDLSEMEAIELREFRKDTAVMSLEAQFGTEDLGGLGLRNAPLGLTAA 219


>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid
           receptor-interacting protein 6 (TRIP6).  The first LIM
           domain of Thyroid receptor-interacting protein 6
           (TRIP6): TRIP6 is a member of the zyxin LIM protein
           family and contains three LIM zinc-binding domains at
           the C-terminal. TRIP6 protein localizes to focal
           adhesion sites and along actin stress fibers.
           Recruitment of this protein to the plasma membrane
           occurs in a lysophosphatidic acid (LPA)-dependent
           manner. TRIP6 recruits a number of molecules involved in
           actin assembly, cell motility, survival and
           transcriptional control. The function of TRIP6 in cell
           motility is regulated by Src-dependent phosphorylation
           at a Tyr residue. The phosphorylation activates the
           coupling to the Crk SH2 domain, which is required for
           the function of TRIP6 in promoting lysophosphatidic acid
           (LPA)-induced cell migration. TRIP6 can shuttle to the
           nucleus to serve as a coactivator of AP-1 and NF-kappaB
           transcriptional factors. Moreover, TRIP6 can form a
           ternary complex with the NHERF2 PDZ protein and LPA2
           receptor to regulate LPA-induced activation of ERK and
           AKT, rendering cells resistant to chemotherapy. Recent
           evidence shows that TRIP6 antagonizes Fas-Induced
           apoptosis by enhancing the antiapoptotic effect of LPA
           in cells. As in other LIM domains, this domain family is
           50-60 amino acids in size and shares two characteristic
           zinc finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein.
          Length = 54

 Score = 25.1 bits (55), Expect = 8.7
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
           +H  CFTC  CN  L    ++    K YC
Sbjct: 22  FHVDCFTCMTCNGKLRGQPFYAVEKKAYC 50


>gnl|CDD|238409 cd00794, NOS_oxygenase_prok, Nitric oxide synthase (NOS)
           prokaryotic oxygenase domain. NOS produces nitric oxide
           (NO) by catalyzing a five-electron heme-based oxidation
           of a guanidine nitrogen of L-arginine to L-citrulline
           via two successive monooxygenation reactions producing
           N(omega)-hydroxy-L-arginine (NHA) as an intermediate.
           Nitric oxide synthases are homodimers. Most prokaryotes
           produce NO as a byproduct of denitrification, using a
           completely different set of enzymes than NOS. However, a
           few prokaryotes also have a NOS, consisting solely of
           the NOS oxygenase domain. Prokaryotic NOS binds to the
           substrate L-Arg, zinc, and to the cofactors heme and
           tetrahydrofolate.
          Length = 353

 Score = 27.0 bits (60), Expect = 8.8
 Identities = 15/55 (27%), Positives = 19/55 (34%), Gaps = 9/55 (16%)

Query: 170 YYLTRDSERDLPDEYRTERLEHQRDLPESYGTHRNSLNKEQN---------HSFD 215
           Y  T    R+L DEYR   L    +          SL K++          HSF 
Sbjct: 233 YMGTEIGARNLADEYRYNLLPKVAEALGLDTLKNRSLWKDRALVELNVAVLHSFK 287


>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1
           (CRP1).  The first LIM domain of Cysteine Rich Protein 1
           (CRP1): Cysteine-rich proteins (CRPs) are characterized
           by the presence of two LIM domains linked to a short
           glycine-rich repeats (GRRs). The CRP family members
           include CRP1, CRP2, CRP3/MLP and TLP. CRP1, CRP2 and
           CRP3 share a conserved nuclear targeting signal
           (K/R-K/R-Y-G-P-K), which supports the fact that these
           proteins function not only in the cytoplasm but also in
           the nucleus. CRPs control regulatory pathways during
           cellular differentiation, and involve in complex
           transcription circuits, and the organization as well as
           the arrangement of the myofibrillar/cytoskeletal
           network. CRP1 can associate with the actin cytoskeleton
           and are capable of interacting with alpha-actinin and
           zyxin. CRP1 was shown to regulate actin filament
           bundling by interaction with alpha-actinin and direct
           binding to actin filaments. LIM domains are 50-60 amino
           acids in size and share two characteristic zinc finger
           motifs. The two zinc fingers contain eight conserved
           residues, mostly cysteines and histidines, which
           coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 56

 Score = 25.0 bits (54), Expect = 9.0
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 112 SCWHPGCFTCSVCNELLVDLIYFYRGDKLYC 142
             +H  CF C VC + L        G+++YC
Sbjct: 21  RSFHKSCFLCMVCKKNLDSTTVAVHGEEIYC 51


>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like
           family.  The second LIM domain of Enigma-like family:
           The Enigma LIM domain family is comprised of three
           members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
           These subfamily members contain a single PDZ domain at
           the N-terminus and three LIM domains at the C-terminus.
           Enigma was initially characterized in humans and is
           expressed in multiple tissues, such as skeletal muscle,
           heart, bone and brain. The third LIM domain specifically
           interacts with the insulin receptor and the second LIM
           domain interacts with the receptor tyrosine kinase Ret
           and the adaptor protein APS.  Thus Enigma is implicated
           in signal transduction processes, such as mitogenic
           activity, insulin related actin organization, and
           glucose metabolism. The second member, ENH protein, was
           first identified in rat brain.  It has been shown that
           ENH interacts with protein kinase D1 (PKD1) via its LIM
           domains and forms a complex with PKD1 and the alpha1C
           subunit of cardiac L-type voltage-gated calcium channel
           in rat neonatal cardiomyocytes. The N-terminal PDZ
           domain interacts with alpha-actinin at the Z-line.
           ZASP/Cypher is required for maintenance of Z-line
           structure during muscle contraction, but not required
           for Z-line assembly. In heart, Cypher/ZASP plays a
           structural role through its interaction with
           cytoskeletal Z-line proteins. In addition, there is
           increasing evidence that Cypher/ZASP also performs
           signaling functions. Studies reveal that Cypher/ZASP
           interacts with and directs PKC to the Z-line, where PKC
           phosphorylates downstream signaling targets. LIM domains
           are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 52

 Score = 24.7 bits (54), Expect = 9.7
 Identities = 8/31 (25%), Positives = 16/31 (51%)

Query: 114 WHPGCFTCSVCNELLVDLIYFYRGDKLYCGR 144
           WH  CF C+ C + + + ++     + YC +
Sbjct: 20  WHVSCFVCAACKQPIGNSLFHMEDGEPYCEK 50


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0693    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 12,020,610
Number of extensions: 1096209
Number of successful extensions: 1272
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1266
Number of HSP's successfully gapped: 151
Length of query: 242
Length of database: 10,937,602
Length adjustment: 94
Effective length of query: 148
Effective length of database: 6,768,326
Effective search space: 1001712248
Effective search space used: 1001712248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.2 bits)