Query         psy8111
Match_columns 135
No_of_seqs    221 out of 1382
Neff          9.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:53:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8111.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8111hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1701|consensus              100.0 9.6E-35 2.1E-39  216.9   0.2  129    3-135   275-406 (468)
  2 KOG1701|consensus               99.9 9.6E-28 2.1E-32  179.6   3.1  122    4-126   336-467 (468)
  3 KOG2272|consensus               99.9 5.2E-26 1.1E-30  160.6   1.4  127    4-134   139-265 (332)
  4 KOG2272|consensus               99.9 2.6E-26 5.6E-31  162.2  -0.4  115    3-120   196-311 (332)
  5 KOG1703|consensus               99.9 4.2E-25 9.1E-30  172.8   3.8  129    3-134   304-433 (479)
  6 KOG4577|consensus               99.9   9E-26 1.9E-30  161.9  -2.7  123    2-126    33-158 (383)
  7 KOG1703|consensus               99.8 3.1E-22 6.6E-27  156.8   1.7  116    2-118   363-478 (479)
  8 KOG1044|consensus               99.8 2.3E-21   5E-26  150.0   2.3  113    3-119   134-248 (670)
  9 KOG1044|consensus               99.8   3E-21 6.5E-26  149.3   2.8  126    6-134    69-203 (670)
 10 PF00412 LIM:  LIM domain;  Int  99.7 2.4E-17 5.2E-22   94.1   4.0   58   65-122     1-58  (58)
 11 PF00412 LIM:  LIM domain;  Int  99.6 1.3E-16 2.8E-21   91.1   3.5   56    5-61      1-58  (58)
 12 KOG1700|consensus               99.5 3.6E-15 7.8E-20  104.8   1.3  119    2-122     7-167 (200)
 13 KOG4577|consensus               99.5 2.5E-15 5.4E-20  108.4  -2.2   78   56-135    27-104 (383)
 14 smart00132 LIM Zinc-binding do  99.0 2.7E-10 5.9E-15   59.3   2.0   38   64-101     1-38  (39)
 15 smart00132 LIM Zinc-binding do  98.9 7.6E-10 1.6E-14   57.6   2.3   36    4-40      1-38  (39)
 16 KOG0490|consensus               98.3 1.5E-07 3.2E-12   67.4  -0.4  112    7-120     1-118 (235)
 17 KOG1700|consensus               98.1 1.2E-06 2.6E-11   61.8   1.0   63   62-125     7-69  (200)
 18 KOG1702|consensus               97.8 2.7E-06 5.8E-11   59.5  -1.5   61   63-124     5-65  (264)
 19 KOG1702|consensus               97.2   3E-05 6.5E-10   54.3  -2.0   59    3-62      5-64  (264)
 20 KOG0490|consensus               96.2  0.0016 3.4E-08   46.5   0.5   65   68-134     2-70  (235)
 21 PF14835 zf-RING_6:  zf-RING of  93.0   0.067 1.5E-06   30.8   1.6   43   91-133     8-50  (65)
 22 PF14835 zf-RING_6:  zf-RING of  91.3    0.19 4.2E-06   28.9   2.1   47   30-76      8-54  (65)
 23 PF14634 zf-RING_5:  zinc-RING   90.8    0.38 8.2E-06   25.3   2.8   39   93-131     2-44  (44)
 24 PF14446 Prok-RING_1:  Prokaryo  90.8    0.18 3.8E-06   28.0   1.6   30   62-91      5-36  (54)
 25 PF10367 Vps39_2:  Vacuolar sor  89.3     0.2 4.4E-06   31.2   1.2   29   63-91     79-107 (109)
 26 PF08394 Arc_trans_TRASH:  Arch  89.0    0.18 3.9E-06   25.8   0.6   26   65-90      1-26  (37)
 27 PRK14890 putative Zn-ribbon RN  87.8    0.53 1.1E-05   26.6   2.1   49   62-130     7-55  (59)
 28 COG2888 Predicted Zn-ribbon RN  83.5    0.99 2.1E-05   25.5   1.8   29   62-100     9-37  (61)
 29 PF06677 Auto_anti-p27:  Sjogre  83.3       1 2.2E-05   23.5   1.7   22   31-56     19-40  (41)
 30 smart00504 Ubox Modified RING   82.9     1.8 3.8E-05   24.1   2.8   43   91-134     2-46  (63)
 31 COG2191 Formylmethanofuran deh  82.8     0.6 1.3E-05   33.0   0.9   31   30-60    173-203 (206)
 32 COG2191 Formylmethanofuran deh  81.2    0.57 1.2E-05   33.1   0.4   31   91-121   173-203 (206)
 33 cd00162 RING RING-finger (Real  80.3     1.6 3.5E-05   21.9   1.9   40   93-133     2-45  (45)
 34 PF13920 zf-C3HC4_3:  Zinc fing  80.2       1 2.2E-05   24.1   1.1   42   92-134     4-48  (50)
 35 PF11781 RRN7:  RNA polymerase   80.1     1.1 2.5E-05   22.6   1.2   25   30-58      9-33  (36)
 36 PF13240 zinc_ribbon_2:  zinc-r  79.7     1.6 3.6E-05   19.7   1.5    8   65-72      2-9   (23)
 37 PF07191 zinc-ribbons_6:  zinc-  78.7     1.1 2.4E-05   26.2   1.0   60   31-103     3-63  (70)
 38 PF01258 zf-dskA_traR:  Prokary  78.6     0.3 6.5E-06   24.6  -1.3   26   93-118     6-31  (36)
 39 PF10367 Vps39_2:  Vacuolar sor  77.7     1.5 3.2E-05   27.2   1.4   28   92-119    80-108 (109)
 40 PF06906 DUF1272:  Protein of u  77.2     4.8  0.0001   22.5   3.2   42   93-134     8-52  (57)
 41 PF09943 DUF2175:  Uncharacteri  75.7    0.82 1.8E-05   28.7  -0.1   28   64-92      4-32  (101)
 42 COG1645 Uncharacterized Zn-fin  75.4     2.3   5E-05   28.0   1.9   23   31-58     30-52  (131)
 43 COG4357 Zinc finger domain con  75.2     0.5 1.1E-05   29.3  -1.2   59   64-127    37-95  (105)
 44 PF10235 Cript:  Microtubule-as  74.0       2 4.3E-05   26.5   1.2   42   23-73     39-80  (90)
 45 KOG4739|consensus               72.2     2.9 6.3E-05   30.3   1.9   40   95-134     8-48  (233)
 46 PF14471 DUF4428:  Domain of un  71.9     3.1 6.8E-05   22.7   1.6   29   92-121     1-30  (51)
 47 PF13248 zf-ribbon_3:  zinc-rib  71.3     2.4 5.2E-05   19.6   0.9   13    1-13      1-13  (26)
 48 KOG0320|consensus               71.3     3.2   7E-05   28.8   1.9   47   88-134   129-178 (187)
 49 PF02069 Metallothio_Pro:  Prok  69.8     3.1 6.7E-05   22.9   1.3   27   32-58     10-37  (52)
 50 PF11571 Med27:  Mediator compl  69.8     1.9   4E-05   26.5   0.4   16   57-72     49-64  (90)
 51 PF12773 DZR:  Double zinc ribb  68.3     6.5 0.00014   20.9   2.4   23   93-119    15-37  (50)
 52 PF00645 zf-PARP:  Poly(ADP-rib  66.8     1.3 2.8E-05   26.4  -0.7   31   62-92      7-47  (82)
 53 PRK14559 putative protein seri  66.6     5.6 0.00012   33.2   2.7    9   64-72     29-37  (645)
 54 PF10083 DUF2321:  Uncharacteri  65.9     4.9 0.00011   27.3   1.9   11    5-15     42-52  (158)
 55 PF12674 Zn_ribbon_2:  Putative  63.5     3.7   8E-05   24.7   0.9   28   93-120     3-35  (81)
 56 KOG2682|consensus               63.4     2.6 5.6E-05   30.9   0.2   50   75-135   140-189 (314)
 57 PF07754 DUF1610:  Domain of un  62.5     5.6 0.00012   18.2   1.2   10    5-14      1-10  (24)
 58 cd02249 ZZ Zinc finger, ZZ typ  62.5     6.7 0.00015   20.6   1.7   10  111-120    23-32  (46)
 59 PRK00420 hypothetical protein;  62.5     5.5 0.00012   25.6   1.6   25   30-58     24-48  (112)
 60 TIGR02098 MJ0042_CXXC MJ0042 f  62.2     3.9 8.4E-05   20.5   0.7   13    1-13      1-13  (38)
 61 PF04570 DUF581:  Protein of un  61.9     5.6 0.00012   22.4   1.4   27   31-57     18-47  (58)
 62 PF07503 zf-HYPF:  HypF finger;  61.5     3.1 6.7E-05   20.9   0.2   22   18-40     11-32  (35)
 63 KOG1813|consensus               61.4     4.8  0.0001   30.2   1.3   43   91-134   242-286 (313)
 64 KOG3002|consensus               59.4     8.3 0.00018   29.1   2.3   43   91-134    49-91  (299)
 65 smart00291 ZnF_ZZ Zinc-binding  58.5     9.6 0.00021   19.9   1.9   11  110-120    26-36  (44)
 66 PLN03208 E3 ubiquitin-protein   57.7      12 0.00026   26.4   2.7   44   90-134    18-79  (193)
 67 PF13923 zf-C3HC4_2:  Zinc fing  57.4     4.5 9.8E-05   20.3   0.5   37   93-129     1-39  (39)
 68 KOG0978|consensus               57.0     3.3 7.2E-05   34.7  -0.2   44   91-135   644-690 (698)
 69 PF06827 zf-FPG_IleRS:  Zinc fi  56.9       3 6.6E-05   19.8  -0.3   11   63-73      2-12  (30)
 70 PF13717 zinc_ribbon_4:  zinc-r  56.3     5.1 0.00011   20.1   0.5    7   92-98     27-33  (36)
 71 COG5152 Uncharacterized conser  55.8     4.9 0.00011   28.5   0.5   41   91-132   197-239 (259)
 72 PF00569 ZZ:  Zinc finger, ZZ t  55.8     4.5 9.7E-05   21.4   0.3   30   30-59      5-37  (46)
 73 PF13719 zinc_ribbon_5:  zinc-r  54.8     6.6 0.00014   19.8   0.8   13    1-13      1-13  (37)
 74 PF09943 DUF2175:  Uncharacteri  54.7     8.5 0.00018   24.2   1.4   33   91-123     3-36  (101)
 75 KOG2462|consensus               54.2       2 4.4E-05   31.8  -1.6   35    5-40    133-172 (279)
 76 PF01286 XPA_N:  XPA protein N-  52.5     5.6 0.00012   19.9   0.3   10   63-72      4-13  (34)
 77 COG0068 HypF Hydrogenase matur  52.4     9.6 0.00021   32.1   1.8   81    4-100   103-183 (750)
 78 KOG4739|consensus               52.0     9.8 0.00021   27.6   1.6   42   32-73      6-48  (233)
 79 PF10886 DUF2685:  Protein of u  51.5     8.3 0.00018   21.3   0.9   25   63-88      2-26  (54)
 80 PRK14873 primosome assembly pr  50.6      13 0.00028   31.2   2.3   57   14-71    369-431 (665)
 81 cd02341 ZZ_ZZZ3 Zinc finger, Z  48.5      18 0.00039   19.4   1.9   11  111-121    26-36  (48)
 82 PF09723 Zn-ribbon_8:  Zinc rib  48.3     6.5 0.00014   20.4   0.2   12   30-41      6-17  (42)
 83 PRK14714 DNA polymerase II lar  48.3      22 0.00048   32.1   3.4   11   93-103   712-722 (1337)
 84 TIGR00570 cdk7 CDK-activating   47.3      24 0.00051   26.8   3.0   26  109-134    26-54  (309)
 85 PF13834 DUF4193:  Domain of un  47.1     5.4 0.00012   25.0  -0.3   28   90-117    70-98  (99)
 86 cd02336 ZZ_RSC8 Zinc finger, Z  47.0      19 0.00041   19.1   1.8   29   92-120     2-32  (45)
 87 PF00096 zf-C2H2:  Zinc finger,  46.2     8.7 0.00019   16.5   0.4   12   30-41      1-12  (23)
 88 smart00834 CxxC_CXXC_SSSS Puta  45.2     8.3 0.00018   19.4   0.3   11   30-40      6-16  (41)
 89 smart00659 RPOLCX RNA polymera  44.8      16 0.00034   19.2   1.3   11   30-40      3-13  (44)
 90 TIGR02605 CxxC_CxxC_SSSS putat  44.8       9  0.0002   20.5   0.4   12   30-41      6-17  (52)
 91 PF07649 C1_3:  C1-like domain;  44.8      14 0.00031   17.4   1.1   12   30-41      1-12  (30)
 92 KOG1813|consensus               43.8      11 0.00025   28.3   0.9   50   21-73    235-286 (313)
 93 PF13695 zf-3CxxC:  Zinc-bindin  43.7      28 0.00062   21.5   2.6    9   85-93     36-44  (98)
 94 cd02340 ZZ_NBR1_like Zinc fing  43.0      22 0.00047   18.5   1.7    9   64-72      2-10  (43)
 95 PF14353 CpXC:  CpXC protein     41.3      32 0.00069   22.2   2.6   38    3-41      2-50  (128)
 96 PF13894 zf-C2H2_4:  C2H2-type   40.5      14 0.00031   15.5   0.7   11   30-40      1-11  (24)
 97 PF15135 UPF0515:  Uncharacteri  39.6      34 0.00073   25.3   2.7   36   62-102   132-167 (278)
 98 PRK00807 50S ribosomal protein  39.3      28 0.00061   19.0   1.8   22   31-52      3-27  (52)
 99 COG4847 Uncharacterized protei  38.9     9.5 0.00021   23.7  -0.1   29   64-93      8-37  (103)
100 KOG3002|consensus               37.9      22 0.00047   26.9   1.6   44   29-73     48-91  (299)
101 PF02591 DUF164:  Putative zinc  36.1     9.9 0.00021   20.9  -0.3   26   31-56     24-52  (56)
102 PF00097 zf-C3HC4:  Zinc finger  35.9      16 0.00034   18.2   0.5   30   93-122     1-30  (41)
103 PF08209 Sgf11:  Sgf11 (transcr  35.7     4.5 9.7E-05   20.1  -1.6   16   91-106     5-20  (33)
104 cd02335 ZZ_ADA2 Zinc finger, Z  35.6      14 0.00031   19.7   0.2   12   30-41      1-12  (49)
105 PRK04023 DNA polymerase II lar  35.5      37 0.00081   30.1   2.7   23   51-73    652-674 (1121)
106 KOG2932|consensus               34.7      20 0.00044   27.3   1.0   40   93-132    93-132 (389)
107 COG2075 RPL24A Ribosomal prote  34.6      40 0.00087   19.5   2.0   22   31-52      5-29  (66)
108 KOG2893|consensus               34.3      12 0.00027   27.4  -0.2   35    5-42     13-47  (341)
109 cd02338 ZZ_PCMF_like Zinc fing  34.3      37 0.00079   18.1   1.8   10  112-121    25-34  (49)
110 PF12874 zf-met:  Zinc-finger o  34.2      17 0.00038   15.9   0.4   12   30-41      1-12  (25)
111 PF06524 NOA36:  NOA36 protein;  33.8      59  0.0013   24.2   3.2   92   29-133   113-219 (314)
112 PF11077 DUF2616:  Protein of u  33.8      20 0.00043   24.9   0.8   32   92-123   138-172 (173)
113 PRK13796 GTPase YqeH; Provisio  33.7      19  0.0004   27.8   0.7   28   31-58      2-42  (365)
114 PF13912 zf-C2H2_6:  C2H2-type   33.5      18 0.00039   16.2   0.4   12   30-41      2-13  (27)
115 smart00184 RING Ring finger. E  32.6      49  0.0011   15.3   2.0   13  109-121    16-28  (39)
116 PF08792 A2L_zn_ribbon:  A2L zi  32.5      50  0.0011   16.2   1.9   23   31-56      5-27  (33)
117 COG4306 Uncharacterized protei  32.1      42 0.00092   22.1   2.0   10    5-14     42-51  (160)
118 PF08271 TF_Zn_Ribbon:  TFIIB z  32.0      21 0.00045   18.4   0.5   14    4-17     21-34  (43)
119 PF06689 zf-C4_ClpX:  ClpX C4-t  31.1      47   0.001   17.0   1.8   29   92-120     3-33  (41)
120 cd01407 SIR2-fam SIR2 family o  30.1      33 0.00071   24.3   1.4   14  122-135   132-145 (218)
121 COG1198 PriA Primosomal protei  29.4      41 0.00089   28.7   2.1   55   15-71    422-484 (730)
122 COG0266 Nei Formamidopyrimidin  29.2      24 0.00052   26.3   0.6   27   62-90    245-271 (273)
123 PRK12495 hypothetical protein;  28.8      32 0.00069   24.8   1.2   25   29-58     42-66  (226)
124 KOG1734|consensus               28.5      37  0.0008   25.4   1.5   45   43-92    210-262 (328)
125 PF12855 Ecl1:  Life-span regul  28.1      23  0.0005   18.6   0.3   19   93-115     9-27  (43)
126 PRK00398 rpoP DNA-directed RNA  28.1      32 0.00069   17.9   0.8   11   30-40      4-14  (46)
127 PF05864 Chordopox_RPO7:  Chord  27.9      14 0.00031   20.7  -0.6   16   30-45      5-20  (63)
128 PF14569 zf-UDP:  Zinc-binding   27.9      28 0.00061   20.8   0.6   43   30-72     10-61  (80)
129 PF10080 DUF2318:  Predicted me  27.7      66  0.0014   20.2   2.3   36   19-59     26-61  (102)
130 smart00531 TFIIE Transcription  27.5      27 0.00059   23.2   0.6   10   30-39    100-109 (147)
131 PHA03082 DNA-dependent RNA pol  27.4      14  0.0003   20.7  -0.6   16   30-45      5-20  (63)
132 PF05502 Dynactin_p62:  Dynacti  26.9      43 0.00093   27.1   1.7   52   48-101     3-63  (483)
133 PF14447 Prok-RING_4:  Prokaryo  26.5      37  0.0008   18.9   0.9   27  109-135    25-51  (55)
134 PF10764 Gin:  Inhibitor of sig  26.0      69  0.0015   17.0   1.9   10   91-100    19-28  (46)
135 PF12156 ATPase-cat_bd:  Putati  26.0      34 0.00075   20.7   0.8   10    4-13      2-11  (88)
136 PF13639 zf-RING_2:  Ring finge  25.9      22 0.00047   18.2  -0.1    9  110-118    22-30  (44)
137 PHA02610 uvsY.-2 hypothetical   25.7      53  0.0012   18.0   1.4   25    3-27      2-27  (53)
138 PF12171 zf-C2H2_jaz:  Zinc-fin  25.5      45 0.00098   15.0   1.0   13   91-103     2-14  (27)
139 PF14255 Cys_rich_CPXG:  Cystei  24.9      25 0.00054   19.3   0.1    8   65-72      3-10  (52)
140 PF03107 C1_2:  C1 domain;  Int  24.7      58  0.0012   15.3   1.3   13   30-42      1-13  (30)
141 cd02334 ZZ_dystrophin Zinc fin  24.6      76  0.0016   17.0   1.9   10  112-121    25-34  (49)
142 cd02342 ZZ_UBA_plant Zinc fing  24.3      73  0.0016   16.8   1.7    9  112-120    25-33  (43)
143 PF00130 C1_1:  Phorbol esters/  24.3      42 0.00091   17.8   0.9   11   63-73     12-22  (53)
144 COG1381 RecO Recombinational D  24.2      45 0.00098   24.3   1.3   31   88-118   152-182 (251)
145 KOG4443|consensus               24.2      46 0.00099   28.0   1.4   21   82-102   107-127 (694)
146 TIGR00595 priA primosomal prot  24.1      97  0.0021   25.1   3.2   56   15-71    200-262 (505)
147 TIGR03597 GTPase_YqeH ribosome  23.3      32 0.00069   26.5   0.4   27   32-58      1-36  (360)
148 cd01412 SIRT5_Af1_CobB SIRT5_A  23.2 1.1E+02  0.0024   21.6   3.2   13  123-135   130-142 (224)
149 PRK14873 primosome assembly pr  23.2      50  0.0011   27.9   1.5   37   93-132   395-431 (665)
150 PF00628 PHD:  PHD-finger;  Int  23.1      70  0.0015   16.6   1.7    7   84-90     22-28  (51)
151 cd02344 ZZ_HERC2 Zinc finger,   23.0      75  0.0016   16.8   1.7   10  111-120    24-33  (45)
152 PLN03123 poly [ADP-ribose] pol  22.9      45 0.00097   29.5   1.2   35   58-92     13-57  (981)
153 TIGR00143 hypF [NiFe] hydrogen  22.7      52  0.0011   28.0   1.5   81    4-100    70-150 (711)
154 PRK00085 recO DNA repair prote  22.7      48   0.001   23.7   1.2   33   24-57    145-177 (247)
155 PF14570 zf-RING_4:  RING/Ubox   22.6      47   0.001   17.9   0.8   23  110-132    21-46  (48)
156 PF04641 Rtf2:  Rtf2 RING-finge  22.5      80  0.0017   23.1   2.3   49   24-73    109-161 (260)
157 smart00355 ZnF_C2H2 zinc finge  22.5      44 0.00094   14.0   0.6   10   31-40      2-11  (26)
158 COG3813 Uncharacterized protei  22.4      57  0.0012   19.3   1.2   42   93-134     8-52  (84)
159 PF07975 C1_4:  TFIIH C1-like d  22.2      45 0.00097   18.2   0.7   10   32-41      2-11  (51)
160 PF05290 Baculo_IE-1:  Baculovi  22.2      55  0.0012   21.8   1.2   47   87-133    77-131 (140)
161 PF14149 YhfH:  YhfH-like prote  21.9      18  0.0004   18.4  -0.8   15  119-133     9-23  (37)
162 cd00472 Ribosomal_L24e_L24 Rib  21.8      81  0.0017   17.4   1.7   22   31-52      5-29  (54)
163 PRK11595 DNA utilization prote  21.7      53  0.0012   23.4   1.2   21   52-72     22-44  (227)
164 KOG0823|consensus               21.7      88  0.0019   22.8   2.3   54   25-81     44-102 (230)
165 cd02345 ZZ_dah Zinc finger, ZZ  21.3      78  0.0017   16.8   1.6    9   64-72      2-11  (49)
166 PF10170 C6_DPF:  Cysteine-rich  21.1      97  0.0021   19.4   2.1   28   93-120    52-80  (97)
167 PF13465 zf-H2C2_2:  Zinc-finge  20.6      42 0.00092   15.1   0.4   11   29-39     14-24  (26)

No 1  
>KOG1701|consensus
Probab=100.00  E-value=9.6e-35  Score=216.94  Aligned_cols=129  Identities=25%  Similarity=0.552  Sum_probs=121.9

Q ss_pred             ccccccCcccccc--ceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccce
Q psy8111           3 SAVKHQDKSFRED--YNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLS   80 (135)
Q Consensus         3 ~~C~~C~~~i~~~--~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~   80 (135)
                      .+|.+|+|.|.++  .+.||++.||.. ||+|.+|++.|.++.||..|+++||+.||... ..+|..|+++|+  +++++
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~-CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~t-lekC~~Cg~~I~--d~iLr  350 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFHVQ-CFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDT-LEKCNKCGEPIM--DRILR  350 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhccc-ceehHhhhhhhccccccccCCcccchHHHHHH-HHHHhhhhhHHH--HHHHH
Confidence            4799999999964  589999999999 99999999999999999999999999999876 479999999995  88999


Q ss_pred             eCCccccccccccccccccCCCCCeeee-CCcccCHHhHhhhcCCCcccCCCCCCC
Q psy8111          81 YKDKHWHEACFSCSKCRQSLVDKQFGSK-SEKIYCGNCYDAQFASRCDGCSEIFKA  135 (135)
Q Consensus        81 ~~~~~~H~~Cf~C~~C~~~l~~~~~~~~-~~~~~C~~c~~~~~~~~C~~C~~~I~~  135 (135)
                      |.|+.||+.||+|..|.+.|++..|.+. ++++||..+|.++|++||+.|++||+|
T Consensus       351 A~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P  406 (468)
T KOG1701|consen  351 ALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILP  406 (468)
T ss_pred             hcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccC
Confidence            9999999999999999999999988876 799999999999999999999999987


No 2  
>KOG1701|consensus
Probab=99.94  E-value=9.6e-28  Score=179.59  Aligned_cols=122  Identities=19%  Similarity=0.452  Sum_probs=111.2

Q ss_pred             cccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEe-ECCeeeccCchhhhcCCchhhcCCccccC-----cc
Q psy8111           4 AVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVL-RDDHPYCIKCYESVFANSCEECSKIIGID-----SK   77 (135)
Q Consensus         4 ~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~-~~~~~~C~~c~~~~~~~~C~~C~~~I~~~-----~~   77 (135)
                      .|..|+++|.+++|.|+|+.||+. ||+|..|++.|++..|.. .++++||.+||+++|+++|+.|+++|++.     ..
T Consensus       336 kC~~Cg~~I~d~iLrA~GkayHp~-CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etv  414 (468)
T KOG1701|consen  336 KCNKCGEPIMDRILRALGKAYHPG-CFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETV  414 (468)
T ss_pred             HHhhhhhHHHHHHHHhcccccCCC-ceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceE
Confidence            599999999999999999999999 999999999999999986 78999999999999999999999999764     24


Q ss_pred             cceeCCccccccccccccccccCCC----CCeeeeCCcccCHHhHhhhcCCCc
Q psy8111          78 DLSYKDKHWHEACFSCSKCRQSLVD----KQFGSKSEKIYCGNCYDAQFASRC  126 (135)
Q Consensus        78 ~~~~~~~~~H~~Cf~C~~C~~~l~~----~~~~~~~~~~~C~~c~~~~~~~~C  126 (135)
                      .|.++++.||.+|++|..|+.+|+.    ...|..||.++|+.|..++....+
T Consensus       415 Rvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl~~~~  467 (468)
T KOG1701|consen  415 RVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRLQAGS  467 (468)
T ss_pred             EEEEccccccccceehhhcCccccccCCCCcceeccCceeechhhhhhhcccC
Confidence            4788999999999999999999972    368899999999999988876554


No 3  
>KOG2272|consensus
Probab=99.91  E-value=5.2e-26  Score=160.59  Aligned_cols=127  Identities=23%  Similarity=0.513  Sum_probs=119.7

Q ss_pred             cccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccceeCC
Q psy8111           4 AVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSYKD   83 (135)
Q Consensus         4 ~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~   83 (135)
                      .|.+|+..|+++.|+..|..||+. +|+|..|++.|++. -.+..|.+||.+|+.+.-.|.|..|.+||  ++.+|.++|
T Consensus       139 vC~KCh~~iD~~~l~fr~d~yH~y-HFkCt~C~keL~sd-aRevk~eLyClrChD~mgipiCgaC~rpI--eervi~amg  214 (332)
T KOG2272|consen  139 VCQKCHAHIDEQPLTFRGDPYHPY-HFKCTTCGKELTSD-AREVKGELYCLRCHDKMGIPICGACRRPI--EERVIFAMG  214 (332)
T ss_pred             ehhhhhhhcccccccccCCCCCcc-ceecccccccccch-hhhhccceeccccccccCCcccccccCch--HHHHHHHhc
Confidence            489999999999999999999999 99999999999875 55677899999999998889999999999  588999999


Q ss_pred             ccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          84 KHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        84 ~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      +.||.++|+|+.|.+|+-+-..|++.|.+||+.+|.++|+..|..|+++|.
T Consensus       215 KhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~  265 (332)
T KOG2272|consen  215 KHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIG  265 (332)
T ss_pred             cccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccC
Confidence            999999999999999999989999999999999999999999999999884


No 4  
>KOG2272|consensus
Probab=99.91  E-value=2.6e-26  Score=162.16  Aligned_cols=115  Identities=30%  Similarity=0.603  Sum_probs=109.4

Q ss_pred             ccccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccceeC
Q psy8111           3 SAVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSYK   82 (135)
Q Consensus         3 ~~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~   82 (135)
                      ..|..|.+||++++|.|+|+.||.+ +|+|+.|.+|+-+.+.|++.|.+||+.+|.++++..|..|+.+|  .+.++.++
T Consensus       196 piCgaC~rpIeervi~amgKhWHve-HFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i--~G~vv~al  272 (332)
T KOG2272|consen  196 PICGACRRPIEERVIFAMGKHWHVE-HFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVI--GGDVVSAL  272 (332)
T ss_pred             cccccccCchHHHHHHHhccccchh-heeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCcc--CccHHHHh
Confidence            4699999999999999999999999 99999999999999999999999999999999999999999999  57799999


Q ss_pred             CccccccccccccccccCCCC-CeeeeCCcccCHHhHhh
Q psy8111          83 DKHWHEACFSCSKCRQSLVDK-QFGSKSEKIYCGNCYDA  120 (135)
Q Consensus        83 ~~~~H~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~  120 (135)
                      ++.|-++||+|+.|++.|... .|++.|-+|.|+.||.+
T Consensus       273 ~KawCv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy~r  311 (332)
T KOG2272|consen  273 NKAWCVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCYDR  311 (332)
T ss_pred             hhhhccccccccccccccccccceeeeccchHHHHHHhh
Confidence            999999999999999999854 79999999999999974


No 5  
>KOG1703|consensus
Probab=99.91  E-value=4.2e-25  Score=172.84  Aligned_cols=129  Identities=22%  Similarity=0.520  Sum_probs=123.4

Q ss_pred             ccccccCccccc-cceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCccccee
Q psy8111           3 SAVKHQDKSFRE-DYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSY   81 (135)
Q Consensus         3 ~~C~~C~~~i~~-~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~   81 (135)
                      ..|..|+++|.+ +++.++++.||++ +|.|+.|+..+....+...+|++||.+|+.+.+++.|.+|+++|.  +..|.+
T Consensus       304 p~c~~c~~~i~~~~~i~~~~~~~h~~-~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~--~~~v~a  380 (479)
T KOG1703|consen  304 PLCLSCNQKIRSVKVIVALGKEWHPE-HFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPIL--EEGVCA  380 (479)
T ss_pred             ccccccccCcccceeEeecccccccc-ceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchH--HhHhhh
Confidence            579999999999 9999999999999 999999999999888899999999999999999999999999995  778999


Q ss_pred             CCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          82 KDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        82 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      .+..||++||+|..|+++|.+..|+..++.|||+.||.++++++|..|.++|.
T Consensus       381 ~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~  433 (479)
T KOG1703|consen  381 LGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVE  433 (479)
T ss_pred             ccCeechhceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhH
Confidence            99999999999999999999999999999999999999999999999998875


No 6  
>KOG4577|consensus
Probab=99.90  E-value=9e-26  Score=161.93  Aligned_cols=123  Identities=20%  Similarity=0.436  Sum_probs=109.4

Q ss_pred             cccccccCccccccc-eeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccce
Q psy8111           2 ESAVKHQDKSFREDY-NKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLS   80 (135)
Q Consensus         2 ~~~C~~C~~~i~~~~-i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~   80 (135)
                      +..|+.|++.|.+++ +.++++.||.. |++|+.|..+|... +|.++|.+||+++|.++|+.+|++|...|.|+..+..
T Consensus        33 ip~CagC~q~IlDrFilKvl~R~wHs~-CLkCs~C~~qL~dr-CFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRk  110 (383)
T KOG4577|consen   33 IPICAGCDQHILDRFILKVLDRHWHSS-CLKCSDCHDQLADR-CFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRK  110 (383)
T ss_pred             cccccchHHHHHHHHHHHHHhhhhhhh-hcchhhhhhHHHHH-HhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHH
Confidence            356999999999998 57899999999 99999999999864 9999999999999999999999999999998777778


Q ss_pred             eCCccccccccccccccccCCCC-Ceee-eCCcccCHHhHhhhcCCCc
Q psy8111          81 YKDKHWHEACFSCSKCRQSLVDK-QFGS-KSEKIYCGNCYDAQFASRC  126 (135)
Q Consensus        81 ~~~~~~H~~Cf~C~~C~~~l~~~-~~~~-~~~~~~C~~c~~~~~~~~C  126 (135)
                      |.+..||..||.|..|+++|..+ .||+ .|.+++|++.|+..-+.-|
T Consensus       111 Aqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~  158 (383)
T KOG4577|consen  111 AQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHC  158 (383)
T ss_pred             hhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccc
Confidence            89999999999999999999743 5555 5899999999987654433


No 7  
>KOG1703|consensus
Probab=99.84  E-value=3.1e-22  Score=156.78  Aligned_cols=116  Identities=23%  Similarity=0.523  Sum_probs=110.2

Q ss_pred             cccccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCccccee
Q psy8111           2 ESAVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSY   81 (135)
Q Consensus         2 ~~~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~   81 (135)
                      ...|.+|+++|.++.|.|+++.||++ ||.|..|+++|.+..|+..+|.+||+.||.+++.++|..|.+++...+..+.+
T Consensus       363 ~p~C~~C~~~i~~~~v~a~~~~wH~~-cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~ie~  441 (479)
T KOG1703|consen  363 RPNCKRCLLPILEEGVCALGRLWHPE-CFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQIEA  441 (479)
T ss_pred             CccccccCCchHHhHhhhccCeechh-ceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhhhHhhc
Confidence            35699999999999999999999999 99999999999999999999999999999999999999999998666788999


Q ss_pred             CCccccccccccccccccCCCCCeeeeCCcccCHHhH
Q psy8111          82 KDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCY  118 (135)
Q Consensus        82 ~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~  118 (135)
                      ++..||..||+|..|.+.|.++.|+...++|+|..|+
T Consensus       442 ~~~~~h~~~F~c~~c~~~l~~~~~~~~~~~p~c~~~~  478 (479)
T KOG1703|consen  442 DGSPFHGDCFRCANCMKKLTKKTFFETLDKPLCQKHF  478 (479)
T ss_pred             cCccccccceehhhhhccccCCceeecCCccccccCC
Confidence            9999999999999999999999999999999998875


No 8  
>KOG1044|consensus
Probab=99.82  E-value=2.3e-21  Score=149.96  Aligned_cols=113  Identities=30%  Similarity=0.594  Sum_probs=103.6

Q ss_pred             ccccccCcccc-ccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCccccee
Q psy8111           3 SAVKHQDKSFR-EDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSY   81 (135)
Q Consensus         3 ~~C~~C~~~i~-~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~   81 (135)
                      +.|++|++.|. |+.+.|+++.||.. ||+|..|...|.++ |+.++|.|||++||.+.|+.+|..|.+.|  .+.++.|
T Consensus       134 s~cagc~~~lk~gq~llald~qwhv~-cfkc~~c~~vL~ge-y~skdg~pyce~dy~~~fgvkc~~c~~fi--sgkvLqa  209 (670)
T KOG1044|consen  134 STCAGCGEELKNGQALLALDKQWHVS-CFKCKSCSAVLNGE-YMSKDGVPYCEKDYQAKFGVKCEECEKFI--SGKVLQA  209 (670)
T ss_pred             ccccchhhhhhccceeeeeccceeee-eeehhhhcccccce-eeccCCCcchhhhhhhhcCeehHHhhhhh--hhhhhhc
Confidence            57999999885 89999999999999 99999999999986 99999999999999999999999999999  4889999


Q ss_pred             CCccccccccccccccccCCC-CCeeeeCCcccCHHhHh
Q psy8111          82 KDKHWHEACFSCSKCRQSLVD-KQFGSKSEKIYCGNCYD  119 (135)
Q Consensus        82 ~~~~~H~~Cf~C~~C~~~l~~-~~~~~~~~~~~C~~c~~  119 (135)
                      .|++|||.|-+|+.|+..+++ +..|+.+..++-..|-+
T Consensus       210 g~kh~HPtCARCsRCgqmF~eGEEMYlQGs~iWHP~C~q  248 (670)
T KOG1044|consen  210 GDKHFHPTCARCSRCGQMFGEGEEMYLQGSEIWHPDCKQ  248 (670)
T ss_pred             cCcccCcchhhhhhhccccccchheeeccccccCCcccc
Confidence            999999999999999999985 57888888888777743


No 9  
>KOG1044|consensus
Probab=99.82  E-value=3e-21  Score=149.31  Aligned_cols=126  Identities=23%  Similarity=0.552  Sum_probs=109.7

Q ss_pred             cccCccccccceeeCCCcccCCCCeeccccCCccCCCceE-eECCeeeccCchhhh--------cCCchhhcCCccccCc
Q psy8111           6 KHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYV-LRDDHPYCIKCYESV--------FANSCEECSKIIGIDS   76 (135)
Q Consensus         6 ~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~-~~~~~~~C~~c~~~~--------~~~~C~~C~~~I~~~~   76 (135)
                      ..|...|.+++|.++|++||++ ||.|+.|+.++....-+ .......|+.|..-.        ....|++|++.|. .+
T Consensus        69 ~~c~~~~~gevvsa~gktyh~~-cf~cs~ck~pf~~g~~vt~~gk~~~c~~c~~~~~~~p~~~~~ps~cagc~~~lk-~g  146 (670)
T KOG1044|consen   69 DDCRAFVEGEVVSTLGKTYHPK-CFSCSTCKSPFKSGDKVTFSGKECLCQTCSQPMPVSPAESYGPSTCAGCGEELK-NG  146 (670)
T ss_pred             cchhhhccceeEecccceeccc-cceecccCCCCCCCCeeeecchhhhhhhhcCcccCCcccccCCccccchhhhhh-cc
Confidence            5788899999999999999999 99999999999876444 445557788876531        2357999999997 67


Q ss_pred             ccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          77 KDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        77 ~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      +.+.|+++.||..||+|..|+..|.++ |+..+|.|||+.+|.++|+.+|..|.+.|.
T Consensus       147 q~llald~qwhv~cfkc~~c~~vL~ge-y~skdg~pyce~dy~~~fgvkc~~c~~fis  203 (670)
T KOG1044|consen  147 QALLALDKQWHVSCFKCKSCSAVLNGE-YMSKDGVPYCEKDYQAKFGVKCEECEKFIS  203 (670)
T ss_pred             ceeeeeccceeeeeeehhhhcccccce-eeccCCCcchhhhhhhhcCeehHHhhhhhh
Confidence            889999999999999999999999876 889999999999999999999999998874


No 10 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.69  E-value=2.4e-17  Score=94.14  Aligned_cols=58  Identities=40%  Similarity=0.844  Sum_probs=53.1

Q ss_pred             hhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhc
Q psy8111          65 CEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQF  122 (135)
Q Consensus        65 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~  122 (135)
                      |++|+++|.+.+.++.+.|+.||++||+|+.|+++|.++.++..+++|||+.||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            7889999986666667999999999999999999999888999999999999999876


No 11 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.64  E-value=1.3e-16  Score=91.08  Aligned_cols=56  Identities=27%  Similarity=0.504  Sum_probs=51.2

Q ss_pred             ccccCccccccce--eeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhc
Q psy8111           5 VKHQDKSFREDYN--KLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVF   61 (135)
Q Consensus         5 C~~C~~~i~~~~i--~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~   61 (135)
                      |.+|+++|.+..+  .++|+.||++ ||+|+.|+++|.+..|+..+|++||++||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~-Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPE-CFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETT-TSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEcc-ccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            7899999997553  5999999999 999999999999988999999999999998764


No 12 
>KOG1700|consensus
Probab=99.51  E-value=3.6e-15  Score=104.83  Aligned_cols=119  Identities=23%  Similarity=0.531  Sum_probs=102.5

Q ss_pred             cccccccCccccc-cceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcC------------------
Q psy8111           2 ESAVKHQDKSFRE-DYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFA------------------   62 (135)
Q Consensus         2 ~~~C~~C~~~i~~-~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~------------------   62 (135)
                      -..|.+|++.+.- +.+...|..||.. ||+|..|+..|+...+..+++.+||..+|...++                  
T Consensus         7 ~~kc~~c~k~vy~~e~~~~~g~~~hk~-c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVEKVQKDGVDFHKE-CFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKGGGFGKGFQKAGGLGK   85 (200)
T ss_pred             cchhhhccCcchHHHHHhccCcchhhh-HHhccccccccccccccccccccccccchHhhhCcccccccccccccCCCCc
Confidence            3569999999984 5567899999999 9999999999999889999999999996554433                  


Q ss_pred             -----------------------CchhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHh
Q psy8111          63 -----------------------NSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYD  119 (135)
Q Consensus        63 -----------------------~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~  119 (135)
                                             ..|.+|++.+++ .+.+...+..||..||+|+.|+..|....+....+.+||..++.
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~g~~~~c~~c~k~vy~-~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~  164 (200)
T KOG1700|consen   86 DGKSLNESKPNQSAKFQVFAGEKEKCARCQKTVYP-LEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFA  164 (200)
T ss_pred             ccccccccccccchhHHhhhccccccccccceeee-hHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhh
Confidence                                   479999999985 44577789999999999999999999999999999999988876


Q ss_pred             hhc
Q psy8111         120 AQF  122 (135)
Q Consensus       120 ~~~  122 (135)
                      .++
T Consensus       165 ~~~  167 (200)
T KOG1700|consen  165 QLF  167 (200)
T ss_pred             eee
Confidence            654


No 13 
>KOG4577|consensus
Probab=99.46  E-value=2.5e-15  Score=108.44  Aligned_cols=78  Identities=29%  Similarity=0.689  Sum_probs=69.7

Q ss_pred             chhhhcCCchhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCCC
Q psy8111          56 CYESVFANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFKA  135 (135)
Q Consensus        56 c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~  135 (135)
                      ++...-.++|++|.+.|. +..++.++++.||..|++|+.|..+|.+. .+.+++.+||+++|.++|++||+.|+++|.|
T Consensus        27 df~~~eip~CagC~q~Il-DrFilKvl~R~wHs~CLkCs~C~~qL~dr-CFsR~~s~yCkedFfKrfGTKCsaC~~GIpP  104 (383)
T KOG4577|consen   27 DFSNVEIPICAGCDQHIL-DRFILKVLDRHWHSSCLKCSDCHDQLADR-CFSREGSVYCKEDFFKRFGTKCSACQEGIPP  104 (383)
T ss_pred             cccccccccccchHHHHH-HHHHHHHHhhhhhhhhcchhhhhhHHHHH-HhhcCCceeehHHHHHHhCCcchhhcCCCCh
Confidence            344445689999999997 67778999999999999999999999775 6689999999999999999999999999986


No 14 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.98  E-value=2.7e-10  Score=59.30  Aligned_cols=38  Identities=39%  Similarity=0.756  Sum_probs=33.5

Q ss_pred             chhhcCCccccCcccceeCCccccccccccccccccCC
Q psy8111          64 SCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLV  101 (135)
Q Consensus        64 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  101 (135)
                      +|.+|+++|.+.+..+.+.++.||++||+|..|+++|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            58899999975447788999999999999999999985


No 15 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.91  E-value=7.6e-10  Score=57.57  Aligned_cols=36  Identities=22%  Similarity=0.235  Sum_probs=32.8

Q ss_pred             cccccCccccc--cceeeCCCcccCCCCeeccccCCccC
Q psy8111           4 AVKHQDKSFRE--DYNKLGGKDRGSGQHFCCWQCDESLT   40 (135)
Q Consensus         4 ~C~~C~~~i~~--~~i~a~~~~~H~~~cf~C~~C~~~l~   40 (135)
                      .|.+|+++|.+  ..+.++++.||++ ||+|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~-Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPE-CFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCcccccc-CCCCcccCCcCc
Confidence            48899999997  5688999999999 999999999986


No 16 
>KOG0490|consensus
Probab=98.26  E-value=1.5e-07  Score=67.37  Aligned_cols=112  Identities=20%  Similarity=0.385  Sum_probs=91.1

Q ss_pred             ccCccccccc-eeeCCCcccCCCCeeccccCCccC-CCceEeECCeeeccCchhh--hcCCchhhcCCccccCcccceeC
Q psy8111           7 HQDKSFREDY-NKLGGKDRGSGQHFCCWQCDESLT-GQRYVLRDDHPYCIKCYES--VFANSCEECSKIIGIDSKDLSYK   82 (135)
Q Consensus         7 ~C~~~i~~~~-i~a~~~~~H~~~cf~C~~C~~~l~-~~~~~~~~~~~~C~~c~~~--~~~~~C~~C~~~I~~~~~~~~~~   82 (135)
                      .|+..|.|++ +.+.+..||.. |..|..|...|. ....+.++|..||..+|..  .+..+|.+|...+...+++..+.
T Consensus         1 ~~~~~~~~~~~l~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~g~~~~~~d~~~~~~~~~rr~rt~~~~~ql~~ler~f   79 (235)
T KOG0490|consen    1 GCGRQILDRYLLRVLDRYWHAS-CLKCAECDNPLGVGDTCFSKDGSIYCKRDYQREFKFSKRCARCKFTISQLDELERAF   79 (235)
T ss_pred             CCCccccchHHhhcccHHHHHH-HHhhhhhcchhccCCCcccCCCcccccccchhhhhccccccCCCCCcCHHHHHHHhh
Confidence            3778888876 67789999999 999999999997 2244444999999999998  77889999999997778888888


Q ss_pred             CccccccccccccccccCCC-CCeeeeC-CcccCHHhHhh
Q psy8111          83 DKHWHEACFSCSKCRQSLVD-KQFGSKS-EKIYCGNCYDA  120 (135)
Q Consensus        83 ~~~~H~~Cf~C~~C~~~l~~-~~~~~~~-~~~~C~~c~~~  120 (135)
                      .+. |..||.|..|...+.+ ..+.+.+ -+..+.+.+.+
T Consensus        80 ~~~-h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~  118 (235)
T KOG0490|consen   80 EKV-HLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKE  118 (235)
T ss_pred             cCC-CcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhh
Confidence            888 9999999999887754 3555554 48888877754


No 17 
>KOG1700|consensus
Probab=98.07  E-value=1.2e-06  Score=61.78  Aligned_cols=63  Identities=27%  Similarity=0.704  Sum_probs=54.1

Q ss_pred             CCchhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCC
Q psy8111          62 ANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASR  125 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~  125 (135)
                      ..+|.+|++.++..+ .+...|..||+.||+|..|...|....+...++.+||+.++..+++++
T Consensus         7 ~~kc~~c~k~vy~~e-~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~   69 (200)
T KOG1700|consen    7 TDKCNACGKTVYFVE-KVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPK   69 (200)
T ss_pred             cchhhhccCcchHHH-HHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCcc
Confidence            468999999997544 455889999999999999999999888989999999999877777653


No 18 
>KOG1702|consensus
Probab=97.77  E-value=2.7e-06  Score=59.45  Aligned_cols=61  Identities=31%  Similarity=0.647  Sum_probs=52.4

Q ss_pred             CchhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCC
Q psy8111          63 NSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFAS  124 (135)
Q Consensus        63 ~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~  124 (135)
                      +.+..|++.++|.+ .+..+++.||..||+|..|+.+|.-..+...+.+|||..+|.++.++
T Consensus         5 ~n~~~cgk~vYPvE-~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~at   65 (264)
T KOG1702|consen    5 CNREDCGKTVYPVE-EVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQVAT   65 (264)
T ss_pred             chhhhhccccccHH-HHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccceee
Confidence            45677889888654 57788999999999999999999988888899999999999887653


No 19 
>KOG1702|consensus
Probab=97.23  E-value=3e-05  Score=54.32  Aligned_cols=59  Identities=24%  Similarity=0.284  Sum_probs=50.7

Q ss_pred             ccccccCccccc-cceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcC
Q psy8111           3 SAVKHQDKSFRE-DYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFA   62 (135)
Q Consensus         3 ~~C~~C~~~i~~-~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~   62 (135)
                      -.+..|++.+.. +-+.-+++.||.. ||+|..|+.+|.-..+-..+.++||..+|.+..+
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~-cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq~a   64 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQ-CFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQVA   64 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHH-hheeeeccCChhhhhccccccCCCcCccccccee
Confidence            357889999884 6688899999999 9999999999987778889999999999976543


No 20 
>KOG0490|consensus
Probab=96.19  E-value=0.0016  Score=46.51  Aligned_cols=65  Identities=32%  Similarity=0.759  Sum_probs=53.1

Q ss_pred             cCCccccCcccceeCCccccccccccccccccCC--CCCeeeeCCcccCHHhHhh--hcCCCcccCCCCCC
Q psy8111          68 CSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLV--DKQFGSKSEKIYCGNCYDA--QFASRCDGCSEIFK  134 (135)
Q Consensus        68 C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~--~~~~~~~~~~~~C~~c~~~--~~~~~C~~C~~~I~  134 (135)
                      |+..|. +...+.+.+..||..|..|..|...+.  ...|.. +|..||...+.+  .+..+|.+|...|.
T Consensus         2 ~~~~~~-~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr~rt~~~~~   70 (235)
T KOG0490|consen    2 CGRQIL-DRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRCARCKFTIS   70 (235)
T ss_pred             CCcccc-chHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccccCCCCCcC
Confidence            556664 445566779999999999999999997  445655 999999999998  88899999987763


No 21 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=93.05  E-value=0.067  Score=30.77  Aligned_cols=43  Identities=26%  Similarity=0.541  Sum_probs=21.6

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIF  133 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I  133 (135)
                      .+|+.|...|...--...=+..||..|..+.++..|..|+.|-
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Pa   50 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPA   50 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChH
Confidence            5677887776543222334788999999998899999998764


No 22 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=91.26  E-value=0.19  Score=28.91  Aligned_cols=47  Identities=19%  Similarity=0.438  Sum_probs=24.5

Q ss_pred             eeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCc
Q psy8111          30 FCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDS   76 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~   76 (135)
                      ++|+.|...|........=+..||..|....++..|+.|..|-+..+
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~CPvC~~Paw~qD   54 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSECPVCHTPAWIQD   54 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-SSS--B-S-SS
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCCCCcCChHHHHH
Confidence            67888988887643445557889999998888889999999986433


No 23 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=90.77  E-value=0.38  Score=25.26  Aligned_cols=39  Identities=18%  Similarity=0.584  Sum_probs=28.0

Q ss_pred             cccccccCC-CCCeeee-CCcccCHHhHhhhc--CCCcccCCC
Q psy8111          93 CSKCRQSLV-DKQFGSK-SEKIYCGNCYDAQF--ASRCDGCSE  131 (135)
Q Consensus        93 C~~C~~~l~-~~~~~~~-~~~~~C~~c~~~~~--~~~C~~C~~  131 (135)
                      |..|...+. ...+.+. =|..+|..|..+..  ..+|..|++
T Consensus         2 C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen    2 CNICFEKYSEERRPRLTSCGHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CcCcCccccCCCCeEEcccCCHHHHHHHHhhcCCCCCCcCCCC
Confidence            566777773 2334444 49999999998888  678888864


No 24 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=90.76  E-value=0.18  Score=28.03  Aligned_cols=30  Identities=17%  Similarity=0.398  Sum_probs=19.9

Q ss_pred             CCchhhcCCccccCccccee--CCcccccccc
Q psy8111          62 ANSCEECSKIIGIDSKDLSY--KDKHWHEACF   91 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~--~~~~~H~~Cf   91 (135)
                      +.+|..|+++|.+.+.+|.-  =+..||.+|+
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            46888888888644444442  3567777776


No 25 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=89.30  E-value=0.2  Score=31.19  Aligned_cols=29  Identities=21%  Similarity=0.334  Sum_probs=15.8

Q ss_pred             CchhhcCCccccCcccceeCCcccccccc
Q psy8111          63 NSCEECSKIIGIDSKDLSYKDKHWHEACF   91 (135)
Q Consensus        63 ~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf   91 (135)
                      ..|+.|+++|.....++...|..+|..|+
T Consensus        79 ~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   79 TKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            46777777775333233334555666664


No 26 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=88.96  E-value=0.18  Score=25.76  Aligned_cols=26  Identities=19%  Similarity=0.381  Sum_probs=15.6

Q ss_pred             hhhcCCccccCcccceeCCccccccc
Q psy8111          65 CEECSKIIGIDSKDLSYKDKHWHEAC   90 (135)
Q Consensus        65 C~~C~~~I~~~~~~~~~~~~~~H~~C   90 (135)
                      |.-|+++|.....++...++.|+.-|
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~fCC   26 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYYFCC   26 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEEEEC
Confidence            45677777544445566777776433


No 27 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.79  E-value=0.53  Score=26.57  Aligned_cols=49  Identities=22%  Similarity=0.666  Sum_probs=26.3

Q ss_pred             CCchhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCC
Q psy8111          62 ANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCS  130 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~  130 (135)
                      .++|..|+..|.+.+..+.          |.|..|+..+...          |..|-.....-+|..|+
T Consensus         7 ~~~CtSCg~~i~~~~~~~~----------F~CPnCG~~~I~R----------C~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAVK----------FLCPNCGEVIIYR----------CEKCRKQSNPYTCPKCG   55 (59)
T ss_pred             CccccCCCCcccCCCccCE----------eeCCCCCCeeEee----------chhHHhcCCceECCCCC
Confidence            3567778777754332221          6677776653221          55554443344566654


No 28 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=83.48  E-value=0.99  Score=25.51  Aligned_cols=29  Identities=21%  Similarity=0.625  Sum_probs=18.0

Q ss_pred             CCchhhcCCccccCcccceeCCccccccccccccccccC
Q psy8111          62 ANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSL  100 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l  100 (135)
                      .+.|.+|+..|.+.+..+.          |.|..|+..+
T Consensus         9 ~~~CtSCg~~i~p~e~~v~----------F~CPnCGe~~   37 (61)
T COG2888           9 PPVCTSCGREIAPGETAVK----------FPCPNCGEVE   37 (61)
T ss_pred             CceeccCCCEeccCCceeE----------eeCCCCCcee
Confidence            4678888888755444332          6677777443


No 29 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=83.26  E-value=1  Score=23.53  Aligned_cols=22  Identities=32%  Similarity=0.832  Sum_probs=15.4

Q ss_pred             eccccCCccCCCceEeECCeeeccCc
Q psy8111          31 CCWQCDESLTGQRYVLRDDHPYCIKC   56 (135)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c   56 (135)
                      .|..|+.||-    -.++|+.||..|
T Consensus        19 ~Cp~C~~PL~----~~k~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPLM----RDKDGKIYCVSC   40 (41)
T ss_pred             ccCCCCCeeE----EecCCCEECCCC
Confidence            4667777763    357888888766


No 30 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=82.88  E-value=1.8  Score=24.10  Aligned_cols=43  Identities=12%  Similarity=0.102  Sum_probs=27.9

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhc--CCCcccCCCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQF--ASRCDGCSEIFK  134 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~I~  134 (135)
                      |.|..|+..+.+ ......|..||+.+..+.+  ...|..|++++.
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            456777777655 3555667888888876543  356777777663


No 31 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=82.76  E-value=0.6  Score=32.99  Aligned_cols=31  Identities=29%  Similarity=0.604  Sum_probs=26.6

Q ss_pred             eeccccCCccCCCceEeECCeeeccCchhhh
Q psy8111          30 FCCWQCDESLTGQRYVLRDDHPYCIKCYESV   60 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~   60 (135)
                      -+|+.|+..+....-...+|+++|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            4789999999887777899999999998754


No 32 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=81.24  E-value=0.57  Score=33.12  Aligned_cols=31  Identities=23%  Similarity=0.513  Sum_probs=27.1

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhh
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQ  121 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~  121 (135)
                      -+|+.|+..+....-...||+++|..|+.+.
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            5799999999887788889999999999754


No 33 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=80.25  E-value=1.6  Score=21.90  Aligned_cols=40  Identities=18%  Similarity=0.553  Sum_probs=22.0

Q ss_pred             cccccccCCCCCeeee-CCcccCHHhHhhhc---CCCcccCCCCC
Q psy8111          93 CSKCRQSLVDKQFGSK-SEKIYCGNCYDAQF---ASRCDGCSEIF  133 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~-~~~~~C~~c~~~~~---~~~C~~C~~~I  133 (135)
                      |..|...+.. .+... =+..+|..|..+.+   ..+|..|+..+
T Consensus         2 C~iC~~~~~~-~~~~~~C~H~~c~~C~~~~~~~~~~~Cp~C~~~~   45 (45)
T cd00162           2 CPICLEEFRE-PVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI   45 (45)
T ss_pred             CCcCchhhhC-ceEecCCCChhcHHHHHHHHHhCcCCCCCCCCcC
Confidence            4455555522 22222 46677777775443   34688887653


No 34 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=80.22  E-value=1  Score=24.15  Aligned_cols=42  Identities=17%  Similarity=0.478  Sum_probs=27.5

Q ss_pred             ccccccccCCCCCeeeeCCcc-cCHHhHhhh--cCCCcccCCCCCC
Q psy8111          92 SCSKCRQSLVDKQFGSKSEKI-YCGNCYDAQ--FASRCDGCSEIFK  134 (135)
Q Consensus        92 ~C~~C~~~l~~~~~~~~~~~~-~C~~c~~~~--~~~~C~~C~~~I~  134 (135)
                      .|..|.....+ .....=|.. +|..|+.+.  ...+|..|.++|.
T Consensus         4 ~C~iC~~~~~~-~~~~pCgH~~~C~~C~~~~~~~~~~CP~Cr~~i~   48 (50)
T PF13920_consen    4 ECPICFENPRD-VVLLPCGHLCFCEECAERLLKRKKKCPICRQPIE   48 (50)
T ss_dssp             B-TTTSSSBSS-EEEETTCEEEEEHHHHHHHHHTTSBBTTTTBB-S
T ss_pred             CCccCCccCCc-eEEeCCCChHHHHHHhHHhcccCCCCCcCChhhc
Confidence            45666665433 233334667 999999876  4689999999885


No 35 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=80.05  E-value=1.1  Score=22.61  Aligned_cols=25  Identities=24%  Similarity=0.498  Sum_probs=18.7

Q ss_pred             eeccccCCccCCCceEeECCeeeccCchh
Q psy8111          30 FCCWQCDESLTGQRYVLRDDHPYCIKCYE   58 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (135)
                      +.|..|+..    .|...+|..||.+|..
T Consensus         9 ~~C~~C~~~----~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSR----WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCe----EeEccCCEEEhhhCce
Confidence            447888665    4778999999987754


No 36 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=79.69  E-value=1.6  Score=19.67  Aligned_cols=8  Identities=38%  Similarity=1.028  Sum_probs=3.3

Q ss_pred             hhhcCCcc
Q psy8111          65 CEECSKII   72 (135)
Q Consensus        65 C~~C~~~I   72 (135)
                      |..|+..|
T Consensus         2 Cp~CG~~~    9 (23)
T PF13240_consen    2 CPNCGAEI    9 (23)
T ss_pred             CcccCCCC
Confidence            33444444


No 37 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=78.73  E-value=1.1  Score=26.20  Aligned_cols=60  Identities=20%  Similarity=0.461  Sum_probs=25.6

Q ss_pred             eccccCCccCCCceEeECCeeeccCchhh-hcCCchhhcCCccccCcccceeCCccccccccccccccccCCCC
Q psy8111          31 CCWQCDESLTGQRYVLRDDHPYCIKCYES-VFANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDK  103 (135)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~~~-~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~  103 (135)
                      .|..|..+|+.     .++..+|..|... ...+.|+.|++++.    ++.|=|..    =|.|..|+..++.+
T Consensus         3 ~CP~C~~~L~~-----~~~~~~C~~C~~~~~~~a~CPdC~~~Le----~LkACGAv----dYFC~~c~gLiSKk   63 (70)
T PF07191_consen    3 TCPKCQQELEW-----QGGHYHCEACQKDYKKEAFCPDCGQPLE----VLKACGAV----DYFCNHCHGLISKK   63 (70)
T ss_dssp             B-SSS-SBEEE-----ETTEEEETTT--EEEEEEE-TTT-SB-E----EEEETTEE----EEE-TTTT-EE-TT
T ss_pred             cCCCCCCccEE-----eCCEEECccccccceecccCCCcccHHH----HHHHhccc----ceeeccCCceeecc
Confidence            35555555532     2356666655432 12357777888773    45554421    14466666666544


No 38 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=78.56  E-value=0.3  Score=24.57  Aligned_cols=26  Identities=15%  Similarity=0.601  Sum_probs=10.0

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhH
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCY  118 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~  118 (135)
                      |..|+.++.........+..+|..|.
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~   31 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQ   31 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHh
Confidence            34444444333333334444444443


No 39 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=77.67  E-value=1.5  Score=27.18  Aligned_cols=28  Identities=21%  Similarity=0.408  Sum_probs=21.9

Q ss_pred             ccccccccCCCCCeeee-CCcccCHHhHh
Q psy8111          92 SCSKCRQSLVDKQFGSK-SEKIYCGNCYD  119 (135)
Q Consensus        92 ~C~~C~~~l~~~~~~~~-~~~~~C~~c~~  119 (135)
                      .|..|+++|+.+.|... +|.++...|..
T Consensus        80 ~C~vC~k~l~~~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   80 KCSVCGKPLGNSVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CccCcCCcCCCceEEEeCCCeEEeccccc
Confidence            49999999998877665 67887777753


No 40 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=77.19  E-value=4.8  Score=22.48  Aligned_cols=42  Identities=19%  Similarity=0.580  Sum_probs=28.0

Q ss_pred             cccccccCCCC---CeeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          93 CSKCRQSLVDK---QFGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        93 C~~C~~~l~~~---~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      |..|++.|...   .+.-.-.=-||.+|.+..+...|..|+..+.
T Consensus         8 CE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen    8 CECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             ccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCccc
Confidence            55666666533   2222334567889988888889999987654


No 41 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=75.74  E-value=0.82  Score=28.72  Aligned_cols=28  Identities=29%  Similarity=0.577  Sum_probs=15.4

Q ss_pred             chhhcCCccccCccccee-CCccccccccc
Q psy8111          64 SCEECSKIIGIDSKDLSY-KDKHWHEACFS   92 (135)
Q Consensus        64 ~C~~C~~~I~~~~~~~~~-~~~~~H~~Cf~   92 (135)
                      +|..|+++|. .++..++ .+..-|-.||+
T Consensus         4 kC~iCg~~I~-~gqlFTF~~kG~VH~~C~~   32 (101)
T PF09943_consen    4 KCYICGKPIY-EGQLFTFTKKGPVHYECFR   32 (101)
T ss_pred             EEEecCCeee-ecceEEEecCCcEeHHHHH
Confidence            5666777765 3334333 33455666665


No 42 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=75.40  E-value=2.3  Score=28.02  Aligned_cols=23  Identities=26%  Similarity=0.709  Sum_probs=18.0

Q ss_pred             eccccCCccCCCceEeECCeeeccCchh
Q psy8111          31 CCWQCDESLTGQRYVLRDDHPYCIKCYE   58 (135)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (135)
                      .|..|+.||    |- ++|.+||.-|-.
T Consensus        30 hCp~Cg~PL----F~-KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPL----FR-KDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcc----ee-eCCeEECCCCCc
Confidence            467888877    44 999999998864


No 43 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=75.18  E-value=0.5  Score=29.33  Aligned_cols=59  Identities=20%  Similarity=0.541  Sum_probs=36.5

Q ss_pred             chhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcc
Q psy8111          64 SCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCD  127 (135)
Q Consensus        64 ~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~  127 (135)
                      .|..|...+. +.......-..+++.+.-|..|.+.|.-..|...+.=|||    +..|.|+|.
T Consensus        37 aCy~CHdel~-~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C----~spFNp~Ck   95 (105)
T COG4357          37 ACYHCHDELE-DHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCGSCPYC----QSPFNPGCK   95 (105)
T ss_pred             hHHHHHhHHh-cCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcCCCCCc----CCCCCcccc
Confidence            4555665553 2233444446678888888888888876667666665555    345555553


No 44 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=74.02  E-value=2  Score=26.47  Aligned_cols=42  Identities=21%  Similarity=0.385  Sum_probs=27.5

Q ss_pred             cccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccc
Q psy8111          23 DRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIG   73 (135)
Q Consensus        23 ~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~   73 (135)
                      .|-+. --.|..|+..+..      .|.-||+.|..+.  ..|+-|++.|.
T Consensus        39 Py~~~-~~~C~~CK~~v~q------~g~~YCq~CAYkk--GiCamCGKki~   80 (90)
T PF10235_consen   39 PYAPY-SSKCKICKTKVHQ------PGAKYCQTCAYKK--GICAMCGKKIL   80 (90)
T ss_pred             ccccc-Ccccccccccccc------CCCccChhhhccc--CcccccCCeec
Confidence            34443 3456677655532      3677898887664  48888888884


No 45 
>KOG4739|consensus
Probab=72.21  E-value=2.9  Score=30.30  Aligned_cols=40  Identities=20%  Similarity=0.498  Sum_probs=27.0

Q ss_pred             cccccCCCCCeeeeC-CcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          95 KCRQSLVDKQFGSKS-EKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        95 ~C~~~l~~~~~~~~~-~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      .|.+.=....|++.. ..++|..|.....++.|.-|+++|.
T Consensus         8 ~C~~~~~~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir   48 (233)
T KOG4739|consen    8 KCFRFPSQDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIR   48 (233)
T ss_pred             cccccCCCCceeeeechhhhhhhhcccCCccccccccceee
Confidence            333333344565554 7888888887777778888888764


No 46 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=71.87  E-value=3.1  Score=22.71  Aligned_cols=29  Identities=21%  Similarity=0.513  Sum_probs=19.3

Q ss_pred             ccccccccCCCC-CeeeeCCcccCHHhHhhh
Q psy8111          92 SCSKCRQSLVDK-QFGSKSEKIYCGNCYDAQ  121 (135)
Q Consensus        92 ~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~~  121 (135)
                      .|..|+..++-- .+-..|| ..|.+|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            367777777643 3556677 5788888665


No 47 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=71.32  E-value=2.4  Score=19.59  Aligned_cols=13  Identities=15%  Similarity=0.079  Sum_probs=7.9

Q ss_pred             CcccccccCcccc
Q psy8111           1 MESAVKHQDKSFR   13 (135)
Q Consensus         1 ~~~~C~~C~~~i~   13 (135)
                      |+..|..|+..|.
T Consensus         1 m~~~Cp~Cg~~~~   13 (26)
T PF13248_consen    1 MEMFCPNCGAEID   13 (26)
T ss_pred             CcCCCcccCCcCC
Confidence            4566666666554


No 48 
>KOG0320|consensus
Probab=71.27  E-value=3.2  Score=28.85  Aligned_cols=47  Identities=21%  Similarity=0.685  Sum_probs=36.5

Q ss_pred             ccccccccccccCCCC-CeeeeCCcccCHHhHhhh--cCCCcccCCCCCC
Q psy8111          88 EACFSCSKCRQSLVDK-QFGSKSEKIYCGNCYDAQ--FASRCDGCSEIFK  134 (135)
Q Consensus        88 ~~Cf~C~~C~~~l~~~-~~~~~~~~~~C~~c~~~~--~~~~C~~C~~~I~  134 (135)
                      ..+|+|..|-...... .+...=|.+||+.|....  .+.+|..|.+-|.
T Consensus       129 ~~~~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  129 EGTYKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKIT  178 (187)
T ss_pred             ccccCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccc
Confidence            4678888887777654 355677999999999764  4679999998775


No 49 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=69.78  E-value=3.1  Score=22.90  Aligned_cols=27  Identities=22%  Similarity=0.629  Sum_probs=15.3

Q ss_pred             ccccCCccCCCceEeECCeeecc-Cchh
Q psy8111          32 CWQCDESLTGQRYVLRDDHPYCI-KCYE   58 (135)
Q Consensus        32 C~~C~~~l~~~~~~~~~~~~~C~-~c~~   58 (135)
                      |..|...++...-+.+||+.||. .|..
T Consensus        10 C~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen   10 CPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             STT----B-TTTSEESSS-EESSHHHHH
T ss_pred             CCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            56777777766788999999985 4543


No 50 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=69.78  E-value=1.9  Score=26.46  Aligned_cols=16  Identities=31%  Similarity=1.134  Sum_probs=12.9

Q ss_pred             hhhhcCCchhhcCCcc
Q psy8111          57 YESVFANSCEECSKII   72 (135)
Q Consensus        57 ~~~~~~~~C~~C~~~I   72 (135)
                      |..+|...|..|++.+
T Consensus        49 Y~~lfs~pC~~C~klL   64 (90)
T PF11571_consen   49 YRNLFSTPCKKCGKLL   64 (90)
T ss_pred             HhhhccchhhHHHhHh
Confidence            4567778999999988


No 51 
>PF12773 DZR:  Double zinc ribbon
Probab=68.32  E-value=6.5  Score=20.86  Aligned_cols=23  Identities=30%  Similarity=0.676  Sum_probs=12.2

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhHh
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCYD  119 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~~  119 (135)
                      |..|+.+|.    .......+|..|-.
T Consensus        15 C~~CG~~l~----~~~~~~~~C~~Cg~   37 (50)
T PF12773_consen   15 CPHCGTPLP----PPDQSKKICPNCGA   37 (50)
T ss_pred             ChhhcCChh----hccCCCCCCcCCcC
Confidence            667777776    12223445555543


No 52 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=66.79  E-value=1.3  Score=26.39  Aligned_cols=31  Identities=26%  Similarity=0.540  Sum_probs=17.8

Q ss_pred             CCchhhcCCccccCccccee-----CC-----ccccccccc
Q psy8111          62 ANSCEECSKIIGIDSKDLSY-----KD-----KHWHEACFS   92 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~-----~~-----~~~H~~Cf~   92 (135)
                      ..+|..|++.|..++..|..     .+     .-||..||.
T Consensus         7 Ra~Ck~C~~~I~kg~lRiG~~~~~~~~~~~~~~W~H~~C~~   47 (82)
T PF00645_consen    7 RAKCKGCKKKIAKGELRIGKIVPSPEGDGDIPKWYHWDCFF   47 (82)
T ss_dssp             TEBETTTSCBE-TTSEEEEEEEEETTSSCEEEEEEEHHHHH
T ss_pred             CccCcccCCcCCCCCEEEEEEecccccCCCCCceECccccc
Confidence            45788899988644332221     11     346888876


No 53 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=66.59  E-value=5.6  Score=33.23  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=4.0

Q ss_pred             chhhcCCcc
Q psy8111          64 SCEECSKII   72 (135)
Q Consensus        64 ~C~~C~~~I   72 (135)
                      .|..|+..+
T Consensus        29 ~Cp~CG~~~   37 (645)
T PRK14559         29 PCPQCGTEV   37 (645)
T ss_pred             cCCCCCCCC
Confidence            344444443


No 54 
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=65.95  E-value=4.9  Score=27.28  Aligned_cols=11  Identities=18%  Similarity=0.268  Sum_probs=5.6

Q ss_pred             ccccCcccccc
Q psy8111           5 VKHQDKSFRED   15 (135)
Q Consensus         5 C~~C~~~i~~~   15 (135)
                      |..|+-+|.|.
T Consensus        42 Cp~C~~~IrG~   52 (158)
T PF10083_consen   42 CPNCSTPIRGD   52 (158)
T ss_pred             CcCCCCCCCCc
Confidence            45555555543


No 55 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=63.51  E-value=3.7  Score=24.72  Aligned_cols=28  Identities=32%  Similarity=0.952  Sum_probs=17.4

Q ss_pred             cccccccCCCCC-eeee-C---CcccCHHhHhh
Q psy8111          93 CSKCRQSLVDKQ-FGSK-S---EKIYCGNCYDA  120 (135)
Q Consensus        93 C~~C~~~l~~~~-~~~~-~---~~~~C~~c~~~  120 (135)
                      |.+|+.||.... +... |   +.-||.-||..
T Consensus         3 CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~~   35 (81)
T PF12674_consen    3 CQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQN   35 (81)
T ss_pred             CCcCcCccCCccccccccCCCCchhHHHHHhcC
Confidence            677888886554 2222 2   45688888753


No 56 
>KOG2682|consensus
Probab=63.45  E-value=2.6  Score=30.87  Aligned_cols=50  Identities=16%  Similarity=0.338  Sum_probs=35.6

Q ss_pred             CcccceeCCccccccccccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCCC
Q psy8111          75 DSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFKA  135 (135)
Q Consensus        75 ~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~  135 (135)
                      ++..|+|.|...|..|..  .|++....+-+         +.+....-.|||..|+..|.|
T Consensus       140 d~~lvEAHGtFa~s~Ci~--~C~~~yp~e~~---------ka~i~~~~vpkC~vC~~lVKP  189 (314)
T KOG2682|consen  140 DEDLVEAHGTFATSHCIS--SCRHEYPLEWM---------KAKIMSEVVPKCEVCQGLVKP  189 (314)
T ss_pred             HHHHHHhccceeeeeehh--hhcCcCCHHHH---------HHHHHhccCCCCchhhccccc
Confidence            456788888888887764  57777765522         444555566899999988876


No 57 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=62.51  E-value=5.6  Score=18.23  Aligned_cols=10  Identities=0%  Similarity=0.023  Sum_probs=4.6

Q ss_pred             ccccCccccc
Q psy8111           5 VKHQDKSFRE   14 (135)
Q Consensus         5 C~~C~~~i~~   14 (135)
                      |..|+.+|.+
T Consensus         1 C~sC~~~i~~   10 (24)
T PF07754_consen    1 CTSCGRPIAP   10 (24)
T ss_pred             CccCCCcccC
Confidence            3445555443


No 58 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=62.49  E-value=6.7  Score=20.64  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=5.5

Q ss_pred             cccCHHhHhh
Q psy8111         111 KIYCGNCYDA  120 (135)
Q Consensus       111 ~~~C~~c~~~  120 (135)
                      --+|.+||..
T Consensus        23 ~dLC~~Cf~~   32 (46)
T cd02249          23 FDLCSSCYAK   32 (46)
T ss_pred             CcCHHHHHCc
Confidence            3456666653


No 59 
>PRK00420 hypothetical protein; Validated
Probab=62.45  E-value=5.5  Score=25.57  Aligned_cols=25  Identities=24%  Similarity=0.387  Sum_probs=17.1

Q ss_pred             eeccccCCccCCCceEeECCeeeccCchh
Q psy8111          30 FCCWQCDESLTGQRYVLRDDHPYCIKCYE   58 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (135)
                      -.|..|+.+|    |-.++|+.||..|-.
T Consensus        24 ~~CP~Cg~pL----f~lk~g~~~Cp~Cg~   48 (112)
T PRK00420         24 KHCPVCGLPL----FELKDGEVVCPVHGK   48 (112)
T ss_pred             CCCCCCCCcc----eecCCCceECCCCCC
Confidence            3567787776    334788888887744


No 60 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=62.18  E-value=3.9  Score=20.49  Aligned_cols=13  Identities=31%  Similarity=0.396  Sum_probs=6.7

Q ss_pred             CcccccccCcccc
Q psy8111           1 MESAVKHQDKSFR   13 (135)
Q Consensus         1 ~~~~C~~C~~~i~   13 (135)
                      |...|..|+..+.
T Consensus         1 M~~~CP~C~~~~~   13 (38)
T TIGR02098         1 MRIQCPNCKTSFR   13 (38)
T ss_pred             CEEECCCCCCEEE
Confidence            4445556655543


No 61 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=61.86  E-value=5.6  Score=22.40  Aligned_cols=27  Identities=30%  Similarity=0.907  Sum_probs=20.2

Q ss_pred             eccccCCccCC-C-ceEeECCeeecc-Cch
Q psy8111          31 CCWQCDESLTG-Q-RYVLRDDHPYCI-KCY   57 (135)
Q Consensus        31 ~C~~C~~~l~~-~-~~~~~~~~~~C~-~c~   57 (135)
                      .|..|++.|.. . .|..++++++|. +|-
T Consensus        18 ~C~~C~k~L~~~~DiymYrGd~aFCS~ECR   47 (58)
T PF04570_consen   18 FCYLCKKKLDPGKDIYMYRGDKAFCSEECR   47 (58)
T ss_pred             HHHccCCCCCCCCCeeeeccccccccHHHH
Confidence            46788999984 3 677888999996 443


No 62 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=61.52  E-value=3.1  Score=20.89  Aligned_cols=22  Identities=9%  Similarity=0.244  Sum_probs=13.8

Q ss_pred             eeCCCcccCCCCeeccccCCccC
Q psy8111          18 KLGGKDRGSGQHFCCWQCDESLT   40 (135)
Q Consensus        18 ~a~~~~~H~~~cf~C~~C~~~l~   40 (135)
                      ...++.||.. =..|..||-.+.
T Consensus        11 ~p~~RR~~~~-~isC~~CGPr~~   32 (35)
T PF07503_consen   11 DPSNRRFHYQ-FISCTNCGPRYS   32 (35)
T ss_dssp             STTSTTTT-T-T--BTTCC-SCC
T ss_pred             CCCCCcccCc-CccCCCCCCCEE
Confidence            3457999999 888999987653


No 63 
>KOG1813|consensus
Probab=61.36  E-value=4.8  Score=30.23  Aligned_cols=43  Identities=23%  Similarity=0.580  Sum_probs=32.6

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhc--CCCcccCCCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQF--ASRCDGCSEIFK  134 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~I~  134 (135)
                      |.|..|.+.+-. .....-+.-+|+.|.-+.|  +++|..|++.+.
T Consensus       242 f~c~icr~~f~~-pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~  286 (313)
T KOG1813|consen  242 FKCFICRKYFYR-PVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTH  286 (313)
T ss_pred             cccccccccccc-chhhcCCceeehhhhccccccCCcceecccccc
Confidence            778888888754 3555667888999987766  479999998763


No 64 
>KOG3002|consensus
Probab=59.35  E-value=8.3  Score=29.08  Aligned_cols=43  Identities=19%  Similarity=0.575  Sum_probs=34.1

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      +.|..|-..|..-.|.-.+|.+.|..|-. +...+|..|..+|.
T Consensus        49 leCPvC~~~l~~Pi~QC~nGHlaCssC~~-~~~~~CP~Cr~~~g   91 (299)
T KOG3002|consen   49 LDCPVCFNPLSPPIFQCDNGHLACSSCRT-KVSNKCPTCRLPIG   91 (299)
T ss_pred             ccCchhhccCcccceecCCCcEehhhhhh-hhcccCCccccccc
Confidence            55777778887777888899999999964 44679999998875


No 65 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=58.50  E-value=9.6  Score=19.87  Aligned_cols=11  Identities=18%  Similarity=0.730  Sum_probs=7.0

Q ss_pred             CcccCHHhHhh
Q psy8111         110 EKIYCGNCYDA  120 (135)
Q Consensus       110 ~~~~C~~c~~~  120 (135)
                      +.-+|..||.+
T Consensus        26 d~dlC~~Cf~~   36 (44)
T smart00291       26 DYDLCQSCFAK   36 (44)
T ss_pred             CccchHHHHhC
Confidence            34468888764


No 66 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=57.73  E-value=12  Score=26.40  Aligned_cols=44  Identities=18%  Similarity=0.480  Sum_probs=28.9

Q ss_pred             ccccccccccCCCCCeeeeCCcccCHHhHhhh------------------cCCCcccCCCCCC
Q psy8111          90 CFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQ------------------FASRCDGCSEIFK  134 (135)
Q Consensus        90 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~------------------~~~~C~~C~~~I~  134 (135)
                      -|.|..|...+.+ .....=|..||..|..+-                  -.++|..|..+|.
T Consensus        18 ~~~CpICld~~~d-PVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is   79 (193)
T PLN03208         18 DFDCNICLDQVRD-PVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVS   79 (193)
T ss_pred             ccCCccCCCcCCC-cEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCC
Confidence            3667777766543 244456778888887532                  1358999998875


No 67 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=57.36  E-value=4.5  Score=20.32  Aligned_cols=37  Identities=22%  Similarity=0.651  Sum_probs=19.1

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhHhhhc--CCCcccC
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCYDAQF--ASRCDGC  129 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C  129 (135)
                      |..|...+.+......=|..||..|..+.+  ..+|..|
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~~C~~~~~~~~~~CP~C   39 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCKECIEKYLEKNPKCPVC   39 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEHHHHHHHHHCTSB-TTT
T ss_pred             CCCCCCcccCcCEECCCCCchhHHHHHHHHHCcCCCcCC
Confidence            344555554422334458888888876543  3445433


No 68 
>KOG0978|consensus
Probab=56.96  E-value=3.3  Score=34.67  Aligned_cols=44  Identities=25%  Similarity=0.745  Sum_probs=26.9

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhcC---CCcccCCCCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFA---SRCDGCSEIFKA  135 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~---~~C~~C~~~I~~  135 (135)
                      .+|+.|+..-.+ .....=+.+||..|..+++.   .+|.+|+.+..|
T Consensus       644 LkCs~Cn~R~Kd-~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aFga  690 (698)
T KOG0978|consen  644 LKCSVCNTRWKD-AVITKCGHVFCEECVQTRYETRQRKCPKCNAAFGA  690 (698)
T ss_pred             eeCCCccCchhh-HHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCCCc
Confidence            456666633222 12233467788888777765   478888877654


No 69 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=56.91  E-value=3  Score=19.82  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=5.1

Q ss_pred             CchhhcCCccc
Q psy8111          63 NSCEECSKIIG   73 (135)
Q Consensus        63 ~~C~~C~~~I~   73 (135)
                      .+|.+|+..|.
T Consensus         2 ~~C~rC~~~~~   12 (30)
T PF06827_consen    2 EKCPRCWNYIE   12 (30)
T ss_dssp             SB-TTT--BBE
T ss_pred             CcCccCCCcce
Confidence            46777777773


No 70 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=56.27  E-value=5.1  Score=20.10  Aligned_cols=7  Identities=57%  Similarity=1.350  Sum_probs=3.0

Q ss_pred             ccccccc
Q psy8111          92 SCSKCRQ   98 (135)
Q Consensus        92 ~C~~C~~   98 (135)
                      +|+.|+.
T Consensus        27 ~C~~C~~   33 (36)
T PF13717_consen   27 RCSKCGH   33 (36)
T ss_pred             ECCCCCC
Confidence            4444443


No 71 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=55.82  E-value=4.9  Score=28.52  Aligned_cols=41  Identities=17%  Similarity=0.605  Sum_probs=31.9

Q ss_pred             cccccccccCCCCCeeeeCCcccCHHhHhhhc--CCCcccCCCC
Q psy8111          91 FSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQF--ASRCDGCSEI  132 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~  132 (135)
                      |.|..|++.... ..+..=|.-+|..|+-+.+  ++.|..|++.
T Consensus       197 F~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~  239 (259)
T COG5152         197 FLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDECGVCGKA  239 (259)
T ss_pred             eeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcceecchh
Confidence            788889887754 3555668899999998766  5899999864


No 72 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=55.77  E-value=4.5  Score=21.41  Aligned_cols=30  Identities=27%  Similarity=0.702  Sum_probs=14.3

Q ss_pred             eeccccCC-ccCCCceEe--ECCeeeccCchhh
Q psy8111          30 FCCWQCDE-SLTGQRYVL--RDDHPYCIKCYES   59 (135)
Q Consensus        30 f~C~~C~~-~l~~~~~~~--~~~~~~C~~c~~~   59 (135)
                      +.|+.|+. ++.+..|.=  =.+--+|.+||.+
T Consensus         5 ~~C~~C~~~~i~g~Ry~C~~C~d~dLC~~C~~~   37 (46)
T PF00569_consen    5 YTCDGCGTDPIIGVRYHCLVCPDYDLCEDCFSK   37 (46)
T ss_dssp             CE-SSS-SSSEESSEEEESSSSS-EEEHHHHHH
T ss_pred             eECcCCCCCcCcCCeEECCCCCCCchhhHHHhC
Confidence            56777766 555543321  1234466666654


No 73 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=54.78  E-value=6.6  Score=19.77  Aligned_cols=13  Identities=23%  Similarity=0.286  Sum_probs=7.4

Q ss_pred             CcccccccCcccc
Q psy8111           1 MESAVKHQDKSFR   13 (135)
Q Consensus         1 ~~~~C~~C~~~i~   13 (135)
                      |...|..|+....
T Consensus         1 M~i~CP~C~~~f~   13 (37)
T PF13719_consen    1 MIITCPNCQTRFR   13 (37)
T ss_pred             CEEECCCCCceEE
Confidence            4556666666543


No 74 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=54.68  E-value=8.5  Score=24.22  Aligned_cols=33  Identities=12%  Similarity=0.377  Sum_probs=26.3

Q ss_pred             cccccccccCC-CCCeeeeCCcccCHHhHhhhcC
Q psy8111          91 FSCSKCRQSLV-DKQFGSKSEKIYCGNCYDAQFA  123 (135)
Q Consensus        91 f~C~~C~~~l~-~~~~~~~~~~~~C~~c~~~~~~  123 (135)
                      ++|..|+.++- ++.|.+..+-|..-.|+.+..+
T Consensus         3 WkC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~~   36 (101)
T PF09943_consen    3 WKCYICGKPIYEGQLFTFTKKGPVHYECFREKAS   36 (101)
T ss_pred             eEEEecCCeeeecceEEEecCCcEeHHHHHHHHh
Confidence            57999999986 5567777778999999976544


No 75 
>KOG2462|consensus
Probab=54.16  E-value=2  Score=31.81  Aligned_cols=35  Identities=20%  Similarity=0.282  Sum_probs=17.5

Q ss_pred             ccccCccccccceeeCCCccc-----CCCCeeccccCCccC
Q psy8111           5 VKHQDKSFREDYNKLGGKDRG-----SGQHFCCWQCDESLT   40 (135)
Q Consensus         5 C~~C~~~i~~~~i~a~~~~~H-----~~~cf~C~~C~~~l~   40 (135)
                      |..|++.....--.+--+..|     .. =|.|..|++.-.
T Consensus       133 c~eCgk~ysT~snLsrHkQ~H~~~~s~k-a~~C~~C~K~Yv  172 (279)
T KOG2462|consen  133 CPECGKSYSTSSNLSRHKQTHRSLDSKK-AFSCKYCGKVYV  172 (279)
T ss_pred             ccccccccccccccchhhcccccccccc-cccCCCCCceee
Confidence            556666554333222333444     33 466777766543


No 76 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=52.55  E-value=5.6  Score=19.86  Aligned_cols=10  Identities=40%  Similarity=1.016  Sum_probs=3.3

Q ss_pred             CchhhcCCcc
Q psy8111          63 NSCEECSKII   72 (135)
Q Consensus        63 ~~C~~C~~~I   72 (135)
                      +.|..|+++.
T Consensus         4 ~~C~eC~~~f   13 (34)
T PF01286_consen    4 PKCDECGKPF   13 (34)
T ss_dssp             EE-TTT--EE
T ss_pred             chHhHhCCHH
Confidence            3444555544


No 77 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=52.42  E-value=9.6  Score=32.13  Aligned_cols=81  Identities=15%  Similarity=0.268  Sum_probs=50.7

Q ss_pred             cccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccceeCC
Q psy8111           4 AVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSYKD   83 (135)
Q Consensus         4 ~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~   83 (135)
                      +|..|-+.|.+.    .++.||-- --.|..|+-.     |...+..||=..--...--+.|..|.+.      +-...+
T Consensus       103 ~C~~Cl~Ei~dp----~~rrY~YP-F~~CT~CGPR-----fTIi~alPYDR~nTsM~~F~lC~~C~~E------Y~dP~n  166 (750)
T COG0068         103 TCEDCLEEIFDP----NSRRYLYP-FINCTNCGPR-----FTIIEALPYDRENTSMADFPLCPFCDKE------YKDPLN  166 (750)
T ss_pred             hhHHHHHHhcCC----CCcceecc-ccccCCCCcc-----eeeeccCCCCcccCccccCcCCHHHHHH------hcCccc
Confidence            566676666553    46788888 7789999644     4444444442111111112566666553      234568


Q ss_pred             ccccccccccccccccC
Q psy8111          84 KHWHEACFSCSKCRQSL  100 (135)
Q Consensus        84 ~~~H~~Cf~C~~C~~~l  100 (135)
                      +.||.+=..|..|+-.+
T Consensus       167 RRfHAQp~aCp~CGP~~  183 (750)
T COG0068         167 RRFHAQPIACPKCGPHL  183 (750)
T ss_pred             cccccccccCcccCCCe
Confidence            99999989999998876


No 78 
>KOG4739|consensus
Probab=52.00  E-value=9.8  Score=27.64  Aligned_cols=42  Identities=24%  Similarity=0.586  Sum_probs=30.9

Q ss_pred             ccccCCccCCCceEeEC-CeeeccCchhhhcCCchhhcCCccc
Q psy8111          32 CWQCDESLTGQRYVLRD-DHPYCIKCYESVFANSCEECSKIIG   73 (135)
Q Consensus        32 C~~C~~~l~~~~~~~~~-~~~~C~~c~~~~~~~~C~~C~~~I~   73 (135)
                      |..|...=...+|+... ..++|+.|.....++.|.-|+++|.
T Consensus         6 Cn~C~~~~~~~~f~LTaC~HvfC~~C~k~~~~~~C~lCkk~ir   48 (233)
T KOG4739|consen    6 CNKCFRFPSQDPFFLTACRHVFCEPCLKASSPDVCPLCKKSIR   48 (233)
T ss_pred             eccccccCCCCceeeeechhhhhhhhcccCCccccccccceee
Confidence            33444444455677654 7899999998888789999999984


No 79 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=51.50  E-value=8.3  Score=21.35  Aligned_cols=25  Identities=16%  Similarity=0.199  Sum_probs=15.8

Q ss_pred             CchhhcCCccccCcccceeCCccccc
Q psy8111          63 NSCEECSKIIGIDSKDLSYKDKHWHE   88 (135)
Q Consensus        63 ~~C~~C~~~I~~~~~~~~~~~~~~H~   88 (135)
                      .+|..|++||.+. ..+...+..-|+
T Consensus         2 ~~CvVCKqpi~~a-~~v~T~~G~VH~   26 (54)
T PF10886_consen    2 EICVVCKQPIDDA-LVVETESGPVHP   26 (54)
T ss_pred             CeeeeeCCccCcc-eEEEcCCCccCc
Confidence            4688888888633 445555556665


No 80 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=50.60  E-value=13  Score=31.19  Aligned_cols=57  Identities=12%  Similarity=0.171  Sum_probs=36.1

Q ss_pred             ccceeeCCCcccCCCCeeccccCCccCCC------ceEeECCeeeccCchhhhcCCchhhcCCc
Q psy8111          14 EDYNKLGGKDRGSGQHFCCWQCDESLTGQ------RYVLRDDHPYCIKCYESVFANSCEECSKI   71 (135)
Q Consensus        14 ~~~i~a~~~~~H~~~cf~C~~C~~~l~~~------~~~~~~~~~~C~~c~~~~~~~~C~~C~~~   71 (135)
                      |++|...++.-... -+.|..|+..+.=.      .|...++.+.|..|-.......|..|+..
T Consensus       369 gqvll~lnRrGyap-~l~C~~Cg~~~~C~~C~~~L~~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        369 GPVLVQVPRRGYVP-SLACARCRTPARCRHCTGPLGLPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CcEEEEecCCCCCC-eeEhhhCcCeeECCCCCCceeEecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            45555556544444 46666666655311      24345678889999776666799999876


No 81 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=48.47  E-value=18  Score=19.42  Aligned_cols=11  Identities=18%  Similarity=0.356  Sum_probs=6.9

Q ss_pred             cccCHHhHhhh
Q psy8111         111 KIYCGNCYDAQ  121 (135)
Q Consensus       111 ~~~C~~c~~~~  121 (135)
                      --+|..||...
T Consensus        26 ~DlC~~C~~~~   36 (48)
T cd02341          26 FDLCQDCVVKG   36 (48)
T ss_pred             CccCHHHHhCc
Confidence            34577777654


No 82 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=48.34  E-value=6.5  Score=20.36  Aligned_cols=12  Identities=17%  Similarity=0.628  Sum_probs=8.3

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |+|..|+..++.
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            778888766653


No 83 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=48.28  E-value=22  Score=32.08  Aligned_cols=11  Identities=27%  Similarity=0.779  Sum_probs=5.9

Q ss_pred             cccccccCCCC
Q psy8111          93 CSKCRQSLVDK  103 (135)
Q Consensus        93 C~~C~~~l~~~  103 (135)
                      |..|+.++...
T Consensus       712 CP~CGtplv~~  722 (1337)
T PRK14714        712 CPRCDVELTPY  722 (1337)
T ss_pred             CCCCCCccccc
Confidence            55566555443


No 84 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.28  E-value=24  Score=26.84  Aligned_cols=26  Identities=23%  Similarity=0.699  Sum_probs=18.4

Q ss_pred             CCcccCHHhHhhhcC---CCcccCCCCCC
Q psy8111         109 SEKIYCGNCYDAQFA---SRCDGCSEIFK  134 (135)
Q Consensus       109 ~~~~~C~~c~~~~~~---~~C~~C~~~I~  134 (135)
                      =|..+|..|..+.|.   ..|..|+.++.
T Consensus        26 CGH~~C~sCv~~l~~~~~~~CP~C~~~lr   54 (309)
T TIGR00570        26 CGHTLCESCVDLLFVRGSGSCPECDTPLR   54 (309)
T ss_pred             CCCcccHHHHHHHhcCCCCCCCCCCCccc
Confidence            377778888777652   47888887764


No 85 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=47.10  E-value=5.4  Score=24.97  Aligned_cols=28  Identities=29%  Similarity=0.615  Sum_probs=18.5

Q ss_pred             ccccccccccCCCCCee-eeCCcccCHHh
Q psy8111          90 CFSCSKCRQSLVDKQFG-SKSEKIYCGNC  117 (135)
Q Consensus        90 Cf~C~~C~~~l~~~~~~-~~~~~~~C~~c  117 (135)
                      =|+|++|--.-..++.. ..+|+++|.+|
T Consensus        70 EFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   70 EFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             ceeeeeeeeEechhhhccccCCCEecccc
Confidence            38888885554433322 45789999887


No 86 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=47.04  E-value=19  Score=19.07  Aligned_cols=29  Identities=17%  Similarity=0.543  Sum_probs=17.0

Q ss_pred             ccccccccCCCCCeeee--CCcccCHHhHhh
Q psy8111          92 SCSKCRQSLVDKQFGSK--SEKIYCGNCYDA  120 (135)
Q Consensus        92 ~C~~C~~~l~~~~~~~~--~~~~~C~~c~~~  120 (135)
                      .|..|+..+....|...  .+.-+|..||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            45666666654333322  246679999865


No 87 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=46.18  E-value=8.7  Score=16.54  Aligned_cols=12  Identities=25%  Similarity=0.717  Sum_probs=6.9

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |+|..|++.+..
T Consensus         1 y~C~~C~~~f~~   12 (23)
T PF00096_consen    1 YKCPICGKSFSS   12 (23)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCccCC
Confidence            456666665543


No 88 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=45.21  E-value=8.3  Score=19.37  Aligned_cols=11  Identities=18%  Similarity=0.800  Sum_probs=7.2

Q ss_pred             eeccccCCccC
Q psy8111          30 FCCWQCDESLT   40 (135)
Q Consensus        30 f~C~~C~~~l~   40 (135)
                      |+|..|+..++
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            66777766554


No 89 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=44.85  E-value=16  Score=19.25  Aligned_cols=11  Identities=18%  Similarity=0.676  Sum_probs=7.5

Q ss_pred             eeccccCCccC
Q psy8111          30 FCCWQCDESLT   40 (135)
Q Consensus        30 f~C~~C~~~l~   40 (135)
                      |.|..|+..++
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            56777777654


No 90 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=44.84  E-value=9  Score=20.51  Aligned_cols=12  Identities=17%  Similarity=0.587  Sum_probs=8.6

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |+|..|+..++.
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            778888776653


No 91 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=44.80  E-value=14  Score=17.38  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=3.0

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |+|..|++++.+
T Consensus         1 ~~C~~C~~~~~~   12 (30)
T PF07649_consen    1 FRCDACGKPIDG   12 (30)
T ss_dssp             ---TTTS----S
T ss_pred             CcCCcCCCcCCC
Confidence            456666666654


No 92 
>KOG1813|consensus
Probab=43.80  E-value=11  Score=28.27  Aligned_cols=50  Identities=20%  Similarity=0.403  Sum_probs=36.8

Q ss_pred             CCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhc--CCchhhcCCccc
Q psy8111          21 GKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVF--ANSCEECSKIIG   73 (135)
Q Consensus        21 ~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~--~~~C~~C~~~I~   73 (135)
                      ...|-..  |.|..|++.+... -+..-+..+|+.|..+.+  +++|..|++.+.
T Consensus       235 ~D~~~~P--f~c~icr~~f~~p-Vvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~  286 (313)
T KOG1813|consen  235 EDIELLP--FKCFICRKYFYRP-VVTKCGHYFCEVCALKPYQKGEKCYVCSQQTH  286 (313)
T ss_pred             CCcccCC--ccccccccccccc-hhhcCCceeehhhhccccccCCcceecccccc
Confidence            3456655  8888888888653 556678888999887654  368999998884


No 93 
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=43.65  E-value=28  Score=21.48  Aligned_cols=9  Identities=22%  Similarity=0.781  Sum_probs=4.6

Q ss_pred             ccccccccc
Q psy8111          85 HWHEACFSC   93 (135)
Q Consensus        85 ~~H~~Cf~C   93 (135)
                      .|+..|-+|
T Consensus        36 v~~Q~C~~C   44 (98)
T PF13695_consen   36 VFGQRCKKC   44 (98)
T ss_pred             EECCCCCCC
Confidence            355555544


No 94 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=43.03  E-value=22  Score=18.54  Aligned_cols=9  Identities=33%  Similarity=0.874  Sum_probs=5.4

Q ss_pred             chhhcCCcc
Q psy8111          64 SCEECSKII   72 (135)
Q Consensus        64 ~C~~C~~~I   72 (135)
                      .|.+|+++|
T Consensus         2 ~Cd~C~~~i   10 (43)
T cd02340           2 ICDGCQGPI   10 (43)
T ss_pred             CCCCCCCcC
Confidence            466666655


No 95 
>PF14353 CpXC:  CpXC protein
Probab=41.25  E-value=32  Score=22.15  Aligned_cols=38  Identities=16%  Similarity=0.151  Sum_probs=22.0

Q ss_pred             ccccccCccccccceeeCCCc-----------ccCCCCeeccccCCccCC
Q psy8111           3 SAVKHQDKSFREDYNKLGGKD-----------RGSGQHFCCWQCDESLTG   41 (135)
Q Consensus         3 ~~C~~C~~~i~~~~i~a~~~~-----------~H~~~cf~C~~C~~~l~~   41 (135)
                      .+|.+|+....-++-+..+..           .-.. -|+|..|+....-
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~-~~~CP~Cg~~~~~   50 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLF-SFTCPSCGHKFRL   50 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcC-EEECCCCCCceec
Confidence            468888888775543322222           2223 4778888776643


No 96 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=40.45  E-value=14  Score=15.51  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=5.0

Q ss_pred             eeccccCCccC
Q psy8111          30 FCCWQCDESLT   40 (135)
Q Consensus        30 f~C~~C~~~l~   40 (135)
                      |.|..|+..+.
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            45666655554


No 97 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=39.65  E-value=34  Score=25.26  Aligned_cols=36  Identities=33%  Similarity=0.695  Sum_probs=25.0

Q ss_pred             CCchhhcCCccccCcccceeCCccccccccccccccccCCC
Q psy8111          62 ANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVD  102 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~  102 (135)
                      ..+|.+|++.-.|    | ..++-|=..=|.|..|+..+.+
T Consensus       132 VSRCr~C~~rYDP----V-P~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  132 VSRCRKCRKRYDP----V-PCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccccccccccCC----C-ccccccceeeeecccccccchh
Confidence            4678888886522    1 1456666666889999998865


No 98 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=39.35  E-value=28  Score=18.99  Aligned_cols=22  Identities=23%  Similarity=0.459  Sum_probs=11.6

Q ss_pred             eccccCCccCCC---ceEeECCeee
Q psy8111          31 CCWQCDESLTGQ---RYVLRDDHPY   52 (135)
Q Consensus        31 ~C~~C~~~l~~~---~~~~~~~~~~   52 (135)
                      .|+.|+..+...   .|+..||++|
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~Dgkv~   27 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKDGTIL   27 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeCCcEE
Confidence            356666666522   3445666654


No 99 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=38.85  E-value=9.5  Score=23.69  Aligned_cols=29  Identities=21%  Similarity=0.519  Sum_probs=13.4

Q ss_pred             chhhcCCccccCccccee-CCcccccccccc
Q psy8111          64 SCEECSKIIGIDSKDLSY-KDKHWHEACFSC   93 (135)
Q Consensus        64 ~C~~C~~~I~~~~~~~~~-~~~~~H~~Cf~C   93 (135)
                      +|+.|+++|. .++..++ ...+-|-+||.=
T Consensus         8 kC~VCg~~ii-eGqkFTF~~kGsVH~eCl~~   37 (103)
T COG4847           8 KCYVCGGTII-EGQKFTFTKKGSVHYECLAE   37 (103)
T ss_pred             eEeeeCCEee-eccEEEEeeCCcchHHHHHH
Confidence            4566666654 2333222 233445555543


No 100
>KOG3002|consensus
Probab=37.86  E-value=22  Score=26.87  Aligned_cols=44  Identities=27%  Similarity=0.554  Sum_probs=36.5

Q ss_pred             CeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccc
Q psy8111          29 HFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIG   73 (135)
Q Consensus        29 cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~   73 (135)
                      =+.|..|-..|....|.=.+|.+.|..|-.++ ..+|..|..+|.
T Consensus        48 lleCPvC~~~l~~Pi~QC~nGHlaCssC~~~~-~~~CP~Cr~~~g   91 (299)
T KOG3002|consen   48 LLDCPVCFNPLSPPIFQCDNGHLACSSCRTKV-SNKCPTCRLPIG   91 (299)
T ss_pred             hccCchhhccCcccceecCCCcEehhhhhhhh-cccCCccccccc
Confidence            47788898999877666788999999998655 479999999994


No 101
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=36.06  E-value=9.9  Score=20.87  Aligned_cols=26  Identities=27%  Similarity=0.591  Sum_probs=14.8

Q ss_pred             eccccCCccCCCceEe---ECCeeeccCc
Q psy8111          31 CCWQCDESLTGQRYVL---RDDHPYCIKC   56 (135)
Q Consensus        31 ~C~~C~~~l~~~~~~~---~~~~~~C~~c   56 (135)
                      +|+.|+..|+.+.+..   .++.++|+.|
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~C   52 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNC   52 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCC
Confidence            5677777777654332   2345566655


No 102
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=35.91  E-value=16  Score=18.23  Aligned_cols=30  Identities=17%  Similarity=0.487  Sum_probs=15.7

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhHhhhc
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCYDAQF  122 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~  122 (135)
                      |..|...+........=|..||..|..+.+
T Consensus         1 C~iC~~~~~~~~~~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen    1 CPICLEPFEDPVILLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSSBCSSEEEETTTSEEEEHHHHHHHH
T ss_pred             CCcCCccccCCCEEecCCCcchHHHHHHHH
Confidence            344555444433233336777888875543


No 103
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=35.67  E-value=4.5  Score=20.06  Aligned_cols=16  Identities=19%  Similarity=0.752  Sum_probs=9.9

Q ss_pred             cccccccccCCCCCee
Q psy8111          91 FSCSKCRQSLVDKQFG  106 (135)
Q Consensus        91 f~C~~C~~~l~~~~~~  106 (135)
                      |.|..|++++....|+
T Consensus         5 ~~C~nC~R~v~a~RfA   20 (33)
T PF08209_consen    5 VECPNCGRPVAASRFA   20 (33)
T ss_dssp             EE-TTTSSEEEGGGHH
T ss_pred             EECCCCcCCcchhhhH
Confidence            5577777777666554


No 104
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=35.65  E-value=14  Score=19.74  Aligned_cols=12  Identities=33%  Similarity=0.944  Sum_probs=7.1

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      ++|..|.+.+.+
T Consensus         1 ~~Cd~C~~~~~~   12 (49)
T cd02335           1 YHCDYCSKDITG   12 (49)
T ss_pred             CCCCCcCCCCCC
Confidence            356666666554


No 105
>PRK04023 DNA polymerase II large subunit; Validated
Probab=35.49  E-value=37  Score=30.08  Aligned_cols=23  Identities=26%  Similarity=0.553  Sum_probs=13.3

Q ss_pred             eeccCchhhhcCCchhhcCCccc
Q psy8111          51 PYCIKCYESVFANSCEECSKIIG   73 (135)
Q Consensus        51 ~~C~~c~~~~~~~~C~~C~~~I~   73 (135)
                      ..|.+|-.......|..|+..+.
T Consensus       652 ~fCP~CG~~~~~y~CPKCG~El~  674 (1121)
T PRK04023        652 YRCPRCGIEVEEDECEKCGREPT  674 (1121)
T ss_pred             eeCccccCcCCCCcCCCCCCCCC
Confidence            35666655544456666666664


No 106
>KOG2932|consensus
Probab=34.74  E-value=20  Score=27.28  Aligned_cols=40  Identities=15%  Similarity=0.443  Sum_probs=18.5

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCC
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEI  132 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~  132 (135)
                      |..|+.+|.--.-..-=+.+||.+|...--...|..|...
T Consensus        93 Cd~Cd~PI~IYGRmIPCkHvFCl~CAr~~~dK~Cp~C~d~  132 (389)
T KOG2932|consen   93 CDRCDFPIAIYGRMIPCKHVFCLECARSDSDKICPLCDDR  132 (389)
T ss_pred             ecccCCcceeeecccccchhhhhhhhhcCccccCcCcccH
Confidence            5555555533222223345555555543333455555543


No 107
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=34.57  E-value=40  Score=19.45  Aligned_cols=22  Identities=23%  Similarity=0.452  Sum_probs=14.1

Q ss_pred             eccccCCccCCC---ceEeECCeee
Q psy8111          31 CCWQCDESLTGQ---RYVLRDDHPY   52 (135)
Q Consensus        31 ~C~~C~~~l~~~---~~~~~~~~~~   52 (135)
                      +|+-|+..+...   -|+..||+++
T Consensus         5 ~CsFcG~~I~PGtG~m~Vr~Dg~v~   29 (66)
T COG2075           5 VCSFCGKKIEPGTGIMYVRNDGKVL   29 (66)
T ss_pred             EecCcCCccCCCceEEEEecCCeEE
Confidence            577788877654   3445667654


No 108
>KOG2893|consensus
Probab=34.32  E-value=12  Score=27.36  Aligned_cols=35  Identities=17%  Similarity=0.347  Sum_probs=25.1

Q ss_pred             ccccCccccccceeeCCCcccCCCCeeccccCCccCCC
Q psy8111           5 VKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQ   42 (135)
Q Consensus         5 C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~   42 (135)
                      |.-|+..+.++.|.+..+  -.. +|+|..|.+.|-+.
T Consensus        13 cwycnrefddekiliqhq--kak-hfkchichkkl~sg   47 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQ--KAK-HFKCHICHKKLFSG   47 (341)
T ss_pred             eeecccccchhhhhhhhh--hhc-cceeeeehhhhccC
Confidence            777888888877655322  356 89999998887543


No 109
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=34.31  E-value=37  Score=18.14  Aligned_cols=10  Identities=40%  Similarity=1.149  Sum_probs=5.5

Q ss_pred             ccCHHhHhhh
Q psy8111         112 IYCGNCYDAQ  121 (135)
Q Consensus       112 ~~C~~c~~~~  121 (135)
                      -+|.+||...
T Consensus        25 dlC~~Cf~~~   34 (49)
T cd02338          25 DLCADCYDSG   34 (49)
T ss_pred             ccchhHHhCC
Confidence            3566666543


No 110
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=34.18  E-value=17  Score=15.89  Aligned_cols=12  Identities=33%  Similarity=0.886  Sum_probs=7.3

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |.|..|+..+.+
T Consensus         1 ~~C~~C~~~f~s   12 (25)
T PF12874_consen    1 FYCDICNKSFSS   12 (25)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCCCCCCcCC
Confidence            456666666554


No 111
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=33.81  E-value=59  Score=24.23  Aligned_cols=92  Identities=12%  Similarity=0.260  Sum_probs=44.0

Q ss_pred             CeeccccCCccCCCceEe-------ECCeeeccCchhhhcCCchhhcCCccccCccc-ceeCCccccccccccccccccC
Q psy8111          29 HFCCWQCDESLTGQRYVL-------RDDHPYCIKCYESVFANSCEECSKIIGIDSKD-LSYKDKHWHEACFSCSKCRQSL  100 (135)
Q Consensus        29 cf~C~~C~~~l~~~~~~~-------~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~-~~~~~~~~H~~Cf~C~~C~~~l  100 (135)
                      |++=..|.-||.+....+       +.|++|           +|+.|...+-.+++. -.|.=+..-.+=|+|.+|++.=
T Consensus       113 Cl~~HaC~Cpl~da~C~EC~R~vw~hGGrif-----------~CsfC~~flCEDDQFEHQAsCQvLe~E~~KC~SCNrlG  181 (314)
T PF06524_consen  113 CLSTHACTCPLQDAVCIECERGVWDHGGRIF-----------KCSFCDNFLCEDDQFEHQASCQVLESETFKCQSCNRLG  181 (314)
T ss_pred             ccccccccCcCCCcEeeeeecccccCCCeEE-----------EeecCCCeeeccchhhhhhhhhhhhccccccccccccc
Confidence            555567777887654433       223322           566666655322221 1122223333446777776542


Q ss_pred             CCCCeeeeCCcccCHHhHhhh-------cCCCcccCCCCC
Q psy8111         101 VDKQFGSKSEKIYCGNCYDAQ-------FASRCDGCSEIF  133 (135)
Q Consensus       101 ~~~~~~~~~~~~~C~~c~~~~-------~~~~C~~C~~~I  133 (135)
                      .-+  -++=..-||.+|..++       -++.|.+|+.+.
T Consensus       182 q~s--CLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~et  219 (314)
T PF06524_consen  182 QYS--CLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGYET  219 (314)
T ss_pred             chh--hhheeeeehhhhhhhcccccccCCCCCCCCCCCcc
Confidence            111  1222344566665432       235677776553


No 112
>PF11077 DUF2616:  Protein of unknown function (DUF2616);  InterPro: IPR020201 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf52; it is a family of uncharacterised viral proteins.
Probab=33.78  E-value=20  Score=24.86  Aligned_cols=32  Identities=25%  Similarity=0.616  Sum_probs=22.3

Q ss_pred             ccccccccCCC--CC-eeeeCCcccCHHhHhhhcC
Q psy8111          92 SCSKCRQSLVD--KQ-FGSKSEKIYCGNCYDAQFA  123 (135)
Q Consensus        92 ~C~~C~~~l~~--~~-~~~~~~~~~C~~c~~~~~~  123 (135)
                      +|-.|+++...  .. ++..|-+++|..|+..+|.
T Consensus       138 kC~QC~~~~~~~~~~~~~~F~~~lFC~~ClFPLF~  172 (173)
T PF11077_consen  138 KCVQCSQKCENVGAKIFTYFNFNLFCKNCLFPLFD  172 (173)
T ss_pred             ccCcCCCCcccccceeEEecChhhcccccCccccc
Confidence            45566665432  23 6677999999999988773


No 113
>PRK13796 GTPase YqeH; Provisional
Probab=33.70  E-value=19  Score=27.83  Aligned_cols=28  Identities=21%  Similarity=0.786  Sum_probs=17.7

Q ss_pred             eccccCCccCCC-----ceEe--------ECCeeeccCchh
Q psy8111          31 CCWQCDESLTGQ-----RYVL--------RDDHPYCIKCYE   58 (135)
Q Consensus        31 ~C~~C~~~l~~~-----~~~~--------~~~~~~C~~c~~   58 (135)
                      +|..||..|...     .|..        ..+.++|++||.
T Consensus         2 ~C~GCG~~lq~~~~~~~Gy~p~~~~~~~~~~~~~~C~RC~~   42 (365)
T PRK13796          2 RCIGCGAAIQTEDKNKPGYAPASALKKGLETEEVYCQRCFR   42 (365)
T ss_pred             cccCCCceeEcCCCCCCCCCCHHHhhcccccCCeEchhhhh
Confidence            577788777422     3443        235678998884


No 114
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=33.53  E-value=18  Score=16.20  Aligned_cols=12  Identities=25%  Similarity=0.839  Sum_probs=7.2

Q ss_pred             eeccccCCccCC
Q psy8111          30 FCCWQCDESLTG   41 (135)
Q Consensus        30 f~C~~C~~~l~~   41 (135)
                      |+|..|++.+..
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            566666666543


No 115
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=32.57  E-value=49  Score=15.28  Aligned_cols=13  Identities=15%  Similarity=0.595  Sum_probs=7.3

Q ss_pred             CCcccCHHhHhhh
Q psy8111         109 SEKIYCGNCYDAQ  121 (135)
Q Consensus       109 ~~~~~C~~c~~~~  121 (135)
                      =+..+|..|..+.
T Consensus        16 C~H~~c~~C~~~~   28 (39)
T smart00184       16 CGHTFCRSCIRKW   28 (39)
T ss_pred             CCChHHHHHHHHH
Confidence            4555666666543


No 116
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=32.54  E-value=50  Score=16.16  Aligned_cols=23  Identities=30%  Similarity=0.550  Sum_probs=12.7

Q ss_pred             eccccCCccCCCceEeECCeeeccCc
Q psy8111          31 CCWQCDESLTGQRYVLRDDHPYCIKC   56 (135)
Q Consensus        31 ~C~~C~~~l~~~~~~~~~~~~~C~~c   56 (135)
                      +|..|+..+.   +...++..+|..|
T Consensus         5 ~C~~C~~~~i---~~~~~~~~~C~~C   27 (33)
T PF08792_consen    5 KCSKCGGNGI---VNKEDDYEVCIFC   27 (33)
T ss_pred             EcCCCCCCeE---EEecCCeEEcccC
Confidence            4555655542   3355666666665


No 117
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.10  E-value=42  Score=22.08  Aligned_cols=10  Identities=20%  Similarity=0.069  Sum_probs=4.3

Q ss_pred             ccccCccccc
Q psy8111           5 VKHQDKSFRE   14 (135)
Q Consensus         5 C~~C~~~i~~   14 (135)
                      |..|+-+|+|
T Consensus        42 cp~csasirg   51 (160)
T COG4306          42 CPICSASIRG   51 (160)
T ss_pred             CCccCCcccc
Confidence            3344444444


No 118
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=31.98  E-value=21  Score=18.39  Aligned_cols=14  Identities=7%  Similarity=0.003  Sum_probs=8.1

Q ss_pred             cccccCccccccce
Q psy8111           4 AVKHQDKSFREDYN   17 (135)
Q Consensus         4 ~C~~C~~~i~~~~i   17 (135)
                      .|..||.+|.+..+
T Consensus        21 vC~~CG~Vl~e~~i   34 (43)
T PF08271_consen   21 VCPNCGLVLEENII   34 (43)
T ss_dssp             EETTT-BBEE-TTB
T ss_pred             ECCCCCCEeecccc
Confidence            57777777766554


No 119
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=31.08  E-value=47  Score=17.02  Aligned_cols=29  Identities=21%  Similarity=0.468  Sum_probs=13.9

Q ss_pred             ccccccccCCCCC-eeeeC-CcccCHHhHhh
Q psy8111          92 SCSKCRQSLVDKQ-FGSKS-EKIYCGNCYDA  120 (135)
Q Consensus        92 ~C~~C~~~l~~~~-~~~~~-~~~~C~~c~~~  120 (135)
                      +|+-|+++-.... ..... +...|..|...
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            4667777765443 22222 55667777654


No 120
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=30.05  E-value=33  Score=24.31  Aligned_cols=14  Identities=21%  Similarity=0.712  Sum_probs=9.6

Q ss_pred             cCCCcccCCCCCCC
Q psy8111         122 FASRCDGCSEIFKA  135 (135)
Q Consensus       122 ~~~~C~~C~~~I~~  135 (135)
                      ..|+|..|+.++.|
T Consensus       132 ~~p~C~~Cg~~lrP  145 (218)
T cd01407         132 EVPRCPKCGGLLRP  145 (218)
T ss_pred             CCCcCCCCCCccCC
Confidence            35777778777665


No 121
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=29.44  E-value=41  Score=28.72  Aligned_cols=55  Identities=15%  Similarity=0.219  Sum_probs=34.5

Q ss_pred             cceeeCCC-cccCCCCeeccccCCccCCC------ceEeECCeeeccCchhh-hcCCchhhcCCc
Q psy8111          15 DYNKLGGK-DRGSGQHFCCWQCDESLTGQ------RYVLRDDHPYCIKCYES-VFANSCEECSKI   71 (135)
Q Consensus        15 ~~i~a~~~-~~H~~~cf~C~~C~~~l~~~------~~~~~~~~~~C~~c~~~-~~~~~C~~C~~~   71 (135)
                      +.|...++ -|.+.  .-|..|+..+.-.      .|....+.+.|..|-.+ .....|..|+..
T Consensus       422 Q~llflnRRGys~~--l~C~~Cg~v~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         422 QVLLFLNRRGYAPL--LLCRDCGYIAECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             eEEEEEccCCccce--eecccCCCcccCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            34444444 55544  5555555544311      35556789999998776 455689999887


No 122
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=29.24  E-value=24  Score=26.32  Aligned_cols=27  Identities=19%  Similarity=0.528  Sum_probs=18.4

Q ss_pred             CCchhhcCCccccCcccceeCCccccccc
Q psy8111          62 ANSCEECSKIIGIDSKDLSYKDKHWHEAC   90 (135)
Q Consensus        62 ~~~C~~C~~~I~~~~~~~~~~~~~~H~~C   90 (135)
                      +..|..|+.+|.  ...+.-++..|.|.|
T Consensus       245 GepC~~CGt~I~--k~~~~gR~t~~CP~C  271 (273)
T COG0266         245 GEPCRRCGTPIE--KIKLGGRSTFYCPVC  271 (273)
T ss_pred             CCCCCccCCEeE--EEEEcCCcCEeCCCC
Confidence            568999999994  444555566665655


No 123
>PRK12495 hypothetical protein; Provisional
Probab=28.79  E-value=32  Score=24.83  Aligned_cols=25  Identities=20%  Similarity=0.672  Sum_probs=17.1

Q ss_pred             CeeccccCCccCCCceEeECCeeeccCchh
Q psy8111          29 HFCCWQCDESLTGQRYVLRDDHPYCIKCYE   58 (135)
Q Consensus        29 cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~   58 (135)
                      =+.|..|+.+|.     ...|..+|..|-.
T Consensus        42 a~hC~~CG~PIp-----a~pG~~~Cp~CQ~   66 (226)
T PRK12495         42 NAHCDECGDPIF-----RHDGQEFCPTCQQ   66 (226)
T ss_pred             hhhcccccCccc-----CCCCeeECCCCCC
Confidence            467778888885     3467777776643


No 124
>KOG1734|consensus
Probab=28.51  E-value=37  Score=25.43  Aligned_cols=45  Identities=16%  Similarity=0.355  Sum_probs=27.1

Q ss_pred             ceEeECCeeeccCchhhhcCCchhhcCCccccCc---ccc-----eeCCccccccccc
Q psy8111          43 RYVLRDDHPYCIKCYESVFANSCEECSKIIGIDS---KDL-----SYKDKHWHEACFS   92 (135)
Q Consensus        43 ~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~---~~~-----~~~~~~~H~~Cf~   92 (135)
                      .|+..+|.|-     ..+....|+.|++.|..+.   .++     -.-|..||+.|.+
T Consensus       210 GfYs~~glPt-----khl~d~vCaVCg~~~~~s~~eegvienty~LsCnHvFHEfCIr  262 (328)
T KOG1734|consen  210 GFYSPSGLPT-----KHLSDSVCAVCGQQIDVSVDEEGVIENTYKLSCNHVFHEFCIR  262 (328)
T ss_pred             cccCCCCCCC-----CCCCcchhHhhcchheeecchhhhhhhheeeecccchHHHhhh
Confidence            5777777762     2334578999999984221   111     1235677877754


No 125
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=28.12  E-value=23  Score=18.59  Aligned_cols=19  Identities=21%  Similarity=0.760  Sum_probs=10.9

Q ss_pred             cccccccCCCCCeeeeCCcccCH
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCG  115 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~  115 (135)
                      |..|.+.+..    ..++.+||.
T Consensus         9 C~~Cdk~~~~----~~~~~lYCS   27 (43)
T PF12855_consen    9 CIVCDKQIDP----PDDGSLYCS   27 (43)
T ss_pred             HHHhhccccC----CCCCccccC
Confidence            4455666533    446777874


No 126
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=28.11  E-value=32  Score=17.94  Aligned_cols=11  Identities=18%  Similarity=0.776  Sum_probs=6.4

Q ss_pred             eeccccCCccC
Q psy8111          30 FCCWQCDESLT   40 (135)
Q Consensus        30 f~C~~C~~~l~   40 (135)
                      |+|..|+..+.
T Consensus         4 y~C~~CG~~~~   14 (46)
T PRK00398          4 YKCARCGREVE   14 (46)
T ss_pred             EECCCCCCEEE
Confidence            55666665553


No 127
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=27.94  E-value=14  Score=20.72  Aligned_cols=16  Identities=31%  Similarity=0.825  Sum_probs=11.7

Q ss_pred             eeccccCCccCCCceE
Q psy8111          30 FCCWQCDESLTGQRYV   45 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~   45 (135)
                      +.|++||+.|+..+|.
T Consensus         5 lvCSTCGrDlSeeRy~   20 (63)
T PF05864_consen    5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCCcchHHHHH
Confidence            5688888888776553


No 128
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=27.87  E-value=28  Score=20.84  Aligned_cols=43  Identities=26%  Similarity=0.618  Sum_probs=14.1

Q ss_pred             eeccccCCccC----CCceEeEC--CeeeccCchhhh---cCCchhhcCCcc
Q psy8111          30 FCCWQCDESLT----GQRYVLRD--DHPYCIKCYESV---FANSCEECSKII   72 (135)
Q Consensus        30 f~C~~C~~~l~----~~~~~~~~--~~~~C~~c~~~~---~~~~C~~C~~~I   72 (135)
                      -.|..|+..+.    +..|+.-+  +-|.|..||+-.   -...|.+|+.+-
T Consensus        10 qiCqiCGD~VGl~~~Ge~FVAC~eC~fPvCr~CyEYErkeg~q~CpqCkt~y   61 (80)
T PF14569_consen   10 QICQICGDDVGLTENGEVFVACHECAFPVCRPCYEYERKEGNQVCPQCKTRY   61 (80)
T ss_dssp             -B-SSS--B--B-SSSSB--S-SSS-----HHHHHHHHHTS-SB-TTT--B-
T ss_pred             cccccccCccccCCCCCEEEEEcccCCccchhHHHHHhhcCcccccccCCCc
Confidence            45777776653    34555433  567788888632   234667776543


No 129
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=27.65  E-value=66  Score=20.23  Aligned_cols=36  Identities=17%  Similarity=0.249  Sum_probs=25.5

Q ss_pred             eCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhh
Q psy8111          19 LGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYES   59 (135)
Q Consensus        19 a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~   59 (135)
                      ..+..+... ==-|..|    .+..|++.++.+.|..|-.+
T Consensus        26 ~~dg~~~va-~daCeiC----~~~GY~q~g~~lvC~~C~~~   61 (102)
T PF10080_consen   26 KPDGSYRVA-FDACEIC----GPKGYYQEGDQLVCKNCGVR   61 (102)
T ss_pred             CCCCCEEEE-EEecccc----CCCceEEECCEEEEecCCCE
Confidence            345556655 4456777    55679999999999988654


No 130
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=27.47  E-value=27  Score=23.24  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=5.0

Q ss_pred             eeccccCCcc
Q psy8111          30 FCCWQCDESL   39 (135)
Q Consensus        30 f~C~~C~~~l   39 (135)
                      |.|..|+..+
T Consensus       100 Y~Cp~C~~~y  109 (147)
T smart00531      100 YKCPNCQSKY  109 (147)
T ss_pred             EECcCCCCEe
Confidence            5555555443


No 131
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=27.40  E-value=14  Score=20.72  Aligned_cols=16  Identities=31%  Similarity=0.825  Sum_probs=11.6

Q ss_pred             eeccccCCccCCCceE
Q psy8111          30 FCCWQCDESLTGQRYV   45 (135)
Q Consensus        30 f~C~~C~~~l~~~~~~   45 (135)
                      +.|++||+.|+..+|.
T Consensus         5 lVCsTCGrDlSeeRy~   20 (63)
T PHA03082          5 LVCSTCGRDLSEERYR   20 (63)
T ss_pred             eeecccCcchhHHHHH
Confidence            5688888888766543


No 132
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=26.90  E-value=43  Score=27.06  Aligned_cols=52  Identities=19%  Similarity=0.513  Sum_probs=0.0

Q ss_pred             CCeeeccCchhhhcC---------CchhhcCCccccCcccceeCCccccccccccccccccCC
Q psy8111          48 DDHPYCIKCYESVFA---------NSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLV  101 (135)
Q Consensus        48 ~~~~~C~~c~~~~~~---------~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~  101 (135)
                      ....||+.|..-+-.         --|..|-..+  ....+...+..--.+||.|..|..+|.
T Consensus         3 ~~L~fC~~C~~irc~~c~~~Ei~~~yCp~CL~~~--p~~e~~~~~nrC~r~Cf~CP~C~~~L~   63 (483)
T PF05502_consen    3 EELYFCEHCHKIRCPRCVSEEIDSYYCPNCLFEV--PSSEARSEKNRCSRNCFDCPICFSPLS   63 (483)
T ss_pred             ccceecccccccCChhhcccccceeECccccccC--ChhhheeccceeccccccCCCCCCcce


No 133
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=26.52  E-value=37  Score=18.90  Aligned_cols=27  Identities=22%  Similarity=0.626  Sum_probs=17.7

Q ss_pred             CCcccCHHhHhhhcCCCcccCCCCCCC
Q psy8111         109 SEKIYCGNCYDAQFASRCDGCSEIFKA  135 (135)
Q Consensus       109 ~~~~~C~~c~~~~~~~~C~~C~~~I~~  135 (135)
                      =+.+.|..||...-..-|.-|+.+|.+
T Consensus        25 CgH~I~~~~f~~~rYngCPfC~~~~~~   51 (55)
T PF14447_consen   25 CGHLICDNCFPGERYNGCPFCGTPFEF   51 (55)
T ss_pred             ccceeeccccChhhccCCCCCCCcccC
Confidence            356677777765555667777777653


No 134
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=26.04  E-value=69  Score=16.99  Aligned_cols=10  Identities=40%  Similarity=1.192  Sum_probs=4.5

Q ss_pred             cccccccccC
Q psy8111          91 FSCSKCRQSL  100 (135)
Q Consensus        91 f~C~~C~~~l  100 (135)
                      |-|..|.+.|
T Consensus        19 fIC~~CE~~i   28 (46)
T PF10764_consen   19 FICSDCEKEI   28 (46)
T ss_pred             EehHHHHHHh
Confidence            4444444443


No 135
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=25.96  E-value=34  Score=20.73  Aligned_cols=10  Identities=10%  Similarity=-0.041  Sum_probs=6.6

Q ss_pred             cccccCcccc
Q psy8111           4 AVKHQDKSFR   13 (135)
Q Consensus         4 ~C~~C~~~i~   13 (135)
                      .|.+|+.+|.
T Consensus         2 ~C~HCg~~~p   11 (88)
T PF12156_consen    2 KCYHCGLPVP   11 (88)
T ss_pred             CCCCCCCCCC
Confidence            4667777774


No 136
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=25.87  E-value=22  Score=18.16  Aligned_cols=9  Identities=11%  Similarity=0.645  Sum_probs=3.9

Q ss_pred             CcccCHHhH
Q psy8111         110 EKIYCGNCY  118 (135)
Q Consensus       110 ~~~~C~~c~  118 (135)
                      +..|+..|.
T Consensus        22 ~H~fh~~Ci   30 (44)
T PF13639_consen   22 GHVFHRSCI   30 (44)
T ss_dssp             SEEEEHHHH
T ss_pred             CCeeCHHHH
Confidence            344444443


No 137
>PHA02610 uvsY.-2 hypothetical protein; Provisional
Probab=25.65  E-value=53  Score=18.00  Aligned_cols=25  Identities=4%  Similarity=-0.057  Sum_probs=13.6

Q ss_pred             ccccccCccccccc-eeeCCCcccCC
Q psy8111           3 SAVKHQDKSFREDY-NKLGGKDRGSG   27 (135)
Q Consensus         3 ~~C~~C~~~i~~~~-i~a~~~~~H~~   27 (135)
                      ..|-.|++||.+.. +.-....-|+.
T Consensus         2 ~iCvvCK~Pi~~al~v~T~~Gpvh~g   27 (53)
T PHA02610          2 KICVVCKQPIEKALVVETEKGPVHPG   27 (53)
T ss_pred             ceeeeeCCchhhceEEecCCCCCCCh
Confidence            45667777775543 33344455554


No 138
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=25.48  E-value=45  Score=15.00  Aligned_cols=13  Identities=23%  Similarity=0.774  Sum_probs=9.8

Q ss_pred             cccccccccCCCC
Q psy8111          91 FSCSKCRQSLVDK  103 (135)
Q Consensus        91 f~C~~C~~~l~~~  103 (135)
                      |.|..|++.+.++
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T PF12171_consen    2 FYCDACDKYFSSE   14 (27)
T ss_dssp             CBBTTTTBBBSSH
T ss_pred             CCcccCCCCcCCH
Confidence            5688888888765


No 139
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.90  E-value=25  Score=19.28  Aligned_cols=8  Identities=38%  Similarity=0.949  Sum_probs=3.8

Q ss_pred             hhhcCCcc
Q psy8111          65 CEECSKII   72 (135)
Q Consensus        65 C~~C~~~I   72 (135)
                      |+.|+.+|
T Consensus         3 CPyCge~~   10 (52)
T PF14255_consen    3 CPYCGEPI   10 (52)
T ss_pred             CCCCCCee
Confidence            44445444


No 140
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=24.74  E-value=58  Score=15.31  Aligned_cols=13  Identities=31%  Similarity=0.751  Sum_probs=8.6

Q ss_pred             eeccccCCccCCC
Q psy8111          30 FCCWQCDESLTGQ   42 (135)
Q Consensus        30 f~C~~C~~~l~~~   42 (135)
                      |.|..|++.+++.
T Consensus         1 ~~C~~C~~~~~~~   13 (30)
T PF03107_consen    1 FWCDVCRRKIDGF   13 (30)
T ss_pred             CCCCCCCCCcCCC
Confidence            4677777777654


No 141
>cd02334 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger present in dystrophin and dystrobrevin. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dystrophin attaches actin filaments to an integral membrane glycoprotein complex in muscle cells. The ZZ domain in dystrophin has been shown to be essential for binding to the membrane protein beta-dystroglycan.
Probab=24.61  E-value=76  Score=17.05  Aligned_cols=10  Identities=20%  Similarity=0.660  Sum_probs=5.9

Q ss_pred             ccCHHhHhhh
Q psy8111         112 IYCGNCYDAQ  121 (135)
Q Consensus       112 ~~C~~c~~~~  121 (135)
                      -+|..||...
T Consensus        25 DLC~~Cf~~g   34 (49)
T cd02334          25 DLCQSCFFSG   34 (49)
T ss_pred             CchHHHHhCC
Confidence            3577776543


No 142
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=24.30  E-value=73  Score=16.76  Aligned_cols=9  Identities=22%  Similarity=0.752  Sum_probs=4.8

Q ss_pred             ccCHHhHhh
Q psy8111         112 IYCGNCYDA  120 (135)
Q Consensus       112 ~~C~~c~~~  120 (135)
                      -+|..||.+
T Consensus        25 DLC~~C~~~   33 (43)
T cd02342          25 DLCTICFSR   33 (43)
T ss_pred             ccHHHHhhh
Confidence            346666543


No 143
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=24.25  E-value=42  Score=17.75  Aligned_cols=11  Identities=36%  Similarity=0.818  Sum_probs=6.8

Q ss_pred             CchhhcCCccc
Q psy8111          63 NSCEECSKIIG   73 (135)
Q Consensus        63 ~~C~~C~~~I~   73 (135)
                      ..|..|++.|.
T Consensus        12 ~~C~~C~~~i~   22 (53)
T PF00130_consen   12 TYCDVCGKFIW   22 (53)
T ss_dssp             EB-TTSSSBEC
T ss_pred             CCCcccCcccC
Confidence            46777777773


No 144
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=24.19  E-value=45  Score=24.33  Aligned_cols=31  Identities=26%  Similarity=0.570  Sum_probs=22.9

Q ss_pred             ccccccccccccCCCCCeeeeCCcccCHHhH
Q psy8111          88 EACFSCSKCRQSLVDKQFGSKSEKIYCGNCY  118 (135)
Q Consensus        88 ~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~  118 (135)
                      ++=..|..|+++.....++...+...|..|+
T Consensus       152 ~~l~~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         152 PNLTSCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             cchHHHhCcCCcCCCcceeeccCcccchhcc
Confidence            3434688888888777777778888887775


No 145
>KOG4443|consensus
Probab=24.18  E-value=46  Score=27.97  Aligned_cols=21  Identities=19%  Similarity=0.551  Sum_probs=17.2

Q ss_pred             CCccccccccccccccccCCC
Q psy8111          82 KDKHWHEACFSCSKCRQSLVD  102 (135)
Q Consensus        82 ~~~~~H~~Cf~C~~C~~~l~~  102 (135)
                      .+..+-++|++|..|+..+.+
T Consensus       107 sg~~~ckk~~~c~qc~~~lpg  127 (694)
T KOG4443|consen  107 SGPWLCKKCTRCRQCDSTLPG  127 (694)
T ss_pred             CcccccHHHHhhhhccccccc
Confidence            356678899999999998876


No 146
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.11  E-value=97  Score=25.15  Aligned_cols=56  Identities=16%  Similarity=0.304  Sum_probs=35.0

Q ss_pred             cceeeCCCcccCCCCeeccccCCccCC------CceEeECCeeeccCchhh-hcCCchhhcCCc
Q psy8111          15 DYNKLGGKDRGSGQHFCCWQCDESLTG------QRYVLRDDHPYCIKCYES-VFANSCEECSKI   71 (135)
Q Consensus        15 ~~i~a~~~~~H~~~cf~C~~C~~~l~~------~~~~~~~~~~~C~~c~~~-~~~~~C~~C~~~   71 (135)
                      +++...++.-... -..|..|+..+.=      ..|...++.+.|..|-.+ .....|..|+..
T Consensus       200 qvLvflnrrGya~-~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       200 QSILFLNRRGYSK-NLLCRSCGYILCCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             cEEEEEeCCcCCC-eeEhhhCcCccCCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            4555555543333 3666666665531      135556788999999765 345689999875


No 147
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=23.30  E-value=32  Score=26.49  Aligned_cols=27  Identities=22%  Similarity=0.854  Sum_probs=16.8

Q ss_pred             ccccCCccCCC-----ceEeE----CCeeeccCchh
Q psy8111          32 CWQCDESLTGQ-----RYVLR----DDHPYCIKCYE   58 (135)
Q Consensus        32 C~~C~~~l~~~-----~~~~~----~~~~~C~~c~~   58 (135)
                      |..||..|...     .|...    .+.++|++||.
T Consensus         1 C~GCG~~lq~~d~~~~Gy~p~~~~~~~~~~C~RC~~   36 (360)
T TIGR03597         1 CIGCGAAIQTTDPKKPGYTPKSALEKEEVYCQRCFR   36 (360)
T ss_pred             CCCCCceeEcCCCCCCCCCchHHcCcCCeeecchhh
Confidence            56777777321     34432    25788888887


No 148
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=23.24  E-value=1.1e+02  Score=21.61  Aligned_cols=13  Identities=23%  Similarity=0.833  Sum_probs=9.1

Q ss_pred             CCCcccCCCCCCC
Q psy8111         123 ASRCDGCSEIFKA  135 (135)
Q Consensus       123 ~~~C~~C~~~I~~  135 (135)
                      .|+|..|+..+.|
T Consensus       130 ~p~C~~Cgg~lrp  142 (224)
T cd01412         130 LPRCPKCGGLLRP  142 (224)
T ss_pred             CCCCCCCCCccCC
Confidence            4777778776654


No 149
>PRK14873 primosome assembly protein PriA; Provisional
Probab=23.24  E-value=50  Score=27.86  Aligned_cols=37  Identities=27%  Similarity=0.474  Sum_probs=23.4

Q ss_pred             cccccccCCCCCeeeeCCcccCHHhHhhhcCCCcccCCCC
Q psy8111          93 CSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSEI  132 (135)
Q Consensus        93 C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~  132 (135)
                      |..|+.+|.   |....+.+.|.-|-......+|..|+..
T Consensus       395 C~~C~~~L~---~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        395 CRHCTGPLG---LPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CCCCCCcee---EecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            444444442   3234567889888665566789999754


No 150
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=23.09  E-value=70  Score=16.64  Aligned_cols=7  Identities=29%  Similarity=1.199  Sum_probs=3.4

Q ss_pred             ccccccc
Q psy8111          84 KHWHEAC   90 (135)
Q Consensus        84 ~~~H~~C   90 (135)
                      +.||..|
T Consensus        22 ~~~H~~C   28 (51)
T PF00628_consen   22 RWYHQEC   28 (51)
T ss_dssp             CEEETTT
T ss_pred             hhhCccc
Confidence            3455554


No 151
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=22.97  E-value=75  Score=16.79  Aligned_cols=10  Identities=30%  Similarity=1.006  Sum_probs=6.0

Q ss_pred             cccCHHhHhh
Q psy8111         111 KIYCGNCYDA  120 (135)
Q Consensus       111 ~~~C~~c~~~  120 (135)
                      --+|+.||..
T Consensus        24 yDLC~~Cf~~   33 (45)
T cd02344          24 FDFCENCFKT   33 (45)
T ss_pred             ccchHHhhCC
Confidence            3457777654


No 152
>PLN03123 poly [ADP-ribose] polymerase; Provisional
Probab=22.90  E-value=45  Score=29.51  Aligned_cols=35  Identities=23%  Similarity=0.379  Sum_probs=20.6

Q ss_pred             hhhcCCchhhcCCccccCccccee-------CC---ccccccccc
Q psy8111          58 ESVFANSCEECSKIIGIDSKDLSY-------KD---KHWHEACFS   92 (135)
Q Consensus        58 ~~~~~~~C~~C~~~I~~~~~~~~~-------~~---~~~H~~Cf~   92 (135)
                      .+.....|.+|++.|.-++..|..       .|   ..||..||.
T Consensus        13 AkS~Rs~Ck~C~~~I~K~~lRi~~~v~~~~~dg~~~~W~H~~Cf~   57 (981)
T PLN03123         13 AKSSRSSCKTCKSPIDKDELRLGKMVQSTQFDGFMPMWNHASCIL   57 (981)
T ss_pred             ecCCCccccccCCcccCCCeEEEEeecccccCCCCCeeecccccc
Confidence            333346788888888644333311       12   356899986


No 153
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=22.73  E-value=52  Score=28.00  Aligned_cols=81  Identities=15%  Similarity=0.325  Sum_probs=46.1

Q ss_pred             cccccCccccccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccceeCC
Q psy8111           4 AVKHQDKSFREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSYKD   83 (135)
Q Consensus         4 ~C~~C~~~i~~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~   83 (135)
                      +|..|-+.|.+    -.++.|+-- --.|..||-.     |......||=..--.-..-+.|..|.+...      ...+
T Consensus        70 ~C~~Cl~E~~d----p~~Rry~Yp-F~nCt~CGPr-----~~i~~~lpydr~~t~m~~f~~C~~C~~ey~------~p~~  133 (711)
T TIGR00143        70 TCSDCLEEMLD----KNDRRYLYP-FISCTHCGPR-----FTIIEALPYDRENTSMADFPLCPDCAKEYK------DPLD  133 (711)
T ss_pred             hHHHHHHHhcC----CCcccccCC-cccccCCCCC-----eEEeecCCCCCCCcCCCCCcCCHHHHHHhc------CCcc
Confidence            45555555543    346788877 7788999654     333333333111000011246666666552      2357


Q ss_pred             ccccccccccccccccC
Q psy8111          84 KHWHEACFSCSKCRQSL  100 (135)
Q Consensus        84 ~~~H~~Cf~C~~C~~~l  100 (135)
                      +.||-.=-.|..|+-.|
T Consensus       134 rr~h~~~~~C~~Cgp~l  150 (711)
T TIGR00143       134 RRFHAQPIACPRCGPQL  150 (711)
T ss_pred             ccCCCCCccCCCCCcEE
Confidence            88887777788888777


No 154
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=22.66  E-value=48  Score=23.73  Aligned_cols=33  Identities=15%  Similarity=0.314  Sum_probs=24.7

Q ss_pred             ccCCCCeeccccCCccCCCceEeECCeeeccCch
Q psy8111          24 RGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCY   57 (135)
Q Consensus        24 ~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~   57 (135)
                      |=++ -..|..|+++++...|...+|..+|..|.
T Consensus       145 ~~p~-l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        145 YGLD-LDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             Cccc-hhhHhcCCCCCCceEEecccCCccccccc
Confidence            4455 45788999998754555788999998885


No 155
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=22.56  E-value=47  Score=17.89  Aligned_cols=23  Identities=35%  Similarity=0.804  Sum_probs=11.6

Q ss_pred             CcccCHHhHhhhc---CCCcccCCCC
Q psy8111         110 EKIYCGNCYDAQF---ASRCDGCSEI  132 (135)
Q Consensus       110 ~~~~C~~c~~~~~---~~~C~~C~~~  132 (135)
                      +--+|..||.+..   +-+|.+|.++
T Consensus        21 gf~IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen   21 GFQICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             S----HHHHHHHTTSS-SB-TTT--B
T ss_pred             CCcHHHHHHHHHHhccCCCCCCCCCC
Confidence            4456899987655   4689999876


No 156
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=22.52  E-value=80  Score=23.14  Aligned_cols=49  Identities=18%  Similarity=0.438  Sum_probs=37.6

Q ss_pred             ccCCCCeeccccCCccCCC-ceEe--ECCeeeccCchhhhc-CCchhhcCCccc
Q psy8111          24 RGSGQHFCCWQCDESLTGQ-RYVL--RDDHPYCIKCYESVF-ANSCEECSKIIG   73 (135)
Q Consensus        24 ~H~~~cf~C~~C~~~l~~~-~~~~--~~~~~~C~~c~~~~~-~~~C~~C~~~I~   73 (135)
                      .... -|.|..-+..|.+. .|+.  .-|.++.++...+.- ...|..|+++..
T Consensus       109 ~~~~-~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~~~Cp~c~~~f~  161 (260)
T PF04641_consen  109 NSEG-RFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKSKKCPVCGKPFT  161 (260)
T ss_pred             cCCc-eeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhcccccccccCCccc
Confidence            4566 79999999999775 4543  468899888887765 457899999886


No 157
>smart00355 ZnF_C2H2 zinc finger.
Probab=22.49  E-value=44  Score=13.97  Aligned_cols=10  Identities=20%  Similarity=0.664  Sum_probs=5.0

Q ss_pred             eccccCCccC
Q psy8111          31 CCWQCDESLT   40 (135)
Q Consensus        31 ~C~~C~~~l~   40 (135)
                      .|..|+..+.
T Consensus         2 ~C~~C~~~f~   11 (26)
T smart00355        2 RCPECGKVFK   11 (26)
T ss_pred             CCCCCcchhC
Confidence            4555555443


No 158
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.45  E-value=57  Score=19.27  Aligned_cols=42  Identities=19%  Similarity=0.525  Sum_probs=26.2

Q ss_pred             cccccccCCCCC---eeeeCCcccCHHhHhhhcCCCcccCCCCCC
Q psy8111          93 CSKCRQSLVDKQ---FGSKSEKIYCGNCYDAQFASRCDGCSEIFK  134 (135)
Q Consensus        93 C~~C~~~l~~~~---~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~  134 (135)
                      |.-|++.|...+   ..-.-.--||.+|.+.++.-.|..|+..++
T Consensus         8 CECCDrDLpp~s~dA~ICtfEcTFCadCae~~l~g~CPnCGGelv   52 (84)
T COG3813           8 CECCDRDLPPDSTDARICTFECTFCADCAENRLHGLCPNCGGELV   52 (84)
T ss_pred             CcccCCCCCCCCCceeEEEEeeehhHhHHHHhhcCcCCCCCchhh
Confidence            455666665331   111124457888888888888888876543


No 159
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=22.18  E-value=45  Score=18.22  Aligned_cols=10  Identities=20%  Similarity=1.009  Sum_probs=4.1

Q ss_pred             ccccCCccCC
Q psy8111          32 CWQCDESLTG   41 (135)
Q Consensus        32 C~~C~~~l~~   41 (135)
                      |..|.++|..
T Consensus         2 CfgC~~~~~~   11 (51)
T PF07975_consen    2 CFGCQKPFPD   11 (51)
T ss_dssp             ETTTTEE-TT
T ss_pred             CccCCCCCCC
Confidence            3344555544


No 160
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=22.16  E-value=55  Score=21.78  Aligned_cols=47  Identities=19%  Similarity=0.601  Sum_probs=34.5

Q ss_pred             cccccccccccccCCCCCeeeeC---CcccCHHhHhhhc-----CCCcccCCCCC
Q psy8111          87 HEACFSCSKCRQSLVDKQFGSKS---EKIYCGNCYDAQF-----ASRCDGCSEIF  133 (135)
Q Consensus        87 H~~Cf~C~~C~~~l~~~~~~~~~---~~~~C~~c~~~~~-----~~~C~~C~~~I  133 (135)
                      -+.=+.|..|+..-.++.|.-.+   |--.|..||..+.     .|+|.+|+...
T Consensus        77 d~~lYeCnIC~etS~ee~FLKPneCCgY~iCn~Cya~LWK~~~~ypvCPvCkTSF  131 (140)
T PF05290_consen   77 DPKLYECNICKETSAEERFLKPNECCGYSICNACYANLWKFCNLYPVCPVCKTSF  131 (140)
T ss_pred             CCCceeccCcccccchhhcCCcccccchHHHHHHHHHHHHHcccCCCCCcccccc
Confidence            34456799998887777666554   7788999997653     48999997654


No 161
>PF14149 YhfH:  YhfH-like protein
Probab=21.94  E-value=18  Score=18.37  Aligned_cols=15  Identities=13%  Similarity=0.428  Sum_probs=8.9

Q ss_pred             hhhcCCCcccCCCCC
Q psy8111         119 DAQFASRCDGCSEIF  133 (135)
Q Consensus       119 ~~~~~~~C~~C~~~I  133 (135)
                      +.+-...|..|++.|
T Consensus         9 rnLp~K~C~~CG~~i   23 (37)
T PF14149_consen    9 RNLPPKKCTECGKEI   23 (37)
T ss_pred             HhCCCcccHHHHHHH
Confidence            334455677777665


No 162
>cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24). L24e/L24 is located on the surface of the large subunit, adjacent to proteins L14 and L3, and near the translation factor binding site.  L24e/L24 appears to play a role in the kinetics of peptide synthesis, and may be involved in interactions between the large and small subunits, either directly or through other factors. In mouse, a deletion mutation in L24 has been identified as the cause for the belly spot and tail (Bst) mutation that results in disrupted pigmentation, somitogenesis and retinal cell fate determination.  L24 may be an important protein in eukaryotic reproduction:  in shrimp, L24 expression is elevated in the ovary, suggesting a role in oogenesis, and in Arabidopsis, L24 has been proposed to have a specific function in gynoecium development. No protein with sequence or structural homology to L24e/L24 has been identifi
Probab=21.83  E-value=81  Score=17.40  Aligned_cols=22  Identities=23%  Similarity=0.401  Sum_probs=12.2

Q ss_pred             eccccCCccCCC---ceEeECCeee
Q psy8111          31 CCWQCDESLTGQ---RYVLRDDHPY   52 (135)
Q Consensus        31 ~C~~C~~~l~~~---~~~~~~~~~~   52 (135)
                      .|+-|+..+...   .|+..||+++
T Consensus         5 ~C~f~g~~I~PG~G~~~Vr~Dgkv~   29 (54)
T cd00472           5 KCSFCGYKIYPGHGKMYVRNDGKVF   29 (54)
T ss_pred             EecCcCCeecCCCccEEEecCCCEE
Confidence            456666666432   4555666654


No 163
>PRK11595 DNA utilization protein GntX; Provisional
Probab=21.69  E-value=53  Score=23.45  Aligned_cols=21  Identities=19%  Similarity=0.659  Sum_probs=11.1

Q ss_pred             eccCchhhh--cCCchhhcCCcc
Q psy8111          52 YCIKCYESV--FANSCEECSKII   72 (135)
Q Consensus        52 ~C~~c~~~~--~~~~C~~C~~~I   72 (135)
                      +|..|....  ..+.|..|++++
T Consensus        22 lC~~C~~~l~~~~~~C~~Cg~~~   44 (227)
T PRK11595         22 ICSVCSRALRTLKTCCPQCGLPA   44 (227)
T ss_pred             ccHHHHhhCCcccCcCccCCCcC
Confidence            566665442  124566666654


No 164
>KOG0823|consensus
Probab=21.66  E-value=88  Score=22.76  Aligned_cols=54  Identities=20%  Similarity=0.418  Sum_probs=36.3

Q ss_pred             cCCCCeeccccCCccCCCceEeECCeeeccCchhh-----hcCCchhhcCCccccCccccee
Q psy8111          25 GSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYES-----VFANSCEECSKIIGIDSKDLSY   81 (135)
Q Consensus        25 H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~-----~~~~~C~~C~~~I~~~~~~~~~   81 (135)
                      --. .|.|..|=. +...+-+.-=|.+||=.|..+     .....|..|+-.|. .+.+|-.
T Consensus        44 ~~~-~FdCNICLd-~akdPVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs-~~~vvPl  102 (230)
T KOG0823|consen   44 DGG-FFDCNICLD-LAKDPVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVS-IDTVVPL  102 (230)
T ss_pred             CCC-ceeeeeecc-ccCCCEEeecccceehHHHHHHHhhcCCCeeCCccccccc-cceEEee
Confidence            345 799999833 333355667799999999876     23356799999886 3444443


No 165
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=21.31  E-value=78  Score=16.84  Aligned_cols=9  Identities=56%  Similarity=1.058  Sum_probs=5.4

Q ss_pred             chhhcCC-cc
Q psy8111          64 SCEECSK-II   72 (135)
Q Consensus        64 ~C~~C~~-~I   72 (135)
                      .|.+|.+ +|
T Consensus         2 ~C~~C~~~~i   11 (49)
T cd02345           2 SCSACRKQDI   11 (49)
T ss_pred             cCCCCCCCCc
Confidence            4566666 55


No 166
>PF10170 C6_DPF:  Cysteine-rich domain;  InterPro: IPR018785  This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. 
Probab=21.09  E-value=97  Score=19.37  Aligned_cols=28  Identities=21%  Similarity=0.511  Sum_probs=15.0

Q ss_pred             cccccccCC-CCCeeeeCCcccCHHhHhh
Q psy8111          93 CSKCRQSLV-DKQFGSKSEKIYCGNCYDA  120 (135)
Q Consensus        93 C~~C~~~l~-~~~~~~~~~~~~C~~c~~~  120 (135)
                      |+.|+++.= +....+.-.+-+|..|..+
T Consensus        52 CS~C~~~VC~~~~CSlFYtkrFC~pC~~~   80 (97)
T PF10170_consen   52 CSICGKPVCVGQDCSLFYTKRFCLPCVKR   80 (97)
T ss_pred             ccccCCceEcCCCccEEeeCceeHHHHHH
Confidence            666776653 2233333445567777543


No 167
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=20.56  E-value=42  Score=15.12  Aligned_cols=11  Identities=27%  Similarity=0.697  Sum_probs=7.5

Q ss_pred             CeeccccCCcc
Q psy8111          29 HFCCWQCDESL   39 (135)
Q Consensus        29 cf~C~~C~~~l   39 (135)
                      =|.|..|++.+
T Consensus        14 ~~~C~~C~k~F   24 (26)
T PF13465_consen   14 PYKCPYCGKSF   24 (26)
T ss_dssp             SEEESSSSEEE
T ss_pred             CCCCCCCcCee
Confidence            37788887654


Done!