Query         psy8114
Match_columns 111
No_of_seqs    23 out of 25
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 18:57:53 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8114.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8114hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01581 FARP:  FMRFamide relat  90.8   0.081 1.8E-06   24.7   0.2    9   89-97      3-11  (11)
  2 TIGR03042 PS_II_psbQ_bact phot  89.4    0.42 9.1E-06   36.3   3.2   55    7-65      9-63  (142)
  3 PF14369 zf-RING_3:  zinc-finge  64.2       3 6.6E-05   24.5   0.6   12   25-36     24-35  (35)
  4 TIGR03516 ppisom_GldI peptidyl  60.7      15 0.00033   27.9   4.0   58    1-64      1-59  (177)
  5 cd07998 WGR_DNA_ligase WGR dom  59.3     4.3 9.4E-05   28.0   0.7   13   92-104    31-43  (77)
  6 TIGR01710 typeII_sec_gspG gene  56.6      13 0.00027   26.6   2.8   22   45-66     37-58  (134)
  7 PF08194 DIM:  DIM protein;  In  56.5      12 0.00026   22.9   2.2   19    1-19      1-19  (36)
  8 PF02903 Alpha-amylase_N:  Alph  53.1     6.7 0.00015   27.1   0.9   19   83-101    29-47  (120)
  9 COG0143 MetG Methionyl-tRNA sy  50.3      13 0.00029   33.5   2.5   28   41-68    440-467 (558)
 10 cd07994 WGR WGR domain. The WG  50.2      10 0.00022   24.9   1.4   15   89-103    28-43  (73)
 11 smart00773 WGR Proposed nuclei  50.1     9.8 0.00021   25.0   1.3   14   89-102    35-48  (84)
 12 TIGR02763 chlamy_scaf chlamydi  48.3       6 0.00013   29.5   0.0   44   32-84     46-89  (114)
 13 PF05406 WGR:  WGR domain;  Int  45.8      10 0.00022   24.8   0.9   15   89-103    32-46  (81)
 14 COG1419 FlhF Flagellar GTP-bin  43.3     9.5 0.00021   33.4   0.5   30   75-104   315-344 (407)
 15 PF03511 Fanconi_A:  Fanconi an  41.8      66  0.0014   22.0   4.3   37    3-48      4-40  (64)
 16 PF10929 DUF2811:  Protein of u  39.8      22 0.00047   23.6   1.7   19   52-70      9-27  (57)
 17 cd07958 Anticodon_Ia_Leu_BEm A  37.4      36 0.00078   21.9   2.4   20   46-65     66-85  (117)
 18 PTZ00015 histone H4; Provision  35.4      14 0.00031   26.6   0.3   44   51-102    54-101 (102)
 19 PF02812 ELFV_dehydrog_N:  Glu/  35.0      22 0.00048   26.0   1.2   73    8-97     50-129 (131)
 20 COG4698 Uncharacterized protei  34.5      24 0.00053   28.5   1.5   63    2-64     12-74  (197)
 21 PLN00035 histone H4; Provision  34.1      15 0.00033   26.6   0.3   45   51-103    53-101 (103)
 22 cd07375 Anticodon_Ia_like Anti  33.0      30 0.00065   21.9   1.5   20   46-65     67-86  (117)
 23 COG2165 PulG Type II secretory  31.8 1.4E+02   0.003   19.6   4.6   29   37-65     37-65  (149)
 24 PF11328 DUF3130:  Protein of u  31.2      61  0.0013   23.3   3.0   34   24-60     27-60  (90)
 25 cd07356 HN_L-whirlin_R1_like F  31.2      40 0.00086   23.8   1.9   48   37-86      2-55  (78)
 26 KOG2046|consensus               31.2      31 0.00068   27.6   1.6   36   45-86     81-117 (193)
 27 cd07996 WGR_MMR_like WGR domai  31.0      33 0.00072   21.7   1.4   16   89-104    29-44  (74)
 28 PF13670 PepSY_2:  Peptidase pr  28.9      98  0.0021   20.1   3.5   27    8-36      3-29  (83)
 29 COG4574 Eco Serine protease in  28.5      50  0.0011   25.9   2.3   20    1-20      1-20  (162)
 30 COG2317 Zn-dependent carboxype  27.7      29 0.00063   31.4   1.0   47   43-93    128-174 (497)
 31 COG3090 DctM TRAP-type C4-dica  27.2      83  0.0018   23.7   3.2   26   27-52     74-99  (177)
 32 cd07355 HN_L-delphilin-R2_like  26.8      46   0.001   23.6   1.7   38   37-86     18-55  (80)
 33 PF15172 Prolactin_RP:  Prolact  26.4      23 0.00051   22.9   0.1    9   93-101    29-37  (47)
 34 PRK11443 lipoprotein; Provisio  25.9      69  0.0015   23.5   2.5   18   15-32     12-31  (124)
 35 TIGR01796 CM_mono_aroH monofun  25.7      30 0.00064   25.8   0.6   16   79-94     93-108 (117)
 36 PF06840 DUF1241:  Protein of u  25.6      74  0.0016   24.5   2.7   20   45-64    117-136 (154)
 37 PF03800 Nuf2:  Nuf2 family;  I  24.9 1.1E+02  0.0025   21.8   3.5   27   37-63    112-138 (146)
 38 PF08479 POTRA_2:  POTRA domain  24.4      51  0.0011   20.9   1.4   22   44-65     30-51  (76)
 39 PRK00888 ftsB cell division pr  24.1      95  0.0021   21.9   2.9   13    1-13      1-13  (105)
 40 cd07957 Anticodon_Ia_Met Antic  23.9      89  0.0019   20.4   2.6   23   44-66     62-84  (129)
 41 PRK13733 conjugal transfer pro  23.8 1.2E+02  0.0025   24.0   3.6   57    1-65      1-57  (171)
 42 cd02185 AroH Chorismate mutase  23.3      35 0.00077   25.4   0.6   16   79-94     93-108 (117)
 43 PF01798 Nop:  Putative snoRNA   23.3 1.3E+02  0.0028   22.6   3.7   25   40-64      2-26  (150)
 44 COG0549 ArcC Carbamate kinase   22.9      34 0.00073   29.4   0.5   16   85-100   232-247 (312)
 45 cd07997 WGR_PARP WGR domain of  22.8      52  0.0011   22.6   1.3   14   89-102    40-53  (102)
 46 PF07327 Neuroparsin:  Neuropar  22.7      84  0.0018   23.2   2.4   21    4-25      7-27  (103)
 47 cd00385 Isoprenoid_Biosyn_C1 I  22.4 1.2E+02  0.0026   20.8   3.1   32   34-65    139-170 (243)
 48 cd07962 Anticodon_Ia_Val Antic  22.4      79  0.0017   21.7   2.2   24   44-67     68-93  (135)
 49 PF06287 DUF1039:  Protein of u  22.3      68  0.0015   21.7   1.8   19   30-50     20-38  (66)
 50 PRK12871 ubiA prenyltransferas  22.0   1E+02  0.0022   25.1   3.0   43   50-110    53-100 (297)
 51 PF13080 DUF3926:  Protein of u  21.8 1.3E+02  0.0029   19.1   2.9   32   32-65      3-34  (44)
 52 cd08003 WGR_PARP2_like WGR dom  21.3      54  0.0012   23.1   1.2   25   76-102    29-53  (103)
 53 PF14377 DUF4414:  Domain of un  21.0      38 0.00082   23.6   0.3   27   22-48     39-65  (108)
 54 PF08334 T2SG:  Type II secreti  20.5   2E+02  0.0043   19.5   3.8   25   42-66     10-34  (108)
 55 PF07736 CM_1:  Chorismate muta  20.3      46 0.00099   24.8   0.7   16   80-95     94-109 (118)
 56 KOG3574|consensus               20.2      26 0.00055   31.8  -0.8   19   88-108    87-106 (510)
 57 PF00616 RasGAP:  GTPase-activa  20.1 1.1E+02  0.0024   22.0   2.6   17   33-49    117-133 (197)
 58 PF06430 L_lactis_RepB_C:  Lact  20.0      47   0.001   25.1   0.7    8   81-88    115-122 (122)

No 1  
>PF01581 FARP:  FMRFamide related peptide family;  InterPro: IPR002544 The neuropeptide Phe-Met-Arg-Phe-NH2 (FMRFamide) is a potent cardioactive neuropeptide in Lymnaea stagnalis []. FMRFamide (Phe-Met-Arg-Phe-NH2) was first demonstrated to be cardioactive in several molluscan species. FMRFamide is now known to be cardioexcitatory in mammals, to inhibit morphine-induced antinociception, and to block morphine-, defeat-, and deprivation-induced feeding []. Thirteen neuropeptides varying in length from 7 to 11 residues and ending C-terminally in -Phe-Met-Arg-Phe-NH2 (calliFMRFamides 1-13) and one dodecapeptide ending in -Met-Ile-Arg-Phe-NH2 (calliMIRFamide 1) have been isolated from thoracic ganglia of the blowfly Calliphora vomitoria. Results indicate that the N terminus (in addition to the C terminus as previously found for FMRFamides of other organisms) is crucial for at least some biological activities [].; GO: 0007218 neuropeptide signaling pathway
Probab=90.80  E-value=0.081  Score=24.70  Aligned_cols=9  Identities=44%  Similarity=1.206  Sum_probs=7.3

Q ss_pred             ceeeeeccc
Q psy8114          89 DHVFLRYGK   97 (111)
Q Consensus        89 DHVFLRFGR   97 (111)
                      |.-|+||||
T Consensus         3 ~~~~~RFGr   11 (11)
T PF01581_consen    3 DNNFMRFGR   11 (11)
T ss_pred             cccccccCC
Confidence            456999998


No 2  
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ. This protein through the member sll1638 from Synechocystis sp. PCC 6803, was shown to be part of the cyanobacteria photosystem II. It is homologous to (but quite diverged from) the chloroplast PsbQ protein, called oxygen-evolving enhancer protein 3 (OEE3). We designate this cyanobacteria protein PsbQ by homology.
Probab=89.44  E-value=0.42  Score=36.26  Aligned_cols=55  Identities=24%  Similarity=0.260  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHhhhhccCCCCCCCcccccCCChHHHHHHHHHHHHHHHHHHHHHhHhhcC
Q psy8114           7 LVLFLMVTLFMKKSLAMPPLQCTPGFVDQIPFKIRKICVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus         7 ~v~~~~~~i~~~~A~AapPp~C~p~~lDelpPriRKiC~AL~ni~els~Ame~YIddq~   65 (111)
                      ||+++++.++|+...++.||-=+|..+..+--.++.|=++=+++.|    +++||+++.
T Consensus         9 Lv~~~~~Lvsc~~p~~~~p~tysp~~l~~i~~~~~~i~~~~~r~~e----Lk~lI~kk~   63 (142)
T TIGR03042         9 LVLLLTFLVSCSGPAAAVPPTYSPAQLAQIQRQAEGIEAAKDRLPE----LASLVAKED   63 (142)
T ss_pred             HHHHHHHHHHcCCCcccCCCCCCHHHHHHHHHHHHHHHHHHHhhHH----HHHHHhhcc
Confidence            5667777888888777778888888888666666666666665555    688998874


No 3  
>PF14369 zf-RING_3:  zinc-finger
Probab=64.24  E-value=3  Score=24.54  Aligned_cols=12  Identities=42%  Similarity=0.863  Sum_probs=10.8

Q ss_pred             CCCCCcccccCC
Q psy8114          25 PLQCTPGFVDQI   36 (111)
Q Consensus        25 Pp~C~p~~lDel   36 (111)
                      =|.|.+||++||
T Consensus        24 CP~C~~gFvEei   35 (35)
T PF14369_consen   24 CPRCHGGFVEEI   35 (35)
T ss_pred             CcCCCCcEeEeC
Confidence            689999999986


No 4  
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
Probab=60.66  E-value=15  Score=27.94  Aligned_cols=58  Identities=24%  Similarity=0.317  Sum_probs=42.3

Q ss_pred             CchhHHHHHHHHHHHHhhhhccCCCCC-CCcccccCCChHHHHHHHHHHHHHHHHHHHHHhHhhc
Q psy8114           1 MKWLQPLVLFLMVTLFMKKSLAMPPLQ-CTPGFVDQIPFKIRKICVALSTIYELSNAMESYIDDN   64 (111)
Q Consensus         1 ~~~~~~~v~~~~~~i~~~~A~AapPp~-C~p~~lDelpPriRKiC~AL~ni~els~Ame~YIddq   64 (111)
                      ||-+.-+.++..++++|++..+-.|-. =+..++++-=.|.||+=..     | ..++++||.++
T Consensus         1 ~~~~~~~~~~~~~~~~c~~~~~~~pv~~~~~~~~~~s~~rnk~l~~~-----e-~~~I~~~i~~~   59 (177)
T TIGR03516         1 MKHLIAVILLLLLLLGCKTPEARRPISRSSGTTIKLSAERNKKLIAA-----E-EAAIKRIISAD   59 (177)
T ss_pred             CceeHHHHHHHHHHhhcCCCCCCCCcCCCCcchHHHHHHHHHHHHHH-----H-HHHHHHHHHhC
Confidence            677777788888999999888776663 3455667655677776552     3 46899999965


No 5  
>cd07998 WGR_DNA_ligase WGR domain of bacterial DNA ligases. The WGR domain is found in a small family of predicted bacterial DNA ligases. It has been called WGR after the most conserved central motif of the domain. The domain typically occurs in together with an ATP-dependent DNA ligase domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain.
Probab=59.25  E-value=4.3  Score=28.02  Aligned_cols=13  Identities=31%  Similarity=0.289  Sum_probs=10.8

Q ss_pred             eeeccccCCCCcc
Q psy8114          92 FLRYGKITSDGWV  104 (111)
Q Consensus        92 FLRFGR~~~~~~~  104 (111)
                      =-||||||++|-.
T Consensus        31 ~~~yGR~Gt~gq~   43 (77)
T cd07998          31 NFRYGRRGSALRE   43 (77)
T ss_pred             EEEEccccCCccc
Confidence            3599999999865


No 6  
>TIGR01710 typeII_sec_gspG general secretion pathway protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens.
Probab=56.57  E-value=13  Score=26.64  Aligned_cols=22  Identities=45%  Similarity=0.567  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHhHhhcCC
Q psy8114          45 VALSTIYELSNAMESYIDDNGS   66 (111)
Q Consensus        45 ~AL~ni~els~Ame~YIddq~~   66 (111)
                      .+.+++.++.+|++.|-.|.+.
T Consensus        37 ~~~~~l~~i~~al~~y~~d~g~   58 (134)
T TIGR01710        37 VAKAQIKALKNALDMYRLDNGR   58 (134)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCC
Confidence            3457777888999999988765


No 7  
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=56.52  E-value=12  Score=22.88  Aligned_cols=19  Identities=26%  Similarity=0.286  Sum_probs=13.6

Q ss_pred             CchhHHHHHHHHHHHHhhh
Q psy8114           1 MKWLQPLVLFLMVTLFMKK   19 (111)
Q Consensus         1 ~~~~~~~v~~~~~~i~~~~   19 (111)
                      |||++=+..++.+++.++.
T Consensus         1 Mk~l~~a~~l~lLal~~a~   19 (36)
T PF08194_consen    1 MKCLSLAFALLLLALAAAV   19 (36)
T ss_pred             CceeHHHHHHHHHHHHhcc
Confidence            8999886677777755444


No 8  
>PF02903 Alpha-amylase_N:  Alpha amylase, N-terminal ig-like domain;  InterPro: IPR004185 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Enzymes containing this domain belong to family 13 (GH13 from CAZY) of the glycosyl hydrolases. The maltogenic alpha-amylase is an enzyme which catalyses hydrolysis of (1-4)-alpha-D-glucosidic linkages in polysaccharides so as to remove successive alpha-maltose residues from the non-reducing ends of the chains in the conversion of starch to maltose. Other enzymes include neopullulanase, which hydrolyses pullulan to panose, and cyclomaltodextrinase, which hydrolyses cyclodextrins.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1J0J_A 1J0H_A 1J0I_A 1J0K_A 1EA9_C 1SMA_A 1GVI_B 1WZK_B 1VFM_B 3A6O_A ....
Probab=53.12  E-value=6.7  Score=27.10  Aligned_cols=19  Identities=32%  Similarity=0.672  Sum_probs=15.4

Q ss_pred             CcccccceeeeeccccCCC
Q psy8114          83 VKRQDMDHVFLRYGKITSD  101 (111)
Q Consensus        83 ~KRQDVDHVFLRFGR~~~~  101 (111)
                      +++.||++|+|++|-+..-
T Consensus        29 t~k~Dv~~V~l~~~d~~~~   47 (120)
T PF02903_consen   29 TAKNDVEKVFLVYGDPYEE   47 (120)
T ss_dssp             EETTT-SEEEEEEEETTSE
T ss_pred             ecCCCCCEEEEEECCCccc
Confidence            6789999999999988743


No 9  
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=50.34  E-value=13  Score=33.45  Aligned_cols=28  Identities=25%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHhHhhcCCCC
Q psy8114          41 RKICVALSTIYELSNAMESYIDDNGSMD   68 (111)
Q Consensus        41 RKiC~AL~ni~els~Ame~YIddq~~~~   68 (111)
                      .++=.||+.+.+|++..|.||+++++|.
T Consensus       440 ~~~~~Al~~i~~l~~~~N~Yi~~~~PW~  467 (558)
T COG0143         440 YEFRKALEEIMALASRANKYIDEQAPWK  467 (558)
T ss_pred             hhHHHHHHHHHHHHHHHHHHhhcCCCch
Confidence            3455688899999999999999999885


No 10 
>cd07994 WGR WGR domain. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs) as well as the putative Escherichia coli molybdate metabolism regulator and related bacterial proteins, a small family of bacterial DNA ligases, and various other bacterial proteins of unknown function. It has been called WGR after the most conserved central motif of the domain. The domain occurs in single-domain proteins and in a variety of domain architectures, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain.
Probab=50.24  E-value=10  Score=24.91  Aligned_cols=15  Identities=33%  Similarity=0.545  Sum_probs=12.4

Q ss_pred             ceeeeeccccCC-CCc
Q psy8114          89 DHVFLRYGKITS-DGW  103 (111)
Q Consensus        89 DHVFLRFGR~~~-~~~  103 (111)
                      =+||-|+||.|. .|=
T Consensus        28 ~~v~~~WGRiGt~~Gq   43 (73)
T cd07994          28 YWVFRSYGRVGTVIGS   43 (73)
T ss_pred             EEEEEEECCccCcCCc
Confidence            478999999998 663


No 11 
>smart00773 WGR Proposed nucleic acid binding domain. This domain is named after its most conserved central motif. It is found in a variety of polyA polymerases as well as in molybdate metabolism regulators (e.g. in E.coli) and other proteins of unknown function. The domain is found in isolation in some proteins and is between 70 and 80 residues in length. It is proposed that it may be a nucleic acid binding domain.
Probab=50.13  E-value=9.8  Score=24.98  Aligned_cols=14  Identities=36%  Similarity=0.788  Sum_probs=12.5

Q ss_pred             ceeeeeccccCCCC
Q psy8114          89 DHVFLRYGKITSDG  102 (111)
Q Consensus        89 DHVFLRFGR~~~~~  102 (111)
                      =+||.++||.|+.|
T Consensus        35 ~~v~~~wGRiG~~g   48 (84)
T smart00773       35 YSVWRRWGRIGTNG   48 (84)
T ss_pred             EEEEEEeeecCCCC
Confidence            58999999999876


No 12 
>TIGR02763 chlamy_scaf chlamydiaphage internal scaffolding protein. Members of this protein family are encoded by genes in chlamydiaphage such as Chp2, viruses with around eight genes that infect obligately intracellular bacterial pathogens of the genus Chlamydia. This protein, initially designated VP3 (as if a structural protein of mature viral particles), is displaced from procapsids as DNA is packaged, and therefore is described as a scafolding protein.
Probab=48.26  E-value=6  Score=29.54  Aligned_cols=44  Identities=25%  Similarity=0.396  Sum_probs=29.6

Q ss_pred             cccCCChHHHHHHHHHHHHHHHHHHHHHhHhhcCCCCCCccccchhhhcCCCc
Q psy8114          32 FVDQIPFKIRKICVALSTIYELSNAMESYIDDNGSMDQFVNPEINQLMENGVK   84 (111)
Q Consensus        32 ~lDelpPriRKiC~AL~ni~els~Ame~YIddq~~~~~~~~~~~~~l~d~~~K   84 (111)
                      +-|+||-++|+=-   .|   =..+|=+|++|+.||.-   ....+++++.+|
T Consensus        46 aFdsLPAkvRe~F---gN---dPeeml~~L~d~~nyde---~~algll~~e~~   89 (114)
T TIGR02763        46 AFDSLPAKVRENF---GN---DPEEMLSWLEDEANYDE---VEALGLLDPETK   89 (114)
T ss_pred             HHHHhhHHHHHHh---CC---CHHHHHHHHhChhhHHH---HHHhcccccccc
Confidence            3577888888621   11   14478899999998653   346777887755


No 13 
>PF05406 WGR:  WGR domain;  InterPro: IPR008893 This domain is named after the most conserved central motif of the domain. It is found in a variety of polyA polymerases as well as the Escherichia coli molybdate metabolism regulator P33345 from SWISSPROT and other proteins of unknown function.The domain is found in isolation in proteins such as Q9JN21 from SWISSPROT and is between 70 and 80 residues in length. ; PDB: 2EOC_A 2RA8_A 4DQY_C 2CR9_A.
Probab=45.85  E-value=10  Score=24.79  Aligned_cols=15  Identities=47%  Similarity=0.636  Sum_probs=13.4

Q ss_pred             ceeeeeccccCCCCc
Q psy8114          89 DHVFLRYGKITSDGW  103 (111)
Q Consensus        89 DHVFLRFGR~~~~~~  103 (111)
                      -.||.++||.|+.|=
T Consensus        32 ~~v~~~wGRiG~~gq   46 (81)
T PF05406_consen   32 WVVFRRWGRIGSKGQ   46 (81)
T ss_dssp             EEEEEEEEETTSSEE
T ss_pred             eEEEEEECCCCCcCc
Confidence            789999999999863


No 14 
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=43.29  E-value=9.5  Score=33.40  Aligned_cols=30  Identities=13%  Similarity=0.389  Sum_probs=25.1

Q ss_pred             chhhhcCCCcccccceeeeeccccCCCCcc
Q psy8114          75 INQLMENGVKRQDMDHVFLRYGKITSDGWV  104 (111)
Q Consensus        75 ~~~l~d~~~KRQDVDHVFLRFGR~~~~~~~  104 (111)
                      .--.+..+.|.+|+.++|-+|+.-..+|-+
T Consensus       315 ~~Lvlsat~K~~dlkei~~~f~~~~i~~~I  344 (407)
T COG1419         315 VYLVLSATTKYEDLKEIIKQFSLFPIDGLI  344 (407)
T ss_pred             EEEEEecCcchHHHHHHHHHhccCCcceeE
Confidence            334477999999999999999999888853


No 15 
>PF03511 Fanconi_A:  Fanconi anaemia group A protein;  InterPro: IPR003516 Fanconi anaemia (FA) [, , ] is a recessive inherited disease characterised by defective DNA repair. FA cells are sensitive to DNA cross-linking agents that cause chromosomal instability and cell death. The disease is manifested clinically by progressive pancytopenia, variable physical anomalies, and predisposition to malignancy []. Four complementation groups have been identified, designated A to D. The FA group A gene (FAA) has been cloned [], but its function remains to be elucidated.
Probab=41.78  E-value=66  Score=21.95  Aligned_cols=37  Identities=22%  Similarity=0.303  Sum_probs=28.3

Q ss_pred             hhHHHHHHHHHHHHhhhhccCCCCCCCcccccCCChHHHHHHHHHH
Q psy8114           3 WLQPLVLFLMVTLFMKKSLAMPPLQCTPGFVDQIPFKIRKICVALS   48 (111)
Q Consensus         3 ~~~~~v~~~~~~i~~~~A~AapPp~C~p~~lDelpPriRKiC~AL~   48 (111)
                      -+++|.||..|-+.|+.-.       .....|  +++.-.+|+.+-
T Consensus         4 lLvsLfFFSLM~LlSs~l~-------p~~~~d--~~kaldiCaeIL   40 (64)
T PF03511_consen    4 LLVSLFFFSLMGLLSSYLA-------PKEGAD--SLKALDICAEIL   40 (64)
T ss_pred             hHHHHHHHHHHHHHHHhcC-------cccccc--cHHHHHHHHHHH
Confidence            5789999999999887543       134567  899999999544


No 16 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=39.77  E-value=22  Score=23.61  Aligned_cols=19  Identities=32%  Similarity=0.691  Sum_probs=16.1

Q ss_pred             HHHHHHHHhHhhcCCCCCC
Q psy8114          52 ELSNAMESYIDDNGSMDQF   70 (111)
Q Consensus        52 els~Ame~YIddq~~~~~~   70 (111)
                      +|-.+|+.||+.-++|+|-
T Consensus         9 ~L~~~m~~fie~hP~WDQ~   27 (57)
T PF10929_consen    9 DLHQAMKDFIETHPNWDQY   27 (57)
T ss_pred             HHHHHHHHHHHcCCCchHH
Confidence            4567999999999999775


No 17 
>cd07958 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases. This domain is found in leucyl tRNA synthetases (LeuRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain. In contrast to other class Ia enzymes, the anticodon is not used as an identity element in LeuRS (with exceptions such as Saccharomyces cerevisiae and some other eukaryotes). No anticodon-binding site can be defined for this family, which includes bacterial and eukaryotic mitochondrial members, as well as LeuRS from the archaeal Halobacteria. LeuRS catalyzes the transfer of leucine to the 3'-end of its tRNA.
Probab=37.37  E-value=36  Score=21.90  Aligned_cols=20  Identities=30%  Similarity=0.532  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHhHhhcC
Q psy8114          46 ALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        46 AL~ni~els~Ame~YIddq~   65 (111)
                      |++.+++|.++++.|+++..
T Consensus        66 a~~~i~~~~~~~n~~~~~~~   85 (117)
T cd07958          66 AIAALMELVNALYKYKKKDA   85 (117)
T ss_pred             HHHHHHHHHHHHHHhhcccc
Confidence            45566777788888877643


No 18 
>PTZ00015 histone H4; Provisional
Probab=35.45  E-value=14  Score=26.65  Aligned_cols=44  Identities=18%  Similarity=0.298  Sum_probs=29.5

Q ss_pred             HHHHHHHHHhHhhcCCCCCCccccchhhhc----CCCcccccceeeeeccccCCCC
Q psy8114          51 YELSNAMESYIDDNGSMDQFVNPEINQLME----NGVKRQDMDHVFLRYGKITSDG  102 (111)
Q Consensus        51 ~els~Ame~YIddq~~~~~~~~~~~~~l~d----~~~KRQDVDHVFLRFGR~~~~~  102 (111)
                      .|+...+|.|+++-       .+++..+.+    ..+|=+||++..-|.|| +.-|
T Consensus        54 ~e~r~vle~~l~~I-------~rdav~~aeHA~RKTVt~~DV~~AlKr~g~-~~yg  101 (102)
T PTZ00015         54 EEVRGVLKAFLENV-------VRDSTAYTEYARRKTVTAMDVVYALKRQGR-TLYG  101 (102)
T ss_pred             HHHHHHHHHHHHHH-------HHHHHHHHHhcCCCcccHHHHHHHHHhcCC-CCCC
Confidence            36667788888763       244444444    34556799999999998 4444


No 19 
>PF02812 ELFV_dehydrog_N:  Glu/Leu/Phe/Val dehydrogenase, dimerisation domain;  InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related. They contain a Gly-rich region containing a conserved Lys residue, which has been implicated in the catalytic activity, in each case a reversible oxidative deamination reaction. Glutamate dehydrogenases (1.4.1.2 from EC, 1.4.1.3 from EC, and 1.4.1.4 from EC) (GluDH) are enzymes that catalyse the NAD- and/or NADP-dependent reversible deamination of L-glutamate into alpha-ketoglutarate [, ]. GluDH isozymes are generally involved with either ammonia assimilation or glutamate catabolism. Two separate enzymes are present in yeasts: the NADP-dependent enzyme, which catalyses the amination of alpha-ketoglutarate to L-glutamate; and the NAD-dependent enzyme, which catalyses the reverse reaction [] - this form links the L-amino acids with the Krebs cycle, which provides a major pathway for metabolic interconversion of alpha-amino acids and alpha- keto acids []. Leucine dehydrogenase (1.4.1.9 from EC) (LeuDH) is a NAD-dependent enzyme that catalyses the reversible deamination of leucine and several other aliphatic amino acids to their keto analogues []. Each subunit of this octameric enzyme from Bacillus sphaericus contains 364 amino acids and folds into two domains, separated by a deep cleft. The nicotinamide ring of the NAD+ cofactor binds deep in this cleft, which is thought to close during the hydride transfer step of the catalytic cycle. Phenylalanine dehydrogenase (1.4.1.20 from EC) (PheDH) is na NAD-dependent enzyme that catalyses the reversible deamidation of L-phenylalanine into phenyl-pyruvate []. Valine dehydrogenase (1.4.1.8 from EC) (ValDH) is an NADP-dependent enzyme that catalyses the reversible deamidation of L-valine into 3-methyl-2-oxobutanoate []. This entry represents the dimerisation region of these enzymes.; GO: 0016491 oxidoreductase activity, 0006520 cellular amino acid metabolic process, 0055114 oxidation-reduction process; PDB: 2BMA_C 1C1D_B 1BXG_A 1BW9_B 1C1X_A 2YFQ_B 3R3J_D 1V9L_C 1B26_C 2TMG_B ....
Probab=34.96  E-value=22  Score=26.03  Aligned_cols=73  Identities=19%  Similarity=0.223  Sum_probs=44.6

Q ss_pred             HHHHHHHHHhhhhccCCCC-------CCCcccccCCChHHHHHHHHHHHHHHHHHHHHHhHhhcCCCCCCccccchhhhc
Q psy8114           8 VLFLMVTLFMKKSLAMPPL-------QCTPGFVDQIPFKIRKICVALSTIYELSNAMESYIDDNGSMDQFVNPEINQLME   80 (111)
Q Consensus         8 v~~~~~~i~~~~A~AapPp-------~C~p~~lDelpPriRKiC~AL~ni~els~Ame~YIddq~~~~~~~~~~~~~l~d   80 (111)
                      |+.++..|..+.|++..|-       .|+|.-++  ++..+++|.      .|.++|+.||-...         +.+-.|
T Consensus        50 v~~LA~~MT~K~Al~~lp~GGaKggI~~dp~~~s--~~e~e~l~r------~f~~~l~~~i~~~~---------~i~a~D  112 (131)
T PF02812_consen   50 VLRLARGMTYKCALAGLPFGGAKGGIKIDPKDLS--DNERERLTR------RFGRALSPFIGPGR---------DIPAPD  112 (131)
T ss_dssp             HHHHHHHHHHHHHHTTSS-EEEEEEEESSGGGS---HHHHHHHHH------HHHHHHGGGSBTTT---------EEEEBB
T ss_pred             HHHHHHHHHhhhhhccCCCCceeEEeecCccccc--HHHHHHHHH------HHHHHHHHHhccCc---------EEECCc
Confidence            5666777777888877765       56666555  566777777      45556666554431         222334


Q ss_pred             CCCcccccceeeeeccc
Q psy8114          81 NGVKRQDMDHVFLRYGK   97 (111)
Q Consensus        81 ~~~KRQDVDHVFLRFGR   97 (111)
                      =|+-=+|+++++-+|.+
T Consensus       113 vgt~~~dm~~i~~~~~~  129 (131)
T PF02812_consen  113 VGTGERDMAWIADEYRR  129 (131)
T ss_dssp             TTBSHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHhchh
Confidence            45666777777766654


No 20 
>COG4698 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.48  E-value=24  Score=28.51  Aligned_cols=63  Identities=24%  Similarity=0.287  Sum_probs=41.0

Q ss_pred             chhHHHHHHHHHHHHhhhhccCCCCCCCcccccCCChHHHHHHHHHHHHHHHHHHHHHhHhhc
Q psy8114           2 KWLQPLVLFLMVTLFMKKSLAMPPLQCTPGFVDQIPFKIRKICVALSTIYELSNAMESYIDDN   64 (111)
Q Consensus         2 ~~~~~~v~~~~~~i~~~~A~AapPp~C~p~~lDelpPriRKiC~AL~ni~els~Ame~YIddq   64 (111)
                      ||+.=..|++-.+++..-+.-...|+=.|.-+.+.++.--|.-+.-.+=.||.+-||+||+|.
T Consensus        12 Kw~f~iLLAln~l~~~~i~~~vlsp~ee~t~~~~a~~~~~~~fqitttr~~LN~li~syl~~~   74 (197)
T COG4698          12 KWLFFILLALNTLLAVLIALFVLSPREEPTHLEDASEKSEKSFQITTTRSQLNELINSYLEDY   74 (197)
T ss_pred             HHHHHHHHHHHHHHHHHhheeeccCCCCCchhhccCcccceeEEEEccHHHHHHHHHHHHHHh
Confidence            677665555555555555555556666666666666644445555566678888899999984


No 21 
>PLN00035 histone H4; Provisional
Probab=34.15  E-value=15  Score=26.60  Aligned_cols=45  Identities=18%  Similarity=0.245  Sum_probs=29.7

Q ss_pred             HHHHHHHHHhHhhcCCCCCCccccchhhhc----CCCcccccceeeeeccccCCCCc
Q psy8114          51 YELSNAMESYIDDNGSMDQFVNPEINQLME----NGVKRQDMDHVFLRYGKITSDGW  103 (111)
Q Consensus        51 ~els~Ame~YIddq~~~~~~~~~~~~~l~d----~~~KRQDVDHVFLRFGR~~~~~~  103 (111)
                      .++..+++.|+++=.       ++...+-+    ..+|=+||.+..-|+|| +.-|+
T Consensus        53 ~elr~vle~~l~~I~-------~dav~ya~HA~RKTV~~~DV~~Alkr~g~-~lyGf  101 (103)
T PLN00035         53 EETRGVLKIFLENVI-------RDAVTYTEHARRKTVTAMDVVYALKRQGR-TLYGF  101 (103)
T ss_pred             HHHHHHHHHHHHHHH-------HHHHHHHHhcCCCcCcHHHHHHHHHHcCC-cCCCC
Confidence            366677788877632       44444433    34566799999999999 55443


No 22 
>cd07375 Anticodon_Ia_like Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains. This domain is found in a variety of class Ia aminoacyl tRNA synthetases, C-terminal to the catalytic core domain. It recognizes and specifically binds to the anticodon of the tRNA. Aminoacyl tRNA synthetases catalyze the transfer of cognate amino acids to the 3'-end of their tRNAs by specifically recognizing cognate from non-cognate amino acids. Members include valyl-, leucyl-, isoleucyl-, cysteinyl-, arginyl-, and methionyl-tRNA synthethases. This superfamily also includes a domain from MshC, an enzyme in the mycothiol biosynthetic pathway.
Probab=33.04  E-value=30  Score=21.86  Aligned_cols=20  Identities=20%  Similarity=0.584  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHhHhhcC
Q psy8114          46 ALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        46 AL~ni~els~Ame~YIddq~   65 (111)
                      |++.+.+|.++.+.|++...
T Consensus        67 a~~~i~~~~~~~n~y~~~~~   86 (117)
T cd07375          67 AVQELFKFTNELNWYLDELK   86 (117)
T ss_pred             HHHHHHHHHHhccHHHHHhh
Confidence            44556677777777777543


No 23 
>COG2165 PulG Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=31.78  E-value=1.4e+02  Score=19.61  Aligned_cols=29  Identities=24%  Similarity=0.266  Sum_probs=24.2

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHHHhHhhcC
Q psy8114          37 PFKIRKICVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        37 pPriRKiC~AL~ni~els~Ame~YIddq~   65 (111)
                      ..+.++..++......+.+++++|..+..
T Consensus        37 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   65 (149)
T COG2165          37 IDKAKRLEAAQQALRVIRLALEEYRLDGG   65 (149)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence            45666888998989999999999999865


No 24 
>PF11328 DUF3130:  Protein of unknown function (DUF3130;  InterPro: IPR021477  This bacterial family of proteins has no known function. 
Probab=31.22  E-value=61  Score=23.34  Aligned_cols=34  Identities=15%  Similarity=0.114  Sum_probs=20.8

Q ss_pred             CCCCCCcccccCCChHHHHHHHHHHHHHHHHHHHHHh
Q psy8114          24 PPLQCTPGFVDQIPFKIRKICVALSTIYELSNAMESY   60 (111)
Q Consensus        24 pPp~C~p~~lDelpPriRKiC~AL~ni~els~Ame~Y   60 (111)
                      +-|.=+.+..-.---.|.++|.||.   +|+.++++|
T Consensus        27 y~plK~gnMaysraNsin~~r~Al~---dLv~~Ve~f   60 (90)
T PF11328_consen   27 YLPLKNGNMAYSRANSINQLRTALI---DLVDVVENF   60 (90)
T ss_pred             cccccCCCeehhhhhhHHHHHHHHH---HHHHHHHHH
Confidence            3344444433222237889999998   666677766


No 25 
>cd07356 HN_L-whirlin_R1_like First harmonin_N_like domain (repeat 1) of the long isoform of whirlin, and related domains. This subgroup contains the first of two harmonin_N_like domains of the long isoform of whirlin, and related domains. Whirlin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds various components of the Usher protein network of the inner ear and the retina: erythrocyte protein p55, usherin, VlGR1, and myosin XVa. The long isoform of whirlin contains two harmonin_N_like domains, and three PDZ protein-binding domains, PDZ1-3. This first harmonin_N_like domain precedes PDZ1, and is a putative protein-binding module based on its sequence similarity to the N-terminal domain of harmonin. This first harmonin_N_like domain has been assayed for interaction with the cytoplasmic domain of cadherin 23 (a component of the Usher network and an interacting partner of the harmonin N-domain), however no interaction could be detected. Th
Probab=31.19  E-value=40  Score=23.79  Aligned_cols=48  Identities=19%  Similarity=0.370  Sum_probs=33.0

Q ss_pred             ChHHHHHHHHHHHH------HHHHHHHHHhHhhcCCCCCCccccchhhhcCCCccc
Q psy8114          37 PFKIRKICVALSTI------YELSNAMESYIDDNGSMDQFVNPEINQLMENGVKRQ   86 (111)
Q Consensus        37 pPriRKiC~AL~ni------~els~Ame~YIddq~~~~~~~~~~~~~l~d~~~KRQ   86 (111)
                      +--+|++=.+|..+      .+|.-++|.|=.+..-|+  +++....++|+..|||
T Consensus         2 s~nVr~lh~~l~~lLs~~Er~~f~h~Ln~Y~~~RnV~~--Lv~sL~~vLd~P~Krq   55 (78)
T cd07356           2 SANVRRLHNALTKLLSEAEREEFIHCLNDYHAKRNVYD--LVQSLKVVLDTPEKRQ   55 (78)
T ss_pred             chhHHHHHHHHHHHccHHHHHHHHHHHHHHHhcccHHH--HHHHHHHHhCCHhHhH
Confidence            44567777777655      356667777766654222  5688888899999998


No 26 
>KOG2046|consensus
Probab=31.17  E-value=31  Score=27.59  Aligned_cols=36  Identities=19%  Similarity=0.222  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHh-HhhcCCCCCCccccchhhhcCCCccc
Q psy8114          45 VALSTIYELSNAMESY-IDDNGSMDQFVNPEINQLMENGVKRQ   86 (111)
Q Consensus        45 ~AL~ni~els~Ame~Y-Iddq~~~~~~~~~~~~~l~d~~~KRQ   86 (111)
                      .-+|||.+|..|++.| +.+..      +=.+.+|.++..+.|
T Consensus        81 ~qmEnIs~Fi~a~~~ygv~~~d------~FqtvDLfE~kd~~~  117 (193)
T KOG2046|consen   81 VQMENISNFIKAAKKYGVPEVD------LFQTVDLFEGKDMAQ  117 (193)
T ss_pred             HHHHHHHHHHHHHHhcCCChhh------cccccccccCCCHHH
Confidence            4479999999999999 55543      344556666555444


No 27 
>cd07996 WGR_MMR_like WGR domain of molybdate metabolism regulator and related proteins. The WGR domain is found in the putative Escherichia coli molybdate metabolism regulator and related bacterial proteins, as well as in various other bacterial proteins of unknown function. It has been called WGR after the most conserved central motif of the domain. The domain appears to occur in single-domain proteins and in a variety of domain architectures, together with ATP-dependent DNA ligase domains, WD40 repeats, leucine-rich repeats, and other domains. It has been proposed to function as a nucleic acid binding domain.
Probab=31.01  E-value=33  Score=21.72  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=13.2

Q ss_pred             ceeeeeccccCCCCcc
Q psy8114          89 DHVFLRYGKITSDGWV  104 (111)
Q Consensus        89 DHVFLRFGR~~~~~~~  104 (111)
                      -+|+-++||.|+-|=.
T Consensus        29 ~~v~~~wGRiG~~Gq~   44 (74)
T cd07996          29 WSLVRRWGRIGTKGQS   44 (74)
T ss_pred             EEEEEEECCCCCCCce
Confidence            4789999999987744


No 28 
>PF13670 PepSY_2:  Peptidase propeptide and YPEB domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. 
Probab=28.90  E-value=98  Score=20.05  Aligned_cols=27  Identities=19%  Similarity=0.160  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhhhhccCCCCCCCcccccCC
Q psy8114           8 VLFLMVTLFMKKSLAMPPLQCTPGFVDQI   36 (111)
Q Consensus         8 v~~~~~~i~~~~A~AapPp~C~p~~lDel   36 (111)
                      .++++++++++.|.|  ++.|...--+++
T Consensus         3 ~~~~a~~~~a~~A~A--~~~~~~p~~~~~   29 (83)
T PF13670_consen    3 ALALAAALLAAPAFA--SDDSDAPPADWL   29 (83)
T ss_pred             HHHHHHHHHhHHhcC--CCCCCCCccccC
Confidence            455666666666666  445554444444


No 29 
>COG4574 Eco Serine protease inhibitor ecotin [General function prediction only]
Probab=28.54  E-value=50  Score=25.92  Aligned_cols=20  Identities=30%  Similarity=0.285  Sum_probs=15.1

Q ss_pred             CchhHHHHHHHHHHHHhhhh
Q psy8114           1 MKWLQPLVLFLMVTLFMKKS   20 (111)
Q Consensus         1 ~~~~~~~v~~~~~~i~~~~A   20 (111)
                      ||.|+|+|||.+.+-.++.+
T Consensus         1 ~~~~~~avl~Aa~~~A~a~~   20 (162)
T COG4574           1 MKTILPAVLFAAFATASAWA   20 (162)
T ss_pred             CchhHHHHHHHHHHHHhHhh
Confidence            78899999988776555544


No 30 
>COG2317 Zn-dependent carboxypeptidase [Amino acid transport and metabolism]
Probab=27.66  E-value=29  Score=31.44  Aligned_cols=47  Identities=26%  Similarity=0.327  Sum_probs=37.7

Q ss_pred             HHHHHHHHHHHHHHHHHhHhhcCCCCCCccccchhhhcCCCcccccceeee
Q psy8114          43 ICVALSTIYELSNAMESYIDDNGSMDQFVNPEINQLMENGVKRQDMDHVFL   93 (111)
Q Consensus        43 iC~AL~ni~els~Ame~YIddq~~~~~~~~~~~~~l~d~~~KRQDVDHVFL   93 (111)
                      +--.|+.|-+|++..-.|...+.+    .|--..+++|+|+.=+|||.||-
T Consensus       128 F~p~Lekiv~l~re~A~~~~~~~~----pYdaLld~yEpG~t~~~i~~vF~  174 (497)
T COG2317         128 FKPYLEKIVELKREFAEYRGYEEH----PYDALLDLYEPGLTVRDVDRVFA  174 (497)
T ss_pred             hhHHHHHHHHHHHHHHHhcccccC----cHHHHHHhhcCCCcHHHHHHHHH
Confidence            445688888999998899988763    24555677889999999999995


No 31 
>COG3090 DctM TRAP-type C4-dicarboxylate transport system, small permease component [Carbohydrate transport and metabolism]
Probab=27.21  E-value=83  Score=23.70  Aligned_cols=26  Identities=19%  Similarity=0.235  Sum_probs=21.2

Q ss_pred             CCCcccccCCChHHHHHHHHHHHHHH
Q psy8114          27 QCTPGFVDQIPFKIRKICVALSTIYE   52 (111)
Q Consensus        27 ~C~p~~lDelpPriRKiC~AL~ni~e   52 (111)
                      .+-.-+.+-+||+.||+|..+..+-=
T Consensus        74 i~vd~l~~~lp~~~r~~l~~~~~~l~   99 (177)
T COG3090          74 IGVDVLVNLLPPRARKILRIIADLLI   99 (177)
T ss_pred             eeehHHHHhCCHHHHHHHHHHHHHHH
Confidence            66677888999999999998876543


No 32 
>cd07355 HN_L-delphilin-R2_like Second harmonin_N_like domain (repeat 2) of L-delphilin, and related domains. This subgroup contains the second of two harmonin_N_like domains of an alternatively spliced longer variant of mouse delphilin (L-delphilin), and related domains. Delphilin is a postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold protein which binds the glutamate receptor delta-2 (GRID2) subunit and the monocarboxylate transporter 2 at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain in L-delphilin follows the second PDZ protein-binding domain, PDZ2; it is also found in the shorter C-terminal isoforms (S-delphilin/delphilin alpha and delphilin beta). It is a putative protein-binding module based on its sequence similarity to the harmonin N-domain. The first harmonin_N_like domain of L-delphilin belongs to a different subgroup and is missing from S-delphilin.
Probab=26.76  E-value=46  Score=23.56  Aligned_cols=38  Identities=13%  Similarity=0.259  Sum_probs=22.8

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHHHhHhhcCCCCCCccccchhhhcCCCccc
Q psy8114          37 PFKIRKICVALSTIYELSNAMESYIDDNGSMDQFVNPEINQLMENGVKRQ   86 (111)
Q Consensus        37 pPriRKiC~AL~ni~els~Ame~YIddq~~~~~~~~~~~~~l~d~~~KRQ   86 (111)
                      |+.=.-+|+||++..+ -+.++.           ++.+.-+++|+..|||
T Consensus        18 ~~ER~~i~qaL~~y~~-~Rnvd~-----------Li~~v~pVLDtPaK~~   55 (80)
T cd07355          18 PPERYGIKKALEDYFQ-HRNIDT-----------LIVDVYPVLDTPAKQV   55 (80)
T ss_pred             HHHHHHHHHHHHHHHH-hccHHH-----------HHhhhhhhcCCHHHHH
Confidence            4444557777765555 232222           4556667888888886


No 33 
>PF15172 Prolactin_RP:  Prolactin-releasing peptide
Probab=26.36  E-value=23  Score=22.87  Aligned_cols=9  Identities=22%  Similarity=0.479  Sum_probs=7.2

Q ss_pred             eeccccCCC
Q psy8114          93 LRYGKITSD  101 (111)
Q Consensus        93 LRFGR~~~~  101 (111)
                      -|||||.+.
T Consensus        29 GRFGrR~aa   37 (47)
T PF15172_consen   29 GRFGRRRAA   37 (47)
T ss_pred             ccccchhcc
Confidence            489999873


No 34 
>PRK11443 lipoprotein; Provisional
Probab=25.92  E-value=69  Score=23.51  Aligned_cols=18  Identities=11%  Similarity=-0.081  Sum_probs=10.5

Q ss_pred             HHhhhhcc--CCCCCCCccc
Q psy8114          15 LFMKKSLA--MPPLQCTPGF   32 (111)
Q Consensus        15 i~~~~A~A--apPp~C~p~~   32 (111)
                      ++++=|.+  .+|+.|+.+.
T Consensus        12 lLsgCa~~~~~~~~~~~~~d   31 (124)
T PRK11443         12 LLSGCQIDPYTHAPTLTSTD   31 (124)
T ss_pred             HHHhccCCCCCChhhhcccC
Confidence            44444443  3677888765


No 35 
>TIGR01796 CM_mono_aroH monofunctional chorismate mutase, gram positive type, clade 1. This model represents a family of monofunctional (non-fused) chorismate mutases from gram positive bacteria (Firmicutes) and cyanobacteria. Trusted members of the family are found in operons with other enzymes of the chorismate pathways, both up- and downstream of CM (Listeria, Bacillus, Oceanobacillus) or are the sole CM in the genome where the other members of the chorismate pathways are found elsewhere in the genome (Nostoc, Thermosynechococcus).
Probab=25.70  E-value=30  Score=25.77  Aligned_cols=16  Identities=38%  Similarity=0.725  Sum_probs=13.1

Q ss_pred             hcCCCcccccceeeee
Q psy8114          79 MENGVKRQDMDHVFLR   94 (111)
Q Consensus        79 ~d~~~KRQDVDHVFLR   94 (111)
                      +++..+++++-|||||
T Consensus        93 v~t~~~~~~i~HvYL~  108 (117)
T TIGR01796        93 IESEKPRTGIHHVYLR  108 (117)
T ss_pred             EecCCCCCCccccccc
Confidence            4466688999999997


No 36 
>PF06840 DUF1241:  Protein of unknown function (DUF1241);  InterPro: IPR009652 This family consists of several programmed cell death 10 protein (PDCD10 or TFAR15) sequences. The function of this family is unknown.; PDB: 3L8I_A 3RQG_B 3RQE_B 3L8J_A 3RQF_B 3AJM_B.
Probab=25.61  E-value=74  Score=24.54  Aligned_cols=20  Identities=30%  Similarity=0.433  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHhHhhc
Q psy8114          45 VALSTIYELSNAMESYIDDN   64 (111)
Q Consensus        45 ~AL~ni~els~Ame~YIddq   64 (111)
                      ..|++|-++++|++..+|+-
T Consensus       117 ~FL~tIK~IAsaIK~lLdAv  136 (154)
T PF06840_consen  117 TFLETIKEIASAIKKLLDAV  136 (154)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            37889999999999999984


No 37 
>PF03800 Nuf2:  Nuf2 family;  InterPro: IPR005549 Members of this family are components of the mitotic spindle. It has been shown that Nuf2 from yeast is part of a complex called the Ndc80p complex []. This complex is thought to bind to the microtubules of the spindle. An arabidopsis protein has been included in this family that has previously not been identified as a member of this family, Q9C953 from SWISSPROT. The match is not strong, but in common with other members of this family contains coiled-coil to the C terminus of this region.; GO: 0007067 mitosis, 0000775 chromosome, centromeric region; PDB: 2VE7_D 3IZ0_D.
Probab=24.88  E-value=1.1e+02  Score=21.78  Aligned_cols=27  Identities=19%  Similarity=0.262  Sum_probs=21.5

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHHHhHhh
Q psy8114          37 PFKIRKICVALSTIYELSNAMESYIDD   63 (111)
Q Consensus        37 pPriRKiC~AL~ni~els~Ame~YIdd   63 (111)
                      |.|.|++-+||-|+..|-+.-...+++
T Consensus       112 ~~R~~~~LSalINF~~Fre~~~~~~~~  138 (146)
T PF03800_consen  112 PKRTRRILSALINFARFREERMDEYEE  138 (146)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            789999999999999986665544444


No 38 
>PF08479 POTRA_2:  POTRA domain, ShlB-type;  InterPro: IPR013686 The POTRA domain (for polypeptide-transport-associated domain) is found towards the N terminus of ShlB family proteins (IPR005565 from INTERPRO). ShlB is important in the secretion and activation of the haemolysin ShlA. It has been postulated that the POTRA domain has a chaperone-like function over ShlA; it may fold back into the C-terminal beta-barrel channel []. ; PDB: 2X8X_X 2QDZ_A 3NJT_A 3MC8_A 3MC9_B.
Probab=24.35  E-value=51  Score=20.95  Aligned_cols=22  Identities=27%  Similarity=0.788  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHhHhhcC
Q psy8114          44 CVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        44 C~AL~ni~els~Ame~YIddq~   65 (111)
                      |..++.+.++.++++.|..+++
T Consensus        30 ~l~~~~l~~~~~~l~~~y~~~G   51 (76)
T PF08479_consen   30 CLTLADLQQLADALTNYYREKG   51 (76)
T ss_dssp             BB-HHHHHHHHHHHHHHHHHTT
T ss_pred             CcCHHHHHHHHHHHHHHHHHcC
Confidence            8889999999999999888886


No 39 
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=24.07  E-value=95  Score=21.88  Aligned_cols=13  Identities=46%  Similarity=0.659  Sum_probs=7.4

Q ss_pred             CchhHHHHHHHHH
Q psy8114           1 MKWLQPLVLFLMV   13 (111)
Q Consensus         1 ~~~~~~~v~~~~~   13 (111)
                      |||+.=++++++.
T Consensus         1 m~~~~~vll~ll~   13 (105)
T PRK00888          1 MRLLTLLLLALLV   13 (105)
T ss_pred             CcHHHHHHHHHHH
Confidence            7887654444443


No 40 
>cd07957 Anticodon_Ia_Met Anticodon-binding domain of methionyl tRNA synthetases. This domain is found in methionyl tRNA synthetases (MetRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon (CAU). MetRS catalyzes the transfer of methionine to the 3'-end of its tRNA.
Probab=23.93  E-value=89  Score=20.39  Aligned_cols=23  Identities=39%  Similarity=0.562  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHhHhhcCC
Q psy8114          44 CVALSTIYELSNAMESYIDDNGS   66 (111)
Q Consensus        44 C~AL~ni~els~Ame~YIddq~~   66 (111)
                      -.|++.+.+|.+..+.|+++..+
T Consensus        62 ~~a~~~~~~~~~~~n~y~~~~kp   84 (129)
T cd07957          62 RKALEEIMELARAANKYIDETAP   84 (129)
T ss_pred             HHHHHHHHHHHHHHHhhhccCCC
Confidence            34555556677777777776543


No 41 
>PRK13733 conjugal transfer protein TraV; Provisional
Probab=23.82  E-value=1.2e+02  Score=24.02  Aligned_cols=57  Identities=19%  Similarity=0.276  Sum_probs=40.2

Q ss_pred             CchhHHHHHHHHHHHHhhhhccCCCCCCCcccccCCChHHHHHHHHHHHHHHHHHHHHHhHhhcC
Q psy8114           1 MKWLQPLVLFLMVTLFMKKSLAMPPLQCTPGFVDQIPFKIRKICVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus         1 ~~~~~~~v~~~~~~i~~~~A~AapPp~C~p~~lDelpPriRKiC~AL~ni~els~Ame~YIddq~   65 (111)
                      ||-+..|.+++...++++-|....--.|+..--|        =|.+++.-+++++..|+--+.+.
T Consensus         1 MK~~~~li~l~~~LlL~GCAg~~s~f~C~~t~sd--------qclsme~A~~~a~~g~~~~~~kp   57 (171)
T PRK13733          1 MKQISLLIPLLGTLLLSGCAGTNSEFECNATTSD--------TCMTMEQANEKAKKLEQSSDAKP   57 (171)
T ss_pred             CchhhHHHHHHHHHHhccccCCCCCCCCCCCCCc--------ceeeHHHHHHHHHhcccccccCc
Confidence            6766776666666667776664222379955555        49999999999988877766654


No 42 
>cd02185 AroH Chorismate mutase (AroH) is one of at least five chorismate-utilizing enzymes present in microorganisms that catalyze the rearrangement of chorismate to prephenic acid, the first committed step in the biosynthesis of aromatic amino acids. In prokaryotes, chorismate mutase may be fused to prephenate dehydratase, prephenate dehydrogenase, or 3-deoxy-D-arabino-heptulosonat-7-phosphate (DAHP) as part of a bifunctional enzyme.  The AroH domain forms a homotrimer with three-fold symmetry.
Probab=23.30  E-value=35  Score=25.38  Aligned_cols=16  Identities=25%  Similarity=0.592  Sum_probs=12.7

Q ss_pred             hcCCCcccccceeeee
Q psy8114          79 MENGVKRQDMDHVFLR   94 (111)
Q Consensus        79 ~d~~~KRQDVDHVFLR   94 (111)
                      +++..+++++-|||||
T Consensus        93 v~t~~~q~~i~HVYL~  108 (117)
T cd02185          93 VNTDKAQQEIKHVYLG  108 (117)
T ss_pred             EecCCCCCCccCcccc
Confidence            3466678899999997


No 43 
>PF01798 Nop:  Putative snoRNA binding domain;  InterPro: IPR002687 This domain is present in various pre-mRNA processing ribonucleoproteins. The function of the domain is unknown however it may be a common RNA or snoRNA or Nop1p binding domain. Proteins have been implicated in an expanding variety of functions during pre-mRNA splicing. Molecular cloning has identified genes encoding spliceosomal proteins that potentially act as novel RNA helicases, GTPases, or protein isomerases. Novel protein-protein and protein-RNA interactions that are required for functional spliceosome formation have also been described. Finally, growing evidence suggests that proteins may contribute directly to the spliceosome's active sites [].; PDB: 3GQX_B 3GQU_A 3NVM_A 3NMU_B 2NNW_C 3NVI_A 3NVK_A 2OZB_E 3SIU_B 3SIV_H ....
Probab=23.27  E-value=1.3e+02  Score=22.59  Aligned_cols=25  Identities=20%  Similarity=0.425  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhHhhc
Q psy8114          40 IRKICVALSTIYELSNAMESYIDDN   64 (111)
Q Consensus        40 iRKiC~AL~ni~els~Ame~YIddq   64 (111)
                      +.++|.-+...+++-+.|.+||+++
T Consensus         2 I~~~~~~~~~L~~~r~~l~~yi~~r   26 (150)
T PF01798_consen    2 ILSACDEVISLSEYRKELLEYIESR   26 (150)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6789999999999999999999997


No 44 
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism]
Probab=22.85  E-value=34  Score=29.38  Aligned_cols=16  Identities=31%  Similarity=0.659  Sum_probs=13.0

Q ss_pred             ccccceeeeeccccCC
Q psy8114          85 RQDMDHVFLRYGKITS  100 (111)
Q Consensus        85 RQDVDHVFLRFGR~~~  100 (111)
                      =+|||-||+-||+..-
T Consensus       232 LTdVd~Vy~n~gkp~q  247 (312)
T COG0549         232 LTDVDAVYVNFGKPNQ  247 (312)
T ss_pred             EeccchheecCCCccc
Confidence            4789999999998763


No 45 
>cd07997 WGR_PARP WGR domain of poly(ADP-ribose) polymerases. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins and histones. Higher eukaryotes contain several PARPs and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. Poly-ADP-ribosylation was thought to be a reversible post-translational covalent modification that serves as a regulator
Probab=22.77  E-value=52  Score=22.57  Aligned_cols=14  Identities=29%  Similarity=0.726  Sum_probs=12.2

Q ss_pred             ceeeeeccccCCCC
Q psy8114          89 DHVFLRYGKITSDG  102 (111)
Q Consensus        89 DHVFLRFGR~~~~~  102 (111)
                      =+||.|.||.|..|
T Consensus        40 y~v~~~WGRVG~~G   53 (102)
T cd07997          40 YALFTRWGRVGERG   53 (102)
T ss_pred             EEEEEEEccCCCcC
Confidence            57999999999866


No 46 
>PF07327 Neuroparsin:  Neuroparsin;  InterPro: IPR010850 This family consists of several locust specific neuroparsin proteins. Neuroparsins are produced by the A1 type of protocerebral median neurosecretory cells of the PI-CC system and display pleiotropic activities: inhibition of the effect of juvenile hormone, stimulation of fluid reabsorption of isolated recta, induction of an increase in hemolymph lipid and trehalose levels, and neurotrophic effects [].
Probab=22.71  E-value=84  Score=23.20  Aligned_cols=21  Identities=33%  Similarity=0.502  Sum_probs=14.4

Q ss_pred             hHHHHHHHHHHHHhhhhccCCC
Q psy8114           4 LQPLVLFLMVTLFMKKSLAMPP   25 (111)
Q Consensus         4 ~~~~v~~~~~~i~~~~A~AapP   25 (111)
                      |.-++|+.+|++| ..+.++|+
T Consensus         7 l~aatLl~~V~Lf-~~~~~~p~   27 (103)
T PF07327_consen    7 LAAATLLIAVILF-HRAEANPI   27 (103)
T ss_pred             HHHHHHHHHHHHH-hccccCCc
Confidence            5567788888888 56666553


No 47 
>cd00385 Isoprenoid_Biosyn_C1 Isoprenoid Biosynthesis enzymes, Class 1. Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, and diterpenes; and are widely distributed among archaea, bacteria, and eukaryota.The enzymes in this superfamily share the same 'isoprenoid synthase fold' and include several subgroups. The head-to-tail (HT) IPPS catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. Cyclic monoter
Probab=22.44  E-value=1.2e+02  Score=20.81  Aligned_cols=32  Identities=25%  Similarity=0.386  Sum_probs=28.2

Q ss_pred             cCCChHHHHHHHHHHHHHHHHHHHHHhHhhcC
Q psy8114          34 DQIPFKIRKICVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        34 DelpPriRKiC~AL~ni~els~Ame~YIddq~   65 (111)
                      .+..+.+++++..+..+.|+.|.+.+|-.+..
T Consensus       139 ~~~~~~~~~~~~~~g~~~ql~nDl~~~~~e~~  170 (243)
T cd00385         139 AELLEALRKLGRALGLAFQLTNDLLDYEGDAE  170 (243)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccCCHH
Confidence            34588999999999999999999999988864


No 48 
>cd07962 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA synthetases. This domain is found in valyl tRNA synthetases (ValRS), which belong to the class Ia aminoacyl tRNA synthetases. It lies C-terminal to the catalytic core domain, and recognizes and specifically binds to the tRNA anticodon. ValRS catalyzes the transfer of valine to the 3'-end of its tRNA.
Probab=22.41  E-value=79  Score=21.70  Aligned_cols=24  Identities=17%  Similarity=0.171  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHH--HHHHhHhhcCCC
Q psy8114          44 CVALSTIYELSN--AMESYIDDNGSM   67 (111)
Q Consensus        44 C~AL~ni~els~--Ame~YIddq~~~   67 (111)
                      =.|++.+.++++  +.|.|++...+|
T Consensus        68 ~~al~~i~~~~~~~~~N~Yi~~~~pW   93 (135)
T cd07962          68 SEAATALYEFFWNDFCDWYLELVKPR   93 (135)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHhhHH
Confidence            346677778876  688888887754


No 49 
>PF06287 DUF1039:  Protein of unknown function (DUF1039);  InterPro: IPR010437  This family describes a small protein, always smaller than 100 amino acids, encoded in pathogenicity islands for bacterial type III secretion systems in various strains of Yersinia, Salmonella, and enteropathogenic Escherichia coli, as well as Chromobacterium violaceum and Citrobacter rodentium. Although strictly associated with type III secretion systems, this protein seems not yet to have been characterised as part of the apparatus or as an effector protein.
Probab=22.30  E-value=68  Score=21.72  Aligned_cols=19  Identities=26%  Similarity=0.436  Sum_probs=14.8

Q ss_pred             cccccCCChHHHHHHHHHHHH
Q psy8114          30 PGFVDQIPFKIRKICVALSTI   50 (111)
Q Consensus        30 p~~lDelpPriRKiC~AL~ni   50 (111)
                      |.+++  ++..|.+|.|+--|
T Consensus        20 P~Li~--D~~~r~~c~alllf   38 (66)
T PF06287_consen   20 PQLIP--DEEDRAVCEALLLF   38 (66)
T ss_pred             hhhcC--CHhHHHHHHHHHHH
Confidence            55667  89999999997643


No 50 
>PRK12871 ubiA prenyltransferase; Reviewed
Probab=21.96  E-value=1e+02  Score=25.14  Aligned_cols=43  Identities=19%  Similarity=0.378  Sum_probs=26.6

Q ss_pred             HHHHHHHHHHhHhhcCCCCCCccccchhhhcCCCcccccceeeee-----ccccCCCCcccccccc
Q psy8114          50 IYELSNAMESYIDDNGSMDQFVNPEINQLMENGVKRQDMDHVFLR-----YGKITSDGWVSPVHVY  110 (111)
Q Consensus        50 i~els~Ame~YIddq~~~~~~~~~~~~~l~d~~~KRQDVDHVFLR-----FGR~~~~~~~~~~~~~  110 (111)
                      ..+-++++|+|.|-+-                  .++||..-.-|     =.|...+|++||-+++
T Consensus        53 ~~~ag~~iND~~D~~~------------------D~~~v~rtm~r~~~P~~~Rpl~sG~is~~~a~  100 (297)
T PRK12871         53 GFEAGFVLNDYVDRKR------------------DRLDVENTLTRYWRPFKERPIPSGKLSSKNAF  100 (297)
T ss_pred             HHHHHHHHhhHHHHhc------------------CcchHhhhhhccccCCCCCccCCCCcCHHHHH
Confidence            3477889999999873                  11222222222     2377789999987653


No 51 
>PF13080 DUF3926:  Protein of unknown function (DUF3926)
Probab=21.85  E-value=1.3e+02  Score=19.14  Aligned_cols=32  Identities=16%  Similarity=0.413  Sum_probs=24.0

Q ss_pred             cccCCChHHHHHHHHHHHHHHHHHHHHHhHhhcC
Q psy8114          32 FVDQIPFKIRKICVALSTIYELSNAMESYIDDNG   65 (111)
Q Consensus        32 ~lDelpPriRKiC~AL~ni~els~Ame~YIddq~   65 (111)
                      +++|||.-++.-..-.-||.|  +.+-+|+..+.
T Consensus         3 IleELP~PiqQsAkqmlnILQ--EELssy~~E~~   34 (44)
T PF13080_consen    3 ILEELPTPIQQSAKQMLNILQ--EELSSYPQEQP   34 (44)
T ss_pred             hHhhcCchHHHHHHHHHHHHH--HHHHhchhhcc
Confidence            578899877776666666665  57888998875


No 52 
>cd08003 WGR_PARP2_like WGR domain of poly(ADP-ribose) polymerases. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins. Higher eukaryotes contain several PARPs and and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. This subfamily is composed of human PARP-2 and similar proteins. Similar to PARP-1, PARP-2 is ubiquitously expressed and it
Probab=21.32  E-value=54  Score=23.15  Aligned_cols=25  Identities=28%  Similarity=0.676  Sum_probs=16.7

Q ss_pred             hhhhcCCCcccccceeeeeccccCCCC
Q psy8114          76 NQLMENGVKRQDMDHVFLRYGKITSDG  102 (111)
Q Consensus        76 ~~l~d~~~KRQDVDHVFLRFGR~~~~~  102 (111)
                      .||+++..  -.-=+||.|.||.|..|
T Consensus        29 lQlle~~~--~~~y~~~~rWGRVG~~G   53 (103)
T cd08003          29 IQLLEDDA--EKIYSVWFRWGRVGKKG   53 (103)
T ss_pred             EEEEEeCC--CCeEEEEEeEccccccc
Confidence            34554332  23568999999999765


No 53 
>PF14377 DUF4414:  Domain of unknown function (DUF4414)
Probab=20.99  E-value=38  Score=23.63  Aligned_cols=27  Identities=33%  Similarity=0.484  Sum_probs=20.8

Q ss_pred             cCCCCCCCcccccCCChHHHHHHHHHH
Q psy8114          22 AMPPLQCTPGFVDQIPFKIRKICVALS   48 (111)
Q Consensus        22 AapPp~C~p~~lDelpPriRKiC~AL~   48 (111)
                      ...++...|.||+.||+.+|.=-.+-+
T Consensus        39 ~~~~~~I~pefL~ALP~diR~EVl~qe   65 (108)
T PF14377_consen   39 APQPSQIDPEFLAALPPDIREEVLAQE   65 (108)
T ss_pred             CCCccccCHHHHHhCCHHHHHHHHHHH
Confidence            445678999999999999997544444


No 54 
>PF08334 T2SG:  Type II secretion system (T2SS), protein G;  InterPro: IPR013545 The general secretion pathway, or type II pullulanase-like machinery, is responsible for the transport of proteins from the periplasm across the outer membrane in Gram-negative bacteria [, ]. This entry includes protein G (e.g. P45773 from SWISSPROT, Q00514 from SWISSPROT) involved in this pathway. The PulG protein (P15746 from SWISSPROT) is thought to be anchored in the inner membrane with its C terminus directed towards the periplasm []. Together with other members of the secretion machinery, it is thought to assemble into a pilus-like structure that may function as a dynamic mechanism to push secreted proteins out of the cell. The polypeptide is organised into a long N-terminal alpha-helix followed by a loop region that separates it from a C-terminal anti-parallel beta-sheet []. ; PDB: 1T92_A 3G20_B 3GN9_B 2KEP_A 3FU1_B.
Probab=20.47  E-value=2e+02  Score=19.47  Aligned_cols=25  Identities=32%  Similarity=0.403  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhHhhcCC
Q psy8114          42 KICVALSTIYELSNAMESYIDDNGS   66 (111)
Q Consensus        42 KiC~AL~ni~els~Ame~YIddq~~   66 (111)
                      |.-.|.+++..|.+||+.|--|.+.
T Consensus        10 k~~~a~~~l~~i~~Ale~Y~~d~G~   34 (108)
T PF08334_consen   10 KEARAKADLRTIKTALEMYYLDNGR   34 (108)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhCC
Confidence            3445556666888899999999764


No 55 
>PF07736 CM_1:  Chorismate mutase type I;  InterPro: IPR008243 Chorismate mutase (CM; 5.4.99.5 from EC) catalyses the reaction at the branch point of the biosynthetic pathway leading to the three aromatic amino acids, phenylalanine, tryptophan and tyrosine (chorismic acid is the last common intermediate, and CM leads to the L-phenylalanine/L-tyrosine branch). It is part of the shikimate pathway, which is present only in bacteria, fungi and plants.  This entry represents a family of monofunctional (non-fused) chorismate mutases from Gram-positive bacteria (Firmicutes) and cyanobacteria. Trusted members of the family are found in operons with other enzymes of the chorismate pathways, both up- and downstream of CM (Listeria, Bacillus, Oceanobacillus) or are the sole CM in the genome where the other members of the chorismate pathways are found elsewhere in the genome (Nostoc, Thermosynechococcus). They are monofunctional, homotrimeric, nonallosteric enzymes and are not regulated by the end-product aromatic amino acids. The three types of CM are AroQ class, Prokaryotic type (e.g., IPR008239 from INTERPRO amongst others); AroQ class, Eukaryotic type (IPR008238 from INTERPRO); and AroH class. They fall into two structural folds (AroQ class and AroH class) which are completely unrelated []. The two types of the AroQ structural class (the Escherichia coli CM dimer and the yeast CM monomer) can be structurally superimposed, and the topology of the four-helix bundle forming the active site is conserved []. For additional information please see [, , , , , , ].; PDB: 2CHS_K 2CHT_L 1COM_J 1FNJ_A 1FNK_A 1DBF_C 1UI9_A 1ODE_A 1UFY_A 1XHO_C ....
Probab=20.26  E-value=46  Score=24.77  Aligned_cols=16  Identities=25%  Similarity=0.553  Sum_probs=9.4

Q ss_pred             cCCCcccccceeeeec
Q psy8114          80 ENGVKRQDMDHVFLRY   95 (111)
Q Consensus        80 d~~~KRQDVDHVFLRF   95 (111)
                      ++..+++++-|||||=
T Consensus        94 ~t~~~~~ei~HVYL~~  109 (118)
T PF07736_consen   94 NTDKSQSEIKHVYLRG  109 (118)
T ss_dssp             EESS-GGGS--EEEGG
T ss_pred             ecCCCccccccccccc
Confidence            3555666999999973


No 56 
>KOG3574|consensus
Probab=20.20  E-value=26  Score=31.85  Aligned_cols=19  Identities=42%  Similarity=0.997  Sum_probs=14.1

Q ss_pred             cceeee-eccccCCCCcccccc
Q psy8114          88 MDHVFL-RYGKITSDGWVSPVH  108 (111)
Q Consensus        88 VDHVFL-RFGR~~~~~~~~~~~  108 (111)
                      ||.+|- |||||-|  |+-|+.
T Consensus        87 VDs~y~k~~Grrks--Wvvp~q  106 (510)
T KOG3574|consen   87 VDSVYSKRFGRRKS--WVVPCQ  106 (510)
T ss_pred             hHHHHHHhhccccc--eeeehH
Confidence            566664 7999986  888864


No 57 
>PF00616 RasGAP:  GTPase-activator protein for Ras-like GTPase;  InterPro: IPR001936 Ras proteins are membrane-associated molecular switches that bind GTP and GDP and slowly hydrolyze GTP to GDP []. This intrinsic GTPase activity of ras is stimulated by a family of proteins collectively known as 'GAP' or GTPase-activating proteins [, ]. As it is the GTP bound form of ras which is active, these proteins are said to be down-regulators of ras. The Ras GTPase-activating proteins are quite large (from 765 residues for sar1 to 3079 residues for IRA2) but share only a limited (about 250 residues) region of sequence similarity, referred to as the 'catalytic domain' or rasGAP domain. Note: There are distinctly different GAPs for the rap and rho/rac subfamilies of ras-like proteins (reviewed in reference []) that do not share sequence similarity with ras GAPs.; GO: 0005096 GTPase activator activity, 0051056 regulation of small GTPase mediated signal transduction, 0005622 intracellular; PDB: 3BXJ_B 1WQ1_G 1WER_A 1NF1_A 3FAY_A.
Probab=20.14  E-value=1.1e+02  Score=22.04  Aligned_cols=17  Identities=41%  Similarity=0.749  Sum_probs=12.9

Q ss_pred             ccCCChHHHHHHHHHHH
Q psy8114          33 VDQIPFKIRKICVALST   49 (111)
Q Consensus        33 lDelpPriRKiC~AL~n   49 (111)
                      ++.+|+.+|.+|..|.+
T Consensus       117 ~~~~P~~lr~i~~~i~~  133 (197)
T PF00616_consen  117 IDQIPPSLRYICKQIYE  133 (197)
T ss_dssp             GGGS-HHHHHHHHHHHH
T ss_pred             HHHhhHHHHHHHHHHHH
Confidence            56789999999996653


No 58 
>PF06430 L_lactis_RepB_C:  Lactococcus lactis RepB C-terminus;  InterPro: IPR010931 This entry represents the C-terminal region of RepB proteins from Lactococcus lactis (See IPR000525 from INTERPRO).
Probab=20.04  E-value=47  Score=25.14  Aligned_cols=8  Identities=63%  Similarity=0.812  Sum_probs=6.8

Q ss_pred             CCCccccc
Q psy8114          81 NGVKRQDM   88 (111)
Q Consensus        81 ~~~KRQDV   88 (111)
                      +.+||||+
T Consensus       115 ptvk~qdl  122 (122)
T PF06430_consen  115 PTVKRQDL  122 (122)
T ss_pred             HHHHhccC
Confidence            78999985


Done!