Diaphorina citri psyllid: psy8147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MSDILTGVCYVGIWNRQALWDFVIIPLSIYLILGLVFLFTGFISLLRIRTIMKHDGTKTDKLEKLMIRICIFSVLYTVPAVLVIVCYLYEFVYIDYWMLTWHVDMCSGTSSVSSLSKPMTSSYNNIYSIPCPMGDKRRHVGRKPQFQVFMLKYLMTLIVGITSSFWIWSPKTLTSWKEFFYKLKPNSTQPSRNEAYV
ccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccc
*SDILTGVCYVGIWNRQALWDFVIIPLSIYLILGLVFLFTGFISLLRIRTIMKHDGTKTDKLEKLMIRICIFSVLYTVPAVLVIVCYLYEFVYIDYWMLTWHVDMCSGTSSVSSLSKPMTSSYNNIYSIPCPMGDKRRHVGRKPQFQVFMLKYLMTLIVGITSSFWIWSPKTLTSWKEFFYKL**************
xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDILTGVCYVGIWNRQALWDFVIIPLSIYLILGLVFLFTGFISLLRIRTIMKHDGTKTDKLEKLMIRICIFSVLYTVPAVLVIVCYLYEFVYIDYWMLTWHVDMCSGTSSVSSLSKPMTSSYNNIYSIPCPMGDKRRHVGRKPQFQVFMLKYLMTLIVGITSSFWIWSPKTLTSWKEFFYKLKPNSTQPSRNEAYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Frizzled-7 Receptor for Wnt proteins. Acts in both canonical and non-canonical Wnt pathways. Although different papers report differing Wnt preferences, wnt5a, wnt8b and wnt11 have been proposed as synergists. In the canonical Wnt pathway, acts via beta-catenin to promote the expression of the dorsal genes siamois, twin and nodal3 and to establish the dorsal axis of the embryo and induce dorsal mesoderm formation. In a non-canonical Wnt/planar cell polarity (PCP) pathway, acts with sdc4 and dvl2/dsh to regulate convergent extension movements in gastrulation. Triggers phosphorylation of dvl2/dsh and its translocation to the plasma membrane. In a third branch of Wnt signaling, acts in a non-canonical pathway via trimeric G proteins, and independently of dvl2/dsh, to recruit protein kinase C (PKC) to the membrane and thus activate PKC. PKC signaling controls cell sorting and tissue separation during gastrulation.confidentQ5BL72
Frizzled-1 Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt8 induces expression of beta-catenin target genes.confidentQ08463
Frizzled-1 Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.confidentO57328

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0042813 [MF]Wnt-activated receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0030855 [BP]epithelial cell differentiationprobableGO:0032502, GO:0060429, GO:0048869, GO:0030154, GO:0009888, GO:0044763, GO:0008150, GO:0009987, GO:0044699, GO:0048856
GO:0048569 [BP]post-embryonic organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048568 [BP]embryonic organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035414 [BP]negative regulation of catenin import into nucleusprobableGO:0033157, GO:0060341, GO:0051049, GO:0032386, GO:0032387, GO:0035412, GO:0051223, GO:0051224, GO:0050789, GO:0032880, GO:0065007, GO:0048519, GO:0070201, GO:0051051, GO:0090317, GO:0050794, GO:0008150, GO:0042308, GO:0042306, GO:0032879, GO:1900180, GO:0046822, GO:0046823
GO:0060061 [BP]Spemann organizer formationprobableGO:0032502, GO:0044700, GO:0045165, GO:0031128, GO:0030154, GO:0048869, GO:0048856, GO:0044763, GO:0045168, GO:0044767, GO:0008150, GO:0048646, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0009653, GO:0044699
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0033077 [BP]T cell differentiation in thymusprobableGO:0030154, GO:0042110, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0030217, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0030098, GO:0008150
GO:0035425 [BP]autocrine signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0007267, GO:0044763, GO:0044699
GO:0042060 [BP]wound healingprobableGO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0008595 [BP]anterior/posterior axis specification, embryoprobableGO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0061299 [BP]retina vasculature morphogenesis in camera-type eyeprobableGO:0032502, GO:0048513, GO:0044699, GO:0032501, GO:0007423, GO:0044707, GO:0001654, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0060041, GO:0048731, GO:0009653, GO:0043010, GO:0007275, GO:0061298
GO:0060027 [BP]convergent extension involved in gastrulationprobableGO:0048598, GO:0002009, GO:0060429, GO:0044707, GO:0060026, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0043507 [BP]positive regulation of JUN kinase activityprobableGO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0046328, GO:0043506, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0023051, GO:0060255, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0043410, GO:0042327, GO:0001932, GO:0080134, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0033036 [BP]macromolecule localizationprobableGO:0008150, GO:0051179
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0001568 [BP]blood vessel developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035426 [BP]extracellular matrix-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0060071 [BP]Wnt receptor signaling pathway, planar cell polarity pathwayprobableGO:0022603, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0065007, GO:0050793, GO:0009987, GO:0050794, GO:0044763, GO:0051239, GO:0007154, GO:0035567, GO:0044700, GO:0090175, GO:0050896, GO:0016055, GO:2000026, GO:2000027, GO:0008150
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0044332 [BP]Wnt receptor signaling pathway involved in dorsal/ventral axis specificationprobableGO:0023052, GO:0007165, GO:0007166, GO:0009798, GO:0050789, GO:0044699, GO:0007389, GO:0051716, GO:0007275, GO:0065007, GO:0032502, GO:0032501, GO:0009987, GO:0050794, GO:0008150, GO:0003002, GO:0007154, GO:0044700, GO:0009953, GO:0044707, GO:0009950, GO:0050896, GO:0016055, GO:0044763
GO:0048609 [BP]multicellular organismal reproductive processprobableGO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0048858 [BP]cell projection morphogenesisprobableGO:0032502, GO:0048856, GO:0000902, GO:0030030, GO:0048869, GO:0009987, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699, GO:0032990
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030514 [BP]negative regulation of BMP signaling pathwayprobableGO:0090092, GO:0009968, GO:0090101, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0030510
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0044702 [BP]single organism reproductive processprobableGO:0022414, GO:0008150, GO:0000003, GO:0044699
GO:0071219 [BP]cellular response to molecule of bacterial originprobableGO:0051716, GO:0009987, GO:0009607, GO:0050896, GO:0009617, GO:0044763, GO:0008150, GO:0002237, GO:0042221, GO:0071216, GO:0051707, GO:0010033, GO:0044699, GO:0051704
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0090504 [BP]epibolyprobableGO:0032502, GO:0002009, GO:0048856, GO:0060429, GO:0009888, GO:0002011, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0032729 [BP]positive regulation of interferon-gamma productionprobableGO:0051240, GO:0032649, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789, GO:0001819
GO:0031527 [CC]filopodium membraneprobableGO:0005575, GO:0016020, GO:0044464, GO:0044463, GO:0031253, GO:0005623, GO:0030175, GO:0071944, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0008585 [BP]female gonad developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0008406, GO:0045137, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0046545, GO:0046660, GO:0007275, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045995 [BP]regulation of embryonic developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0060412 [BP]ventricular septum morphogenesisprobableGO:0003281, GO:0072359, GO:0072358, GO:0009653, GO:0007275, GO:0044699, GO:0003205, GO:0003206, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0003007, GO:0008150, GO:0003231, GO:0007507, GO:0003279, GO:0044707, GO:0048856, GO:0044767, GO:0048731, GO:0060411
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0007223 [BP]Wnt receptor signaling pathway, calcium modulating pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0044699, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0035567
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0017147 [MF]Wnt-protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0009791 [BP]post-embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted