Diaphorina citri psyllid: psy8156

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MFLVMLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGGNGPDSLCVGDNEEGGKSSTLSPMIESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCTKPFSPPPEHPHLAMVSTITQGTRQEACTILFMILYFFGMASSIWDVFVMASTTIY
cEEEHHHHHHcccccccccccccccccccCEEccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MFLVMLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGGNGPD**********GKSSTLSPMIESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCT***********LAMVSTITQGTRQEACTILFMILYFFGMASSIWDVFVMASTTIY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLVMLISVSVGDQITHISDHDILPIHAKCETITIPFCQDIAYNETIMPNLLGHSKQEDAGFEVHQYFPLVKVKCSPDLQFFLCSMYAPVCTILERAIPPCRNLCLSARNGCEKLMNDFGFQWPETFECSKFPLPSSGPDSLCVGDNEEGGNGPDSLCVGDNEEGGKSSTLSPMIESNFGKDLRPGVSYPNLPENAKDYGFVCPLHFKIPPGLDYELKVGDKVEKNCGAPCDGMFFSEKEKKMSRLWVGIWSALCATSCLFTVLTFMIDSDRFRYPERPIIFLSVCYLMVSITYIIGFMSGDKISCTKPFSPPPEHPHLAMVSTITQGTRQEACTILFMILYFFGMASSIWDVFVMASTTIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0003674 [MF]molecular_functionprobable
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010604 [BP]positive regulation of macromolecule metabolic processprobableGO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0060027 [BP]convergent extension involved in gastrulationprobableGO:0048598, GO:0002009, GO:0060429, GO:0044707, GO:0060026, GO:0007369, GO:0009888, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699, GO:0048856
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044093 [BP]positive regulation of molecular functionprobableGO:0008150, GO:0065009, GO:0065007
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051179 [BP]localizationprobableGO:0008150
GO:0031325 [BP]positive regulation of cellular metabolic processprobableGO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051090 [BP]regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0007389 [BP]pattern specification processprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0035567 [BP]non-canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IJY, chain A
Confidence level:very confident
Coverage over the Query: 27-148
View the alignment between query and template
View the model in PyMOL