Query         psy8167
Match_columns 167
No_of_seqs    141 out of 1913
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 20:17:14 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8167.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8167hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.2E-24 4.8E-29  151.3   6.6  109   50-161   127-245 (279)
  2 KOG2462|consensus               99.9 2.6E-23 5.6E-28  145.9   5.6  102   51-155   159-267 (279)
  3 KOG1074|consensus               99.7 5.3E-18 1.2E-22  134.0   5.1   55  105-159   607-661 (958)
  4 KOG3576|consensus               99.7 1.9E-17 4.1E-22  111.7   2.9  107   51-160   115-241 (267)
  5 KOG1074|consensus               99.7 6.5E-17 1.4E-21  128.0   6.3   57  105-161   881-937 (958)
  6 KOG3623|consensus               99.6 1.3E-16 2.9E-21  124.7   1.2  102   51-152   208-330 (1007)
  7 KOG3623|consensus               99.6   6E-16 1.3E-20  121.2   4.4   83   48-152   889-971 (1007)
  8 KOG3608|consensus               99.4 4.9E-13 1.1E-17   97.4   6.6   97   58-155   184-316 (467)
  9 KOG3608|consensus               99.4 4.9E-13 1.1E-17   97.4   5.2  100   54-153   264-374 (467)
 10 KOG3576|consensus               99.4 1.3E-13 2.9E-18   93.3   0.7   78   78-155   113-197 (267)
 11 PHA00733 hypothetical protein   99.3 9.5E-12 2.1E-16   80.5   4.9   86   51-156    38-124 (128)
 12 PHA02768 hypothetical protein;  99.2 3.1E-12 6.7E-17   69.2   1.4   42  104-147     6-47  (55)
 13 PLN03086 PRLI-interacting fact  98.9 2.1E-09 4.5E-14   84.5   5.7   97   51-155   451-564 (567)
 14 PF13465 zf-H2C2_2:  Zinc-finge  98.9 5.3E-10 1.1E-14   51.9   1.1   26  118-143     1-26  (26)
 15 PHA02768 hypothetical protein;  98.8 4.4E-09 9.6E-14   57.0   2.3   38   54-94      6-43  (55)
 16 KOG3993|consensus               98.8 1.5E-09 3.3E-14   81.1   0.7   83   52-156   266-381 (500)
 17 PHA00616 hypothetical protein   98.7 8.1E-09 1.8E-13   53.3   2.4   33  104-136     2-34  (44)
 18 PHA00732 hypothetical protein   98.7 7.2E-09 1.6E-13   61.2   2.5   48  103-155     1-48  (79)
 19 PHA00616 hypothetical protein   98.7 5.6E-09 1.2E-13   53.9   1.6   34  131-164     1-34  (44)
 20 PLN03086 PRLI-interacting fact  98.7 5.5E-08 1.2E-12   76.7   7.9   99   52-161   406-506 (567)
 21 PHA00733 hypothetical protein   98.6 8.2E-08 1.8E-12   62.2   5.0   54   51-128    71-124 (128)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.5 7.3E-08 1.6E-12   44.6   1.2   25   68-93      1-25  (26)
 23 PF05605 zf-Di19:  Drought indu  98.4 8.5E-07 1.8E-11   48.7   4.2   51  103-156     2-54  (54)
 24 KOG3993|consensus               98.3 3.1E-07 6.8E-12   69.0   2.5   76   52-128   294-381 (500)
 25 PF05605 zf-Di19:  Drought indu  98.3 1.6E-06 3.5E-11   47.5   4.7   53   53-128     2-54  (54)
 26 PHA00732 hypothetical protein   98.3 7.1E-07 1.5E-11   52.7   2.6   46   53-125     1-46  (79)
 27 PF00096 zf-C2H2:  Zinc finger,  98.2 9.1E-07   2E-11   39.6   2.2   22  104-125     1-22  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  98.1 8.1E-07 1.8E-11   39.8   0.9   23  132-154     1-23  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.0 5.4E-06 1.2E-10   37.2   2.4   22  105-126     2-23  (24)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.0 3.1E-06 6.7E-11   38.1   1.3   24  132-155     1-24  (24)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.9 5.4E-06 1.2E-10   51.2   1.7   49  106-154     2-73  (100)
 32 PF12756 zf-C2H2_2:  C2H2 type   97.9 9.8E-06 2.1E-10   50.0   2.7   72   55-126     1-73  (100)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.9 5.6E-06 1.2E-10   38.5   1.2   23  104-126     2-24  (27)
 34 PF09237 GAGA:  GAGA factor;  I  97.8 6.6E-06 1.4E-10   43.5   1.1   33  128-160    21-53  (54)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.6E-05 3.5E-10   37.0   2.0   26  131-156     1-26  (27)
 36 COG5189 SFP1 Putative transcri  97.6 6.1E-05 1.3E-09   55.1   3.0   69   51-124   347-419 (423)
 37 PF09237 GAGA:  GAGA factor;  I  97.5  0.0001 2.2E-09   39.0   2.7   31  101-131    22-52  (54)
 38 smart00355 ZnF_C2H2 zinc finge  97.5  0.0001 2.2E-09   33.4   2.4   23  132-154     1-23  (26)
 39 COG5189 SFP1 Putative transcri  97.4   5E-05 1.1E-09   55.5   0.3   53  101-153   347-420 (423)
 40 smart00355 ZnF_C2H2 zinc finge  97.3  0.0002 4.4E-09   32.4   2.1   24  104-127     1-24  (26)
 41 PRK04860 hypothetical protein;  97.2 0.00019 4.1E-09   48.3   1.9   38  103-144   119-156 (160)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00036 7.8E-09   31.3   2.1   23  104-127     1-23  (24)
 43 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00014   3E-09   32.7   0.5   24  132-156     1-24  (24)
 44 PF12874 zf-met:  Zinc-finger o  97.1 0.00019   4E-09   32.6   0.8   21  133-153     2-22  (25)
 45 PF12874 zf-met:  Zinc-finger o  96.9  0.0008 1.7E-08   30.4   1.9   23  104-126     1-23  (25)
 46 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00046   1E-08   31.9  -0.0   21  132-152     2-22  (27)
 47 KOG1146|consensus               96.5 0.00073 1.6E-08   58.0   0.2  103   50-153   462-611 (1406)
 48 PRK04860 hypothetical protein;  96.3  0.0021 4.5E-08   43.3   1.4   38   52-94    118-155 (160)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.2  0.0023   5E-08   29.5   0.8   22  104-125     2-23  (27)
 50 COG4049 Uncharacterized protei  95.9  0.0034 7.4E-08   33.9   0.9   29  127-155    13-41  (65)
 51 PF12013 DUF3505:  Protein of u  95.8   0.022 4.9E-07   35.8   4.5   27   52-79     10-36  (109)
 52 PF13913 zf-C2HC_2:  zinc-finge  95.8  0.0083 1.8E-07   27.2   1.7   19  133-152     4-22  (25)
 53 KOG1146|consensus               95.6   0.012 2.7E-07   50.9   3.2   52  102-153   464-540 (1406)
 54 KOG2231|consensus               95.5   0.021 4.4E-07   46.6   4.3  100   54-157   100-238 (669)
 55 smart00451 ZnF_U1 U1-like zinc  95.5    0.01 2.2E-07   29.0   1.5   23  131-153     3-25  (35)
 56 COG4049 Uncharacterized protei  95.2   0.011 2.4E-07   31.9   1.3   32   47-78     11-42  (65)
 57 KOG2893|consensus               94.8  0.0095 2.1E-07   42.2   0.4   32   55-91     12-43  (341)
 58 PF12013 DUF3505:  Protein of u  94.3   0.072 1.6E-06   33.5   3.6   25  132-156    81-109 (109)
 59 smart00451 ZnF_U1 U1-like zinc  94.0   0.055 1.2E-06   26.3   2.0   21   53-73      3-23  (35)
 60 KOG2186|consensus               93.9   0.033 7.1E-07   39.8   1.4   46  104-152     4-49  (276)
 61 cd00350 rubredoxin_like Rubred  93.2   0.065 1.4E-06   25.9   1.5   10  130-139    16-25  (33)
 62 COG5048 FOG: Zn-finger [Genera  93.1   0.016 3.6E-07   44.6  -1.2   59  102-160   288-352 (467)
 63 KOG2482|consensus               93.1    0.14 3.1E-06   38.4   3.7  100   53-153   195-356 (423)
 64 KOG4173|consensus               92.9   0.053 1.1E-06   37.7   1.2   75   53-152    79-167 (253)
 65 PF09538 FYDLN_acid:  Protein o  92.4   0.068 1.5E-06   33.6   1.2   30   83-116    10-39  (108)
 66 PF13719 zinc_ribbon_5:  zinc-r  92.1   0.087 1.9E-06   26.2   1.1   33  104-141     3-35  (37)
 67 PF09986 DUF2225:  Uncharacteri  91.7   0.029 6.2E-07   39.8  -1.3   43  102-144     4-61  (214)
 68 PF13717 zinc_ribbon_4:  zinc-r  91.3    0.13 2.8E-06   25.4   1.3   33  104-141     3-35  (36)
 69 COG5048 FOG: Zn-finger [Genera  91.1    0.11 2.3E-06   40.1   1.3  108   52-161   288-448 (467)
 70 PRK00398 rpoP DNA-directed RNA  90.8    0.13 2.8E-06   26.9   1.0    9  104-112    22-30  (46)
 71 COG2888 Predicted Zn-ribbon RN  90.6    0.15 3.4E-06   28.0   1.2   31  104-139    28-58  (61)
 72 COG5236 Uncharacterized conser  90.4    0.38 8.3E-06   36.3   3.4   78   55-155   222-305 (493)
 73 TIGR02098 MJ0042_CXXC MJ0042 f  90.1    0.15 3.2E-06   25.4   0.9   33  104-141     3-35  (38)
 74 KOG2893|consensus               89.9   0.058 1.2E-06   38.4  -1.0   41  106-150    13-53  (341)
 75 PF10571 UPF0547:  Uncharacteri  89.9    0.17 3.6E-06   23.1   0.8    9  106-114    17-25  (26)
 76 KOG2231|consensus               89.7    0.43 9.2E-06   39.3   3.5   53   55-127   184-236 (669)
 77 cd00729 rubredoxin_SM Rubredox  89.4    0.28 6.1E-06   23.9   1.5    9  131-139    18-26  (34)
 78 KOG2482|consensus               89.3    0.37 8.1E-06   36.2   2.7   70   54-125   145-217 (423)
 79 PHA00626 hypothetical protein   88.8   0.075 1.6E-06   28.8  -0.8   14  131-144    23-36  (59)
 80 TIGR00622 ssl1 transcription f  88.4    0.77 1.7E-05   29.0   3.3   22   52-73     14-35  (112)
 81 PF04959 ARS2:  Arsenite-resist  88.3   0.096 2.1E-06   37.0  -0.8   23  131-153    77-99  (214)
 82 PRK06266 transcription initiat  88.1    0.13 2.9E-06   35.3  -0.3   29   82-112   117-145 (178)
 83 PF15135 UPF0515:  Uncharacteri  87.8    0.48   1E-05   34.0   2.3   12   50-61    109-120 (278)
 84 PF06524 NOA36:  NOA36 protein;  87.7    0.16 3.5E-06   36.6  -0.1   89   50-154   139-232 (314)
 85 TIGR02605 CxxC_CxxC_SSSS putat  87.6    0.17 3.8E-06   27.1   0.0   29  104-139     6-34  (52)
 86 TIGR00373 conserved hypothetic  87.3    0.34 7.4E-06   32.6   1.4   29   82-112   109-137 (158)
 87 COG1592 Rubrerythrin [Energy p  87.1    0.38 8.3E-06   32.6   1.5   23  103-138   134-156 (166)
 88 PF09723 Zn-ribbon_8:  Zinc rib  86.1    0.28 6.2E-06   25.1   0.4   13  104-116     6-18  (42)
 89 PF02892 zf-BED:  BED zinc fing  86.0    0.79 1.7E-05   23.6   2.1   27   51-77     14-44  (45)
 90 smart00614 ZnF_BED BED zinc fi  85.9    0.72 1.6E-05   24.5   1.9   21  104-124    19-44  (50)
 91 COG5236 Uncharacterized conser  85.8     1.6 3.5E-05   33.1   4.2   92   54-154   152-274 (493)
 92 PF05443 ROS_MUCR:  ROS/MUCR tr  85.7    0.33 7.2E-06   31.6   0.6   23  104-129    73-95  (132)
 93 TIGR02300 FYDLN_acid conserved  85.6    0.42 9.1E-06   30.7   1.0   30   83-116    10-39  (129)
 94 smart00531 TFIIE Transcription  85.0    0.29 6.2E-06   32.6   0.1   13  104-116   100-112 (147)
 95 COG1592 Rubrerythrin [Energy p  84.9    0.41 8.8E-06   32.5   0.8   23   82-110   134-156 (166)
 96 PRK14890 putative Zn-ribbon RN  84.5    0.49 1.1E-05   26.1   0.8   10  130-139    47-56  (59)
 97 KOG2785|consensus               83.8     1.2 2.7E-05   34.0   3.0   50  104-153   167-242 (390)
 98 PRK00464 nrdR transcriptional   83.8    0.46 9.9E-06   31.9   0.6   12   83-94     29-40  (154)
 99 PF05443 ROS_MUCR:  ROS/MUCR tr  83.7    0.69 1.5E-05   30.2   1.4   31  127-160    68-98  (132)
100 COG3357 Predicted transcriptio  83.6    0.53 1.1E-05   28.3   0.8   27   81-110    57-83  (97)
101 KOG2785|consensus               83.5     1.5 3.2E-05   33.6   3.3   73   51-125   164-242 (390)
102 KOG2186|consensus               83.1    0.68 1.5E-05   33.4   1.3   38   53-93      3-40  (276)
103 smart00834 CxxC_CXXC_SSSS Puta  83.0    0.53 1.1E-05   23.6   0.6   12  104-115     6-17  (41)
104 PF09986 DUF2225:  Uncharacteri  82.8    0.15 3.2E-06   36.2  -2.1   22   52-73      4-25  (214)
105 KOG4167|consensus               82.6    0.34 7.3E-06   40.1  -0.4   27  101-127   790-816 (907)
106 smart00659 RPOLCX RNA polymera  82.5    0.86 1.9E-05   23.6   1.2   11   83-93      3-13  (44)
107 PF14353 CpXC:  CpXC protein     82.3    0.63 1.4E-05   30.1   0.8   11   55-65      3-13  (128)
108 smart00734 ZnF_Rad18 Rad18-lik  82.3     1.3 2.8E-05   20.1   1.7   19  105-124     3-21  (26)
109 cd00730 rubredoxin Rubredoxin;  82.2    0.65 1.4E-05   24.8   0.7    9  102-110    33-41  (50)
110 PF04959 ARS2:  Arsenite-resist  82.0    0.98 2.1E-05   32.0   1.8   31   50-80     74-104 (214)
111 COG1996 RPC10 DNA-directed RNA  80.6     0.8 1.7E-05   24.3   0.7    7  104-110    25-31  (49)
112 smart00531 TFIIE Transcription  79.2     1.4   3E-05   29.3   1.7   33   82-114    99-134 (147)
113 COG1997 RPL43A Ribosomal prote  78.5     1.2 2.7E-05   26.6   1.1   12  104-115    54-65  (89)
114 TIGR00373 conserved hypothetic  77.9     1.5 3.2E-05   29.6   1.6   33  101-142   107-139 (158)
115 PRK06266 transcription initiat  77.2     1.4   3E-05   30.3   1.3   34  101-143   115-148 (178)
116 PRK09678 DNA-binding transcrip  76.7    0.58 1.3E-05   27.1  -0.6   17  129-145    25-43  (72)
117 COG1198 PriA Primosomal protei  76.5    0.63 1.4E-05   39.0  -0.6   15  126-140   470-484 (730)
118 PF00301 Rubredoxin:  Rubredoxi  76.3     1.2 2.6E-05   23.5   0.6   10  101-110    32-41  (47)
119 PF13451 zf-trcl:  Probable zin  75.8     2.4 5.2E-05   22.5   1.7   39   52-90      3-41  (49)
120 KOG4167|consensus               75.7     1.6 3.4E-05   36.4   1.3   28   51-79    790-817 (907)
121 COG1655 Uncharacterized protei  75.0    0.73 1.6E-05   32.8  -0.5   41  101-141    17-72  (267)
122 PF01363 FYVE:  FYVE zinc finge  73.9     1.9 4.1E-05   24.4   1.1    8   56-63     12-19  (69)
123 PF12907 zf-met2:  Zinc-binding  73.1     2.9 6.3E-05   21.2   1.5   32   54-85      2-36  (40)
124 PF13240 zinc_ribbon_2:  zinc-r  73.1     1.5 3.2E-05   19.3   0.4    6  106-111    16-21  (23)
125 KOG0978|consensus               73.0     1.1 2.3E-05   37.3  -0.1   14   52-65    642-655 (698)
126 PF01780 Ribosomal_L37ae:  Ribo  71.7     1.6 3.4E-05   26.4   0.4   32   81-115    34-65  (90)
127 PF12760 Zn_Tnp_IS1595:  Transp  71.3      11 0.00025   19.4   3.6   27   83-111    19-45  (46)
128 PF10083 DUF2321:  Uncharacteri  68.8    0.76 1.7E-05   30.6  -1.5   12  105-116    70-81  (158)
129 COG4888 Uncharacterized Zn rib  68.7    0.88 1.9E-05   27.9  -1.1   39  100-142    19-57  (104)
130 COG1198 PriA Primosomal protei  68.6       2 4.3E-05   36.2   0.5   46   54-112   436-484 (730)
131 PF13248 zf-ribbon_3:  zinc-rib  68.0     2.2 4.8E-05   19.2   0.4    6  106-111    19-24  (26)
132 PRK04023 DNA polymerase II lar  68.0     2.7   6E-05   36.4   1.2   12  131-142   663-674 (1121)
133 PRK14873 primosome assembly pr  67.7       2 4.3E-05   35.9   0.3   26   77-111   405-430 (665)
134 COG4530 Uncharacterized protei  67.6     2.6 5.6E-05   26.4   0.7   10  104-113    27-36  (129)
135 TIGR01206 lysW lysine biosynth  67.3     3.3 7.1E-05   22.5   1.0    7   55-61      4-10  (54)
136 KOG3408|consensus               66.9     4.3 9.3E-05   25.9   1.6   23  131-153    57-79  (129)
137 PF01927 Mut7-C:  Mut7-C RNAse   64.6     5.2 0.00011   26.5   1.8   19  103-121   124-142 (147)
138 KOG4602|consensus               64.4      11 0.00024   27.4   3.5   46   51-111   231-276 (318)
139 PF04780 DUF629:  Protein of un  63.5     5.8 0.00013   31.6   2.1   30   52-81     56-85  (466)
140 PF07754 DUF1610:  Domain of un  63.2     3.9 8.5E-05   18.2   0.7    7  104-110    17-23  (24)
141 PF04438 zf-HIT:  HIT zinc fing  63.2     3.1 6.7E-05   19.6   0.4   10  104-113    14-23  (30)
142 PF11931 DUF3449:  Domain of un  62.6     2.5 5.4E-05   29.6   0.0   22  101-122    99-121 (196)
143 PTZ00255 60S ribosomal protein  61.6     4.4 9.5E-05   24.5   0.9   31   82-115    36-66  (90)
144 PRK14714 DNA polymerase II lar  61.6       4 8.7E-05   36.4   1.1   11  131-141   709-719 (1337)
145 TIGR00280 L37a ribosomal prote  61.2     4.2   9E-05   24.7   0.8   32   82-116    35-66  (91)
146 COG4957 Predicted transcriptio  61.1     3.2   7E-05   27.0   0.3   22  105-129    78-99  (148)
147 KOG2593|consensus               61.0     7.1 0.00015   30.6   2.2   31   81-111   127-161 (436)
148 PF08271 TF_Zn_Ribbon:  TFIIB z  60.9     5.3 0.00012   20.3   1.1    9  104-112    20-28  (43)
149 cd00065 FYVE FYVE domain; Zinc  60.8     5.5 0.00012   21.4   1.2   12  103-114    18-29  (57)
150 TIGR00595 priA primosomal prot  60.4     3.5 7.5E-05   33.3   0.5   47   55-111   215-261 (505)
151 PF09845 DUF2072:  Zn-ribbon co  60.0     3.3 7.1E-05   26.9   0.2   13   54-66      2-14  (131)
152 PF15269 zf-C2H2_7:  Zinc-finge  60.0     7.3 0.00016   20.2   1.4   22  104-125    21-42  (54)
153 PF03604 DNA_RNApol_7kD:  DNA d  59.9     4.6  0.0001   19.3   0.7    6  105-110    19-24  (32)
154 PF10013 DUF2256:  Uncharacteri  59.8     5.4 0.00012   20.4   0.9   17  105-121    10-26  (42)
155 COG2879 Uncharacterized small   59.7      11 0.00024   21.1   2.2   18  143-160    24-41  (65)
156 KOG3214|consensus               59.5       3 6.6E-05   25.6  -0.0   41  101-145    21-61  (109)
157 KOG3408|consensus               59.3     6.9 0.00015   25.0   1.5   25   50-74     54-78  (129)
158 KOG2593|consensus               57.7     6.2 0.00013   30.9   1.4   39   52-94    127-165 (436)
159 PF08790 zf-LYAR:  LYAR-type C2  57.6     3.4 7.4E-05   19.1   0.0   17  105-122     2-18  (28)
160 PRK04023 DNA polymerase II lar  57.5     6.1 0.00013   34.5   1.4   11   52-62    625-635 (1121)
161 PRK03976 rpl37ae 50S ribosomal  57.2     5.3 0.00011   24.2   0.8   31   82-115    36-66  (90)
162 PF14311 DUF4379:  Domain of un  57.0      10 0.00022   20.4   1.8   15  104-118    29-43  (55)
163 KOG1280|consensus               56.9       5 0.00011   30.5   0.7   29  103-131    79-107 (381)
164 PF03833 PolC_DP2:  DNA polymer  56.5     3.6 7.9E-05   35.0   0.0   13   82-94    655-667 (900)
165 smart00661 RPOL9 RNA polymeras  56.1     8.1 0.00018   20.3   1.3   10  104-113    21-30  (52)
166 smart00064 FYVE Protein presen  55.9     6.1 0.00013   22.2   0.9   28   83-115    11-38  (68)
167 TIGR00100 hypA hydrogenase nic  55.7     6.1 0.00013   25.1   0.9   12  104-115    71-82  (115)
168 PRK03824 hypA hydrogenase nick  55.5     5.3 0.00012   26.2   0.6   16  101-116    68-83  (135)
169 KOG0782|consensus               55.2       4 8.6E-05   33.3   0.0   49   66-117   238-290 (1004)
170 KOG0717|consensus               54.8     6.4 0.00014   31.2   1.1   22  132-153   293-314 (508)
171 COG5112 UFD2 U1-like Zn-finger  54.4     7.5 0.00016   24.2   1.1   23  131-153    55-77  (126)
172 PF04780 DUF629:  Protein of un  53.9     8.3 0.00018   30.8   1.5   22  132-153    58-79  (466)
173 PF02176 zf-TRAF:  TRAF-type zi  53.7     3.9 8.5E-05   22.2  -0.2   40  104-144    10-55  (60)
174 TIGR00595 priA primosomal prot  52.4     4.4 9.5E-05   32.8  -0.2   14  127-140   249-262 (505)
175 PRK14873 primosome assembly pr  52.3     4.5 9.8E-05   33.9  -0.1   11  130-140   421-431 (665)
176 KOG2636|consensus               52.1     9.2  0.0002   30.2   1.5   23  101-123   399-422 (497)
177 PF13878 zf-C2H2_3:  zinc-finge  51.7      16 0.00035   18.4   2.0   23   54-77     14-38  (41)
178 PF01155 HypA:  Hydrogenase exp  51.5       6 0.00013   25.0   0.4   13  104-116    71-83  (113)
179 PF15135 UPF0515:  Uncharacteri  51.4     7.8 0.00017   28.1   1.0   28   82-111   155-182 (278)
180 PF07649 C1_3:  C1-like domain;  51.3     8.1 0.00018   17.9   0.8    7  104-110    16-22  (30)
181 PF05191 ADK_lid:  Adenylate ki  50.6     6.3 0.00014   19.4   0.3    8  106-113     4-11  (36)
182 COG1773 Rubredoxin [Energy pro  50.5       8 0.00017   21.1   0.7   15  103-117     3-17  (55)
183 COG3091 SprT Zn-dependent meta  50.3     6.4 0.00014   26.3   0.4   35  101-140   115-149 (156)
184 KOG2636|consensus               50.0      11 0.00024   29.8   1.7   29  124-152   394-423 (497)
185 KOG0978|consensus               49.9       4 8.7E-05   34.1  -0.7   22  129-150   676-697 (698)
186 PF08274 PhnA_Zn_Ribbon:  PhnA   49.7     4.6 9.9E-05   19.0  -0.3    8  131-138    19-26  (30)
187 PRK00564 hypA hydrogenase nick  49.4     8.4 0.00018   24.6   0.8   12  104-115    72-83  (117)
188 COG5151 SSL1 RNA polymerase II  49.0      12 0.00026   28.1   1.7   48  105-154   364-411 (421)
189 PHA02998 RNA polymerase subuni  49.0     2.4 5.2E-05   29.0  -1.8   38  103-144   143-184 (195)
190 PF07800 DUF1644:  Protein of u  48.7      31 0.00067   23.3   3.4   61  103-164    80-142 (162)
191 PF02150 RNA_POL_M_15KD:  RNA p  48.6      10 0.00022   18.5   0.9    9  105-113    22-30  (35)
192 PF09332 Mcm10:  Mcm10 replicat  48.3       5 0.00011   30.7  -0.4   39   54-94    253-297 (344)
193 COG4338 Uncharacterized protei  48.1     6.9 0.00015   20.6   0.2   19  105-123    14-32  (54)
194 PF01286 XPA_N:  XPA protein N-  48.1     6.9 0.00015   19.0   0.2    9   85-93      6-14  (34)
195 KOG4173|consensus               48.1      15 0.00032   26.0   1.9   47  103-152    79-127 (253)
196 COG1675 TFA1 Transcription ini  48.0      12 0.00025   25.8   1.4   30   81-112   112-141 (176)
197 COG1656 Uncharacterized conser  47.8      12 0.00026   25.4   1.4   17  104-120   131-147 (165)
198 PF12773 DZR:  Double zinc ribb  47.8      13 0.00028   19.4   1.3    9  131-139    29-37  (50)
199 PRK14559 putative protein seri  47.6      16 0.00035   30.6   2.4    7  106-112    44-50  (645)
200 COG5152 Uncharacterized conser  47.2       8 0.00017   27.1   0.5   48   81-143   195-242 (259)
201 KOG4118|consensus               46.8      14 0.00031   20.8   1.4   30  131-160    38-67  (74)
202 KOG1842|consensus               46.6      13 0.00029   29.3   1.7   29   53-81     15-43  (505)
203 PF04810 zf-Sec23_Sec24:  Sec23  46.5      11 0.00024   18.9   0.8   10  102-111    23-32  (40)
204 PF07975 C1_4:  TFIIH C1-like d  45.8     5.1 0.00011   21.5  -0.5   24  103-126    21-44  (51)
205 smart00154 ZnF_AN1 AN1-like Zi  45.5     9.7 0.00021   19.0   0.5   15   53-67     12-26  (39)
206 PF11789 zf-Nse:  Zinc-finger o  44.8      11 0.00024   20.6   0.8   44   81-136    10-53  (57)
207 KOG2807|consensus               43.8      36 0.00077   25.9   3.4   21   53-73    290-310 (378)
208 KOG1701|consensus               43.7      18 0.00038   28.5   1.9   45   54-100   275-320 (468)
209 KOG1280|consensus               43.0      27 0.00058   26.8   2.7   39   51-89     77-116 (381)
210 PF04641 Rtf2:  Rtf2 RING-finge  42.9     2.9 6.3E-05   30.6  -2.3   17   50-66    110-126 (260)
211 COG3364 Zn-ribbon containing p  42.6      11 0.00024   23.3   0.5   11  104-114     3-13  (112)
212 PTZ00448 hypothetical protein;  42.4      24 0.00052   27.3   2.4   22  104-125   315-336 (373)
213 PF04423 Rad50_zn_hook:  Rad50   41.6      11 0.00024   20.2   0.4   12  105-116    22-33  (54)
214 TIGR01562 FdhE formate dehydro  41.5      15 0.00032   27.7   1.2   77   53-144   184-265 (305)
215 PRK05452 anaerobic nitric oxid  41.3      13 0.00027   30.0   0.9    7  104-110   459-465 (479)
216 KOG2071|consensus               41.1      13 0.00029   30.4   0.9   28  128-155   415-442 (579)
217 COG4640 Predicted membrane pro  40.7      16 0.00035   28.5   1.3   16  104-119    16-31  (465)
218 PF01096 TFIIS_C:  Transcriptio  40.5     8.5 0.00018   19.2  -0.1    9  104-112    29-37  (39)
219 smart00504 Ubox Modified RING   40.4      30 0.00065   18.7   2.1   29  108-142    18-46  (63)
220 PRK12496 hypothetical protein;  40.0      11 0.00025   25.5   0.4   11   83-93    128-138 (164)
221 PF14446 Prok-RING_1:  Prokaryo  39.9      17 0.00038   19.7   1.0   25   83-112     6-30  (54)
222 PRK05580 primosome assembly pr  39.8     7.8 0.00017   32.6  -0.5   13  128-140   418-430 (679)
223 COG1594 RPB9 DNA-directed RNA   39.7     4.5 9.7E-05   25.7  -1.5   16   52-67     21-36  (113)
224 PRK00420 hypothetical protein;  39.4      18  0.0004   22.9   1.2   29   83-115    24-52  (112)
225 PF06044 DRP:  Dam-replacing fa  38.9     3.8 8.3E-05   29.5  -2.1   37   81-117    30-67  (254)
226 PRK03564 formate dehydrogenase  38.7      17 0.00036   27.5   1.1   78   52-144   186-265 (309)
227 cd00924 Cyt_c_Oxidase_Vb Cytoc  38.6      13 0.00029   22.8   0.5   20  123-143    72-91  (97)
228 PF10122 Mu-like_Com:  Mu-like   38.1      22 0.00049   19.0   1.2    9  104-112    25-33  (51)
229 COG1571 Predicted DNA-binding   38.1      17 0.00036   28.7   1.0   14  131-144   367-380 (421)
230 PTZ00303 phosphatidylinositol   37.9      16 0.00034   31.3   0.9   33   84-116   462-494 (1374)
231 PLN03238 probable histone acet  37.9      31 0.00068   25.7   2.3   22  131-152    48-69  (290)
232 PF04606 Ogr_Delta:  Ogr/Delta-  37.7     3.5 7.6E-05   21.6  -1.9   12  131-142    25-38  (47)
233 PF01428 zf-AN1:  AN1-like Zinc  37.7      15 0.00033   18.7   0.5   15  102-116    12-26  (43)
234 KOG0402|consensus               37.4      16 0.00035   21.7   0.7   30   82-114    36-65  (92)
235 COG3809 Uncharacterized protei  37.4      27 0.00058   20.5   1.6   40   85-125     4-43  (88)
236 TIGR00416 sms DNA repair prote  37.3      16 0.00034   29.2   0.8    7  104-110    22-28  (454)
237 PRK00762 hypA hydrogenase nick  37.2      15 0.00032   23.7   0.6   11   53-64     70-80  (124)
238 KOG2071|consensus               37.2      20 0.00042   29.5   1.3   28   51-79    416-443 (579)
239 PF10276 zf-CHCC:  Zinc-finger   37.1      15 0.00032   18.6   0.4   10  104-113    30-39  (40)
240 COG0068 HypF Hydrogenase matur  37.1     9.3  0.0002   32.1  -0.5   72   53-139   101-181 (750)
241 PF13824 zf-Mss51:  Zinc-finger  37.1      17 0.00038   19.8   0.7    7  104-110    15-21  (55)
242 PRK04351 hypothetical protein;  36.4      17 0.00036   24.3   0.7   33  103-143   112-144 (149)
243 PLN02294 cytochrome c oxidase   36.4      14 0.00029   25.3   0.3   21  123-144   134-154 (174)
244 COG0846 SIR2 NAD-dependent pro  36.4      22 0.00048   26.0   1.4   34  102-139   121-154 (250)
245 PF07282 OrfB_Zn_ribbon:  Putat  36.0      24 0.00053   19.7   1.3    9  132-140    47-55  (69)
246 PRK00432 30S ribosomal protein  35.9      25 0.00054   18.7   1.2    7  132-138    38-44  (50)
247 COG1327 Predicted transcriptio  35.8      16 0.00035   24.4   0.6   12   83-94     29-40  (156)
248 PTZ00303 phosphatidylinositol   35.6      19 0.00041   30.9   1.1   33  105-144   462-494 (1374)
249 TIGR00244 transcriptional regu  35.5      18  0.0004   24.1   0.8   11  105-115    30-40  (147)
250 smart00440 ZnF_C2C2 C2C2 Zinc   35.3      17 0.00037   18.2   0.5    8  132-139    29-36  (40)
251 KOG1729|consensus               35.3     5.6 0.00012   29.6  -1.8    6  133-138   216-221 (288)
252 PRK11823 DNA repair protein Ra  35.1      18 0.00039   28.8   0.8    7  104-110    22-28  (446)
253 KOG2907|consensus               35.0      29 0.00064   21.9   1.6    8   54-61     75-82  (116)
254 smart00731 SprT SprT homologue  34.9      23 0.00049   23.4   1.2   33  103-142   112-144 (146)
255 PF05290 Baculo_IE-1:  Baculovi  34.8      25 0.00054   23.0   1.3   57   78-145    76-135 (140)
256 PF10071 DUF2310:  Zn-ribbon-co  34.7      17 0.00038   26.6   0.7   27  105-138   222-248 (258)
257 PRK14892 putative transcriptio  34.3      10 0.00023   23.4  -0.4   12  132-143    43-54  (99)
258 PF11672 DUF3268:  Protein of u  34.2      14  0.0003   23.0   0.1    8  132-139    32-39  (102)
259 COG5188 PRP9 Splicing factor 3  33.7      88  0.0019   24.2   4.1   22   52-73    373-395 (470)
260 PRK05978 hypothetical protein;  33.7      21 0.00046   23.8   0.9    8   54-61     34-41  (148)
261 PF10263 SprT-like:  SprT-like   33.7      16 0.00035   24.2   0.3   31  103-141   123-153 (157)
262 COG4306 Uncharacterized protei  33.6      19 0.00041   23.2   0.6   13  105-117    70-82  (160)
263 KOG1994|consensus               33.5      23  0.0005   25.4   1.1   21   52-72    238-258 (268)
264 COG1779 C4-type Zn-finger prot  33.2      17 0.00038   25.4   0.4    9   54-62     15-23  (201)
265 PF15616 TerY-C:  TerY-C metal   32.5      26 0.00057   22.9   1.1    9  131-139   105-113 (131)
266 cd01121 Sms Sms (bacterial rad  31.6      24 0.00052   27.4   1.0   21   83-110     1-21  (372)
267 KOG3990|consensus               31.4      29 0.00062   25.3   1.3   15   53-67      6-20  (305)
268 COG4391 Uncharacterized protei  31.4      19 0.00042   20.0   0.3   12  104-115    49-60  (62)
269 COG3677 Transposase and inacti  31.4      24 0.00052   22.9   0.8   16   51-66     51-66  (129)
270 PTZ00448 hypothetical protein;  30.8      36 0.00078   26.4   1.8   23  131-153   314-336 (373)
271 cd02335 ZZ_ADA2 Zinc finger, Z  30.7      31 0.00068   18.0   1.1    6  104-109    16-21  (49)
272 PTZ00064 histone acetyltransfe  30.6      45 0.00097   27.1   2.3   31  130-160   279-309 (552)
273 PLN00104 MYST -like histone ac  30.5      43 0.00093   26.8   2.2   31  131-161   198-228 (450)
274 TIGR00310 ZPR1_znf ZPR1 zinc f  30.3      26 0.00055   24.5   0.9    8   55-62      2-9   (192)
275 PLN02748 tRNA dimethylallyltra  30.1      36 0.00077   27.4   1.7   24  130-153   417-441 (468)
276 PF09082 DUF1922:  Domain of un  30.1     8.7 0.00019   21.9  -1.2   26   83-113     4-29  (68)
277 cd02341 ZZ_ZZZ3 Zinc finger, Z  29.5      34 0.00074   18.0   1.1    6  104-109    16-21  (48)
278 COG5574 PEX10 RING-finger-cont  29.4      22 0.00048   26.1   0.4   33  104-140   228-260 (271)
279 COG5188 PRP9 Splicing factor 3  29.3      35 0.00075   26.3   1.5   30  123-152   366-396 (470)
280 PF06220 zf-U1:  U1 zinc finger  29.2      45 0.00098   16.5   1.4   10  132-141     4-13  (38)
281 PF06397 Desulfoferrod_N:  Desu  28.6      28  0.0006   17.2   0.6   11  103-113     6-16  (36)
282 KOG3362|consensus               28.6      16 0.00034   24.2  -0.4   22  131-152   129-150 (156)
283 smart00290 ZnF_UBP Ubiquitin C  28.5      28 0.00061   18.0   0.7   13  104-116    12-24  (50)
284 KOG1842|consensus               28.5      34 0.00073   27.2   1.3   29  101-129    13-41  (505)
285 COG1545 Predicted nucleic-acid  28.3      24 0.00053   23.2   0.5   12   83-94     30-41  (140)
286 PF04216 FdhE:  Protein involve  28.2      26 0.00056   26.1   0.7   78   54-143   173-250 (290)
287 PF05129 Elf1:  Transcription e  27.8      23 0.00051   20.9   0.3   11  105-115    48-58  (81)
288 KOG4317|consensus               27.6      15 0.00032   27.7  -0.7   12   83-94     20-31  (383)
289 PF14803 Nudix_N_2:  Nudix N-te  27.5      35 0.00075   16.5   0.8    6  133-138    24-29  (34)
290 smart00709 Zpr1 Duplicated dom  27.3      26 0.00057   23.7   0.5    6   56-61      3-8   (160)
291 KOG0782|consensus               26.5      21 0.00045   29.4  -0.1   30  118-147   240-269 (1004)
292 PF03107 C1_2:  C1 domain;  Int  26.4      41 0.00088   15.5   0.9    7  104-110    16-22  (30)
293 PLN03208 E3 ubiquitin-protein   26.4      70  0.0015   22.4   2.4   12   52-63     17-28  (193)
294 KOG1819|consensus               26.0      37  0.0008   27.5   1.1    8   85-92    920-927 (990)
295 KOG1044|consensus               25.5      30 0.00066   28.4   0.6   36  105-147   194-234 (670)
296 PF03145 Sina:  Seven in absent  25.5      40 0.00086   23.5   1.2   51  104-157    15-73  (198)
297 PRK06450 threonine synthase; V  25.3      31 0.00068   26.3   0.7   10   54-63      4-13  (338)
298 PTZ00409 Sir2 (Silent Informat  25.3      68  0.0015   23.7   2.4   34  104-138   138-171 (271)
299 PF07503 zf-HYPF:  HypF finger;  25.2      45 0.00098   16.2   1.0    9  105-113    23-31  (35)
300 PF12230 PRP21_like_P:  Pre-mRN  24.8      24 0.00053   25.2   0.0   28  104-132   169-196 (229)
301 PF02748 PyrI_C:  Aspartate car  24.6      38 0.00083   18.2   0.7   16  101-116    33-48  (52)
302 PLN03239 histone acetyltransfe  24.5      67  0.0015   24.8   2.2   23  130-152   105-127 (351)
303 KOG0320|consensus               24.3      29 0.00062   24.0   0.3   10  131-140   167-176 (187)
304 cd01396 MeCP2_MBD MeCP2, MBD1,  24.3      64  0.0014   18.8   1.7   18  137-154    34-51  (77)
305 COG1379 PHP family phosphoeste  24.3      74  0.0016   24.4   2.4   53  105-166   248-301 (403)
306 TIGR00515 accD acetyl-CoA carb  23.9      25 0.00055   26.2  -0.0   11   53-63     26-36  (285)
307 PLN02748 tRNA dimethylallyltra  23.5      55  0.0012   26.4   1.7   25  101-125   416-441 (468)
308 CHL00174 accD acetyl-CoA carbo  23.2      27  0.0006   26.2   0.0   11   53-63     38-48  (296)
309 PRK14138 NAD-dependent deacety  23.0      76  0.0016   23.0   2.3   32  104-139   120-151 (244)
310 PF10537 WAC_Acf1_DNA_bd:  ATP-  22.9      77  0.0017   19.7   2.0   37   52-90      2-38  (102)
311 PF03884 DUF329:  Domain of unk  22.8      38 0.00081   18.6   0.5   12  104-115     3-14  (57)
312 COG1326 Uncharacterized archae  22.8      59  0.0013   22.8   1.5   10  132-141    31-40  (201)
313 COG1066 Sms Predicted ATP-depe  22.7      35 0.00077   27.0   0.5    6  105-110    23-28  (456)
314 COG1645 Uncharacterized Zn-fin  22.4      50  0.0011   21.6   1.1   27   82-113    28-54  (131)
315 PRK07218 replication factor A;  22.4      37 0.00081   26.9   0.6    7   55-61    299-305 (423)
316 TIGR00627 tfb4 transcription f  22.3      43 0.00093   25.0   0.9   27  101-141   253-279 (279)
317 COG2331 Uncharacterized protei  22.3      22 0.00048   20.8  -0.5    9   54-62     13-21  (82)
318 PRK07591 threonine synthase; V  21.9      40 0.00087   26.6   0.7   28   53-94     18-45  (421)
319 TIGR00340 zpr1_rel ZPR1-relate  21.8      37 0.00081   23.1   0.4    6   56-61      1-6   (163)
320 PF07295 DUF1451:  Protein of u  21.8      26 0.00057   23.3  -0.3    6  105-110   132-137 (146)
321 cd01413 SIR2_Af2 SIR2_Af2: Arc  21.7      78  0.0017   22.5   2.1   31  104-139   114-144 (222)
322 PRK05654 acetyl-CoA carboxylas  21.7      30 0.00065   26.0  -0.1   11   52-62     26-36  (292)
323 KOG3352|consensus               21.7      38 0.00082   22.7   0.4   17  127-143   129-145 (153)
324 PF14787 zf-CCHC_5:  GAG-polypr  21.7      41 0.00089   16.5   0.4   16  105-120     4-19  (36)
325 PRK01343 zinc-binding protein;  21.5      47   0.001   18.3   0.7   11  104-114    10-20  (57)
326 PF03367 zf-ZPR1:  ZPR1 zinc-fi  21.4      30 0.00065   23.4  -0.1    8  104-111    31-38  (161)
327 PF08209 Sgf11:  Sgf11 (transcr  21.4      47   0.001   16.0   0.6   20  104-124     5-24  (33)
328 PF06467 zf-FCS:  MYM-type Zinc  20.8      61  0.0013   16.0   1.0   15  104-118     7-21  (43)
329 PF14634 zf-RING_5:  zinc-RING   20.6      89  0.0019   15.7   1.6   10  129-138    34-43  (44)
330 COG0068 HypF Hydrogenase matur  20.5      22 0.00047   30.0  -1.0   68   83-151   102-171 (750)
331 PF05495 zf-CHY:  CHY zinc fing  20.3      27 0.00058   20.0  -0.4   13   54-66     11-23  (71)
332 COG3880 Modulator of heat shoc  20.3      30 0.00066   23.6  -0.2   31  104-144    75-105 (176)
333 PTZ00043 cytochrome c oxidase   20.1      49  0.0011   23.8   0.7   17  127-143   177-193 (268)
334 PRK12722 transcriptional activ  20.0      61  0.0013   22.6   1.2   28  104-139   135-162 (187)
335 PF04328 DUF466:  Protein of un  20.0   1E+02  0.0022   17.4   1.9   18  143-160    24-41  (65)

No 1  
>KOG2462|consensus
Probab=99.90  E-value=2.2e-24  Score=151.28  Aligned_cols=109  Identities=17%  Similarity=0.231  Sum_probs=83.8

Q ss_pred             CCCcccccccccccCCHHHHHHHHHHhcCC---CCcccccchhhhhhccccccc-------cCceecccccccccChhHH
Q psy8167          50 PIDRIPCTLCDKTFTRKDSLKKHIRIFHTQ---NQPQHTNVIEVALGARANAAF-------IDRIRCELCDKSFTRKDSL  119 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~---~~~~~c~~c~~~~~~~~~~~l-------~k~~~C~~C~k~f~~~~~l  119 (167)
                      ....|.|..||+.+....+|.+|. +.|..   .+.+.|+.|++.+..  ...|       .-++.|.+|||.|.+...|
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHk-Q~H~~~~s~ka~~C~~C~K~YvS--mpALkMHirTH~l~c~C~iCGKaFSRPWLL  203 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHK-QTHRSLDSKKAFSCKYCGKVYVS--MPALKMHIRTHTLPCECGICGKAFSRPWLL  203 (279)
T ss_pred             cCCceeccccccccccccccchhh-cccccccccccccCCCCCceeee--hHHHhhHhhccCCCcccccccccccchHHh
Confidence            345688888888888888888887 65643   456888888888776  5444       3356788888888888888


Q ss_pred             HHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhcCCCCCcc
Q psy8167         120 KKHNRIFHGGADPKLMDEQMARGSADFLEVVLNEDGEGEPVS  161 (167)
Q Consensus       120 ~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  161 (167)
                      +-|+|+|+|||||.|..|+|+|..+++|+-|+++|.+.++..
T Consensus       204 QGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  204 QGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             hcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            888888888888888888888888888888888887766544


No 2  
>KOG2462|consensus
Probab=99.88  E-value=2.6e-23  Score=145.92  Aligned_cols=102  Identities=18%  Similarity=0.245  Sum_probs=91.1

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccc-------cCceecccccccccChhHHHHHH
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAF-------IDRIRCELCDKSFTRKDSLKKHN  123 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l-------~k~~~C~~C~k~f~~~~~l~~H~  123 (167)
                      .+.+.|+.|++.|..-..|.+|+ ++|+  .+++|.+||+.|...=.+.-       +|+|.|+.|+|+|..+++|+.||
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHi-rTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHI-RTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHh-hccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHH
Confidence            56799999999999999999999 6685  78999999999985111111       99999999999999999999999


Q ss_pred             HhhcCCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         124 RIFHGGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       124 ~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      ++|.+.|+|+|..|+|+|...+.|.+|...-.
T Consensus       236 QTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~C  267 (279)
T KOG2462|consen  236 QTHSDVKKHQCPRCGKSFALKSYLNKHSESAC  267 (279)
T ss_pred             HhhcCCccccCcchhhHHHHHHHHHHhhhhcc
Confidence            99999999999999999999999999998544


No 3  
>KOG1074|consensus
Probab=99.72  E-value=5.3e-18  Score=134.05  Aligned_cols=55  Identities=18%  Similarity=0.214  Sum_probs=51.7

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhcCCCCC
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNEDGEGEP  159 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~  159 (167)
                      .|-+|.++..-++.|+.|.|+|+|++||+|.+||+.|..+-+|+.|+-+|....|
T Consensus       607 qCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~  661 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPP  661 (958)
T ss_pred             ceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCcc
Confidence            6999999999999999999999999999999999999999999999998876444


No 4  
>KOG3576|consensus
Probab=99.68  E-value=1.9e-17  Score=111.70  Aligned_cols=107  Identities=21%  Similarity=0.366  Sum_probs=90.2

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccc---------cCceecccccccccChhHHHH
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAF---------IDRIRCELCDKSFTRKDSLKK  121 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l---------~k~~~C~~C~k~f~~~~~l~~  121 (167)
                      ...|.|.+|++.|....-|.+|+ ..|...+-+-|..||+.|.+  .+.|         .++|+|..|+|+|.++-.|..
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~-kch~~vkr~lct~cgkgfnd--tfdlkrh~rthtgvrpykc~~c~kaftqrcsles  191 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHL-KCHSDVKRHLCTFCGKGFND--TFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLES  191 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHh-hhccHHHHHHHhhccCcccc--hhhhhhhhccccCccccchhhhhHHHHhhccHHH
Confidence            46799999999999999999999 88998888899999988877  5555         678889999999999988888


Q ss_pred             HHHhhcC-----------CCCCCCCchhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         122 HNRIFHG-----------GADPKLMDEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       122 H~~~h~~-----------~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      |++.-|+           .+.|.|..||..-.....+-.|++.||+..|.
T Consensus       192 hl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Spa  241 (267)
T KOG3576|consen  192 HLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSPA  241 (267)
T ss_pred             HHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCHH
Confidence            8876665           35688999998888888888888888876553


No 5  
>KOG1074|consensus
Probab=99.68  E-value=6.5e-17  Score=128.02  Aligned_cols=57  Identities=23%  Similarity=0.223  Sum_probs=53.5

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhcCCCCCcc
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNEDGEGEPVS  161 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  161 (167)
                      -|.+||+.|...+.|+.|+++|.++|||.|.+|++.|..+-+|+.||.+|....|.+
T Consensus       881 ~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCc
Confidence            499999999999999999999999999999999999999999999999998766543


No 6  
>KOG3623|consensus
Probab=99.61  E-value=1.3e-16  Score=124.72  Aligned_cols=102  Identities=22%  Similarity=0.374  Sum_probs=88.4

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCC-CCcccccchhhhhhccccccc--------------------cCceecccc
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQ-NQPQHTNVIEVALGARANAAF--------------------IDRIRCELC  109 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~-~~~~~c~~c~~~~~~~~~~~l--------------------~k~~~C~~C  109 (167)
                      .....|++|.+.+.+...|..|++..|.. +..|.|..|..+|..++.+--                    .++|+|..|
T Consensus       208 sqlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtEC  287 (1007)
T KOG3623|consen  208 SQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTEC  287 (1007)
T ss_pred             hhhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccccccc
Confidence            34578999999999999999999766644 346999999999987432211                    688999999


Q ss_pred             cccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHh
Q psy8167         110 DKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       110 ~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      ||+|..+-+|+.|+|+|.|+|||.|+.|+|.|...-.+..|+-
T Consensus       288 gKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  288 GKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             chhhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999999999999999999999985


No 7  
>KOG3623|consensus
Probab=99.60  E-value=6e-16  Score=121.15  Aligned_cols=83  Identities=24%  Similarity=0.432  Sum_probs=76.1

Q ss_pred             cCCCCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhc
Q psy8167          48 VVPIDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFH  127 (167)
Q Consensus        48 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~  127 (167)
                      ..++..|.|..|+++|...+.|.+|. -.|+|.+|                     |.|.+|.|+|.++-+|..|+|.|.
T Consensus       889 kte~gmyaCDqCDK~FqKqSSLaRHK-YEHsGqRP---------------------yqC~iCkKAFKHKHHLtEHkRLHS  946 (1007)
T KOG3623|consen  889 KTEDGMYACDQCDKAFQKQSSLARHK-YEHSGQRP---------------------YQCIICKKAFKHKHHLTEHKRLHS  946 (1007)
T ss_pred             cCccccchHHHHHHHHHhhHHHHHhh-hhhcCCCC---------------------cccchhhHhhhhhhhhhhhhhhcc
Confidence            34567899999999999999999998 66999988                     577778889999999999999999


Q ss_pred             CCCCCCCCchhhhcCCHHHHHHHHh
Q psy8167         128 GGADPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       128 ~~~~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      |+|||+|+.|+|.|...-.+..||.
T Consensus       947 GEKPfQCdKClKRFSHSGSYSQHMN  971 (1007)
T KOG3623|consen  947 GEKPFQCDKCLKRFSHSGSYSQHMN  971 (1007)
T ss_pred             CCCcchhhhhhhhcccccchHhhhc
Confidence            9999999999999999999999996


No 8  
>KOG3608|consensus
Probab=99.41  E-value=4.9e-13  Score=97.38  Aligned_cols=97  Identities=18%  Similarity=0.240  Sum_probs=54.3

Q ss_pred             ccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccc----------------------------cc-------cC
Q psy8167          58 LCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANA----------------------------AF-------ID  102 (167)
Q Consensus        58 ~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~----------------------------~l-------~k  102 (167)
                      .|-+.|.++..|++|+ +.|+++|...|+.||..|..++.+                            .|       ..
T Consensus       184 ~Ct~~~~~k~~LreH~-r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn  262 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHI-RTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVN  262 (467)
T ss_pred             hhhhhhccHHHHHHHH-HhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhh
Confidence            4556666666666666 556666666666666655552211                            11       22


Q ss_pred             ceecccccccccChhHHHHHHHh-hcCCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRI-FHGGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      -|+|+.|.-.....+.|..||+. |..++|++|+.|++.|.+.+.|.+|+..|.
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS  316 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS  316 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc
Confidence            34566666666666666666553 334566666666666666666666665553


No 9  
>KOG3608|consensus
Probab=99.39  E-value=4.9e-13  Score=97.36  Aligned_cols=100  Identities=22%  Similarity=0.253  Sum_probs=53.1

Q ss_pred             ccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccc------cCceeccc--ccccccChhHHHHHHHh
Q psy8167          54 IPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAF------IDRIRCEL--CDKSFTRKDSLKKHNRI  125 (167)
Q Consensus        54 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l------~k~~~C~~--C~k~f~~~~~l~~H~~~  125 (167)
                      |+|+.|++.....++|..|++..|..++||+|..|.+.+...+.++-      +-.|.|..  |-..|.+...|++|++.
T Consensus       264 ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS~~~y~C~h~~C~~s~r~~~q~~~H~~e  343 (467)
T KOG3608|consen  264 YKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHSKTVYQCEHPDCHYSVRTYTQMRRHFLE  343 (467)
T ss_pred             ccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhccccceecCCCCCcHHHHHHHHHHHHHHH
Confidence            45555555555555555555555555555555555555554211111      23345544  55555555555555555


Q ss_pred             hcC---CCCCCCCchhhhcCCHHHHHHHHhh
Q psy8167         126 FHG---GADPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       126 h~~---~~~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      ++.   ..+|.|..|++.|.+..+|..|+..
T Consensus       344 vhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~k  374 (467)
T KOG3608|consen  344 VHEGNNPILYACHCCDRFFTSGKSLSAHLMK  374 (467)
T ss_pred             hccCCCCCceeeecchhhhccchhHHHHHHH
Confidence            542   2345666666666666666666554


No 10 
>KOG3576|consensus
Probab=99.36  E-value=1.3e-13  Score=93.26  Aligned_cols=78  Identities=22%  Similarity=0.209  Sum_probs=67.0

Q ss_pred             CCCCcccccchhhhhhccccccc-------cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHH
Q psy8167          78 TQNQPQHTNVIEVALGARANAAF-------IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVV  150 (167)
Q Consensus        78 ~~~~~~~c~~c~~~~~~~~~~~l-------~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  150 (167)
                      .+...|.|.+|++.|.....++-       .+++-|..|||.|..--.|.+|+|+|+|.+||+|..|+|+|.....|..|
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            34457999999999987332222       56778999999999999999999999999999999999999999999999


Q ss_pred             HhhcC
Q psy8167         151 LNEDG  155 (167)
Q Consensus       151 ~~~~~  155 (167)
                      ++.-|
T Consensus       193 l~kvh  197 (267)
T KOG3576|consen  193 LKKVH  197 (267)
T ss_pred             HHHHc
Confidence            98544


No 11 
>PHA00733 hypothetical protein
Probab=99.25  E-value=9.5e-12  Score=80.48  Aligned_cols=86  Identities=14%  Similarity=0.050  Sum_probs=65.9

Q ss_pred             CCcccccccccccCCHHHHHHHHH-HhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcCC
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIR-IFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGG  129 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~-~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~  129 (167)
                      .+++.|.+|.+.|.....|..+.. ..|..                  ..-.++|.|..||+.|.....|..|++.|  .
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~------------------~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~   97 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLT------------------SKAVSPYVCPLCLMPFSSSVSLKQHIRYT--E   97 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcc------------------cCCCCCccCCCCCCcCCCHHHHHHHHhcC--C
Confidence            466788888888887776666521 11111                  00145689999999999999999999975  4


Q ss_pred             CCCCCCchhhhcCCHHHHHHHHhhcCC
Q psy8167         130 ADPKLMDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       130 ~~~~C~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                      .++.|..|++.|.....|..|+..+|+
T Consensus        98 ~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         98 HSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            579999999999999999999987664


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.23  E-value=3.1e-12  Score=69.19  Aligned_cols=42  Identities=17%  Similarity=0.328  Sum_probs=39.1

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHH
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFL  147 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  147 (167)
                      |.|+.||+.|.+.+.|..|+++|+  ++++|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            789999999999999999999988  799999999999987665


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.92  E-value=2.1e-09  Score=84.53  Aligned_cols=97  Identities=14%  Similarity=0.274  Sum_probs=71.8

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhcccccc-------ccCceecccccccccC--------
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAA-------FIDRIRCELCDKSFTR--------  115 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~-------l~k~~~C~~C~k~f~~--------  115 (167)
                      +..+.|+.|++.|. ...|..|+ ..|.  +++.|+ |++.+.. ..+.       ..+++.|..|++.|..        
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~-~~~H--kpv~Cp-Cg~~~~R-~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~  524 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHM-KVFH--EPLQCP-CGVVLEK-EQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVR  524 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHH-HhcC--CCccCC-CCCCcch-hHHHhhhhccCCCCceeCCCCCCccccCccccchh
Confidence            34578999999996 67799999 4452  789998 9865432 1111       1678899999998852        


Q ss_pred             --hhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         116 --KDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       116 --~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                        .+.|..|... .+.+++.|..||+.|..+ .|..|+-.-|
T Consensus       525 d~~s~Lt~HE~~-CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h  564 (567)
T PLN03086        525 DRLRGMSEHESI-CGSRTAPCDSCGRSVMLK-EMDIHQIAVH  564 (567)
T ss_pred             hhhhhHHHHHHh-cCCcceEccccCCeeeeh-hHHHHHHHhh
Confidence              4578889888 688999999999988776 4667776544


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=5.3e-10  Score=51.94  Aligned_cols=26  Identities=19%  Similarity=0.126  Sum_probs=24.0

Q ss_pred             HHHHHHHhhcCCCCCCCCchhhhcCC
Q psy8167         118 SLKKHNRIFHGGADPKLMDEQMARGS  143 (167)
Q Consensus       118 ~l~~H~~~h~~~~~~~C~~C~~~f~~  143 (167)
                      +|.+|+++|.+++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999999999999999999964


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.78  E-value=4.4e-09  Score=56.95  Aligned_cols=38  Identities=13%  Similarity=0.301  Sum_probs=29.5

Q ss_pred             ccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhc
Q psy8167          54 IPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGA   94 (167)
Q Consensus        54 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~   94 (167)
                      |.|+.||+.|.....|..|+ ++|+  ++++|..|++.|..
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~-r~H~--k~~kc~~C~k~f~~   43 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHL-RKHN--TNLKLSNCKRISLR   43 (55)
T ss_pred             cCcchhCCeeccHHHHHHHH-HhcC--CcccCCcccceecc
Confidence            79999999999999999999 6686  56555555544443


No 16 
>KOG3993|consensus
Probab=98.78  E-value=1.5e-09  Score=81.07  Aligned_cols=83  Identities=18%  Similarity=0.221  Sum_probs=64.6

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcC---
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHG---  128 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~---  128 (167)
                      .-|.|+.|...|.+-..|.+|. -..                     .....|+|+.|+|+|.-..+|-.|.|.|..   
T Consensus       266 GdyiCqLCK~kYeD~F~LAQHr-C~R---------------------IV~vEYrCPEC~KVFsCPANLASHRRWHKPR~e  323 (500)
T KOG3993|consen  266 GDYICQLCKEKYEDAFALAQHR-CPR---------------------IVHVEYRCPECDKVFSCPANLASHRRWHKPRPE  323 (500)
T ss_pred             HHHHHHHHHHhhhhHHHHhhcc-CCe---------------------eEEeeecCCcccccccCchhhhhhhcccCCchh
Confidence            3478888888888887777774 211                     114458999999999999999999998742   


Q ss_pred             -----C-------------------------CCCCCCchhhhcCCHHHHHHHHhhcCC
Q psy8167         129 -----G-------------------------ADPKLMDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       129 -----~-------------------------~~~~C~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                           .                         .-|.|.+|+|.|.+...|+.|+.+|+.
T Consensus       324 aa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~  381 (500)
T KOG3993|consen  324 AAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQR  381 (500)
T ss_pred             hhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhc
Confidence                 1                         127899999999999999999988774


No 17 
>PHA00616 hypothetical protein
Probab=98.73  E-value=8.1e-09  Score=53.27  Aligned_cols=33  Identities=21%  Similarity=0.310  Sum_probs=18.8

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMD  136 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~  136 (167)
                      |.|..||+.|..++.|.+|++.||+++++.|+.
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            455555555555555555555555555555543


No 18 
>PHA00732 hypothetical protein
Probab=98.73  E-value=7.2e-09  Score=61.19  Aligned_cols=48  Identities=19%  Similarity=0.135  Sum_probs=40.4

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      +|.|..||+.|.....|..|++.+|.  ++.|..|++.|.   .|..|..++.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--CCccCCCCCEeC---ChhhhhcccC
Confidence            47899999999999999999985343  468999999998   4789987654


No 19 
>PHA00616 hypothetical protein
Probab=98.72  E-value=5.6e-09  Score=53.85  Aligned_cols=34  Identities=3%  Similarity=-0.215  Sum_probs=31.3

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhhcCCCCCccccc
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNEDGEGEPVSITV  164 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~  164 (167)
                      ||+|..||+.|....+|.+|++.||+.+|..+.-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6899999999999999999999999999887653


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.72  E-value=5.5e-08  Score=76.66  Aligned_cols=99  Identities=13%  Similarity=0.286  Sum_probs=59.2

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccc--hhhhhhccccccccCceecccccccccChhHHHHHHHhhcCC
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNV--IEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGG  129 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~--c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~  129 (167)
                      ..-.|..|........ |..|. ... ....-.|+.  |+..|..   ..+.+.+.|+.||+.|. ...|..|+.+||  
T Consensus       406 ~~V~C~NC~~~i~l~~-l~lHe-~~C-~r~~V~Cp~~~Cg~v~~r---~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--  476 (567)
T PLN03086        406 DTVECRNCKHYIPSRS-IALHE-AYC-SRHNVVCPHDGCGIVLRV---EEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--  476 (567)
T ss_pred             CeEECCCCCCccchhH-HHHHH-hhC-CCcceeCCcccccceeec---cccccCccCCCCCCccc-hHHHHHHHHhcC--
Confidence            3457999988755544 66887 433 333445653  6666632   33344456777776664 456666766654  


Q ss_pred             CCCCCCchhhhcCCHHHHHHHHhhcCCCCCcc
Q psy8167         130 ADPKLMDEQMARGSADFLEVVLNEDGEGEPVS  161 (167)
Q Consensus       130 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  161 (167)
                      +++.|+ ||+.+ ....|..|++.|.+.+|..
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~  506 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLIT  506 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCcee
Confidence            566676 76544 4566666766666665543


No 21 
>PHA00733 hypothetical protein
Probab=98.61  E-value=8.2e-08  Score=62.19  Aligned_cols=54  Identities=31%  Similarity=0.551  Sum_probs=45.7

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcC
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHG  128 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~  128 (167)
                      .++|.|..|++.|.....|..|+ ..|.  .                     +|.|.+|++.|.....|..|+...|+
T Consensus        71 ~kPy~C~~Cgk~Fss~s~L~~H~-r~h~--~---------------------~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         71 VSPYVCPLCLMPFSSSVSLKQHI-RYTE--H---------------------SKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCccCCCCCCcCCCHHHHHHHH-hcCC--c---------------------CccCCCCCCccCCHHHHHHHHHHhcC
Confidence            57899999999999999999998 5442  1                     26899999999999999999998775


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.46  E-value=7.3e-08  Score=44.63  Aligned_cols=25  Identities=20%  Similarity=0.375  Sum_probs=20.1

Q ss_pred             HHHHHHHHhcCCCCcccccchhhhhh
Q psy8167          68 SLKKHIRIFHTQNQPQHTNVIEVALG   93 (167)
Q Consensus        68 ~l~~H~~~~h~~~~~~~c~~c~~~~~   93 (167)
                      +|.+|+ +.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~-~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHM-RTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHH-HHHSSSSSEEESSSSEEES
T ss_pred             CHHHHh-hhcCCCCCCCCCCCcCeeC
Confidence            488999 6799999987777776664


No 23 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.36  E-value=8.5e-07  Score=48.67  Aligned_cols=51  Identities=20%  Similarity=0.129  Sum_probs=40.4

Q ss_pred             ceecccccccccChhHHHHHHHhhcCC--CCCCCCchhhhcCCHHHHHHHHhhcCC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGG--ADPKLMDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~--~~~~C~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                      .|.|++||+. .....|..|....|..  +.+.|++|...+..  +|.+|+..+|+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHHHHhcC
Confidence            4889999994 5567899998776653  46999999987664  89999987663


No 24 
>KOG3993|consensus
Probab=98.32  E-value=3.1e-07  Score=69.00  Aligned_cols=76  Identities=26%  Similarity=0.433  Sum_probs=49.0

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCc-c--cccchhhhhhccc---------cccccCceecccccccccChhHH
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQP-Q--HTNVIEVALGARA---------NAAFIDRIRCELCDKSFTRKDSL  119 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~-~--~c~~c~~~~~~~~---------~~~l~k~~~C~~C~k~f~~~~~l  119 (167)
                      ..|+|+.|++.|.-..+|..|.+| |.-... -  .-+.-.+....+.         ...-..-|.|.+|+|.|.+..-|
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRW-HKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYL  372 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRW-HKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYL  372 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcc-cCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHH
Confidence            459999999999999999999977 533221 1  0000000000000         00113358999999999999999


Q ss_pred             HHHHHhhcC
Q psy8167         120 KKHNRIFHG  128 (167)
Q Consensus       120 ~~H~~~h~~  128 (167)
                      +.|+-+|+.
T Consensus       373 rKHqlthq~  381 (500)
T KOG3993|consen  373 RKHQLTHQR  381 (500)
T ss_pred             HHhHHhhhc
Confidence            999887753


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.32  E-value=1.6e-06  Score=47.54  Aligned_cols=53  Identities=26%  Similarity=0.479  Sum_probs=40.1

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcC
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHG  128 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~  128 (167)
                      .|.|++|++ ..+...|..|....|..+.                    +.+.|++|...+.  .+|..|+..+|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~--------------------~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSES--------------------KNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCC--------------------CCccCCCchhhhh--hHHHHHHHHhcC
Confidence            489999999 5667889999988887653                    1256777776544  489999988764


No 26 
>PHA00732 hypothetical protein
Probab=98.26  E-value=7.1e-07  Score=52.73  Aligned_cols=46  Identities=33%  Similarity=0.582  Sum_probs=35.5

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHh
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      +|.|..|++.|.....|..|++..|.+                        +.|+.||+.|.   .+..|+++
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~------------------------~~C~~CgKsF~---~l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL------------------------TKCPVCNKSYR---RLNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC------------------------CccCCCCCEeC---Chhhhhcc
Confidence            488999999999999999999434542                        35778888887   36667754


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.24  E-value=9.1e-07  Score=39.65  Aligned_cols=22  Identities=45%  Similarity=0.934  Sum_probs=13.7

Q ss_pred             eecccccccccChhHHHHHHHh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      |.|+.|++.|..+..|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666655


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.14  E-value=8.1e-07  Score=39.81  Aligned_cols=23  Identities=13%  Similarity=-0.148  Sum_probs=21.2

Q ss_pred             CCCCchhhhcCCHHHHHHHHhhc
Q psy8167         132 PKLMDEQMARGSADFLEVVLNED  154 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~~  154 (167)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999999874


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.02  E-value=5.4e-06  Score=37.24  Aligned_cols=22  Identities=41%  Similarity=0.890  Sum_probs=10.7

Q ss_pred             ecccccccccChhHHHHHHHhh
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIF  126 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h  126 (167)
                      .|++|++.|.....|..|+++|
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHHhh
Confidence            4555555555555555555544


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.99  E-value=3.1e-06  Score=38.07  Aligned_cols=24  Identities=8%  Similarity=-0.236  Sum_probs=20.3

Q ss_pred             CCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         132 PKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      |.|++|++.|.+...|..|++.||
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            579999999999999999999875


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.91  E-value=5.4e-06  Score=51.19  Aligned_cols=49  Identities=24%  Similarity=0.349  Sum_probs=21.3

Q ss_pred             cccccccccChhHHHHHHHhhcC-----------------------CCCCCCCchhhhcCCHHHHHHHHhhc
Q psy8167         106 CELCDKSFTRKDSLKKHNRIFHG-----------------------GADPKLMDEQMARGSADFLEVVLNED  154 (167)
Q Consensus       106 C~~C~k~f~~~~~l~~H~~~h~~-----------------------~~~~~C~~C~~~f~~~~~l~~H~~~~  154 (167)
                      |..|+..|.....|..|+...|+                       ...+.|..|++.|.+...|..|++.+
T Consensus         2 C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            66677777777777777655443                       12488999999999999999999964


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.89  E-value=9.8e-06  Score=50.01  Aligned_cols=72  Identities=25%  Similarity=0.520  Sum_probs=21.8

Q ss_pred             cccccccccCCHHHHHHHHHHhcCCCCcccccc-hhhhhhccccccccCceecccccccccChhHHHHHHHhh
Q psy8167          55 PCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNV-IEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIF  126 (167)
Q Consensus        55 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~-c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h  126 (167)
                      .|..|+..|.....|..|+...|.-..+-.-.. -...+.......+...+.|..|++.|.....|..||+.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            489999999999999999988785543310000 000111100111234589999999999999999999974


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.89  E-value=5.6e-06  Score=38.55  Aligned_cols=23  Identities=30%  Similarity=0.788  Sum_probs=11.4

Q ss_pred             eecccccccccChhHHHHHHHhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIF  126 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h  126 (167)
                      |.|..|++.|.....|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            44555555555555555554443


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.85  E-value=6.6e-06  Score=43.45  Aligned_cols=33  Identities=9%  Similarity=-0.172  Sum_probs=21.8

Q ss_pred             CCCCCCCCchhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         128 GGADPKLMDEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       128 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      .+.|..|++|+..+....+|++|+...|+.+|.
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~~   53 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKPG   53 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS--
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccCC
Confidence            456788888888888888888888888877764


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.80  E-value=1.6e-05  Score=36.95  Aligned_cols=26  Identities=8%  Similarity=-0.202  Sum_probs=23.9

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhhcCC
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                      +|.|..|++.|.+...|..|++.|+.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999998864


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.58  E-value=6.1e-05  Score=55.08  Aligned_cols=69  Identities=25%  Similarity=0.459  Sum_probs=43.9

Q ss_pred             CCcccccc--cccccCCHHHHHHHHHHhcCCCCccccc--chhhhhhccccccccCceecccccccccChhHHHHHHH
Q psy8167          51 IDRIPCTL--CDKTFTRKDSLKKHIRIFHTQNQPQHTN--VIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNR  124 (167)
Q Consensus        51 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~c~--~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~  124 (167)
                      ++||+|++  |++.|+....|.-|+..-|...+...-+  .--..|     ..-.|+|+|++|+|.|.....|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F-----~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIF-----SAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccc-----cccCCceeccccchhhccCccceeccc
Confidence            48999987  9999999999999983323211111111  000001     111577888888888888888877754


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.54  E-value=0.0001  Score=39.03  Aligned_cols=31  Identities=19%  Similarity=0.383  Sum_probs=23.0

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCC
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGAD  131 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~  131 (167)
                      ..+-.|++|+..+.+..+|++|+.++|+.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            5567899999999999999999999998775


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.52  E-value=0.0001  Score=33.43  Aligned_cols=23  Identities=9%  Similarity=-0.092  Sum_probs=13.1

Q ss_pred             CCCCchhhhcCCHHHHHHHHhhc
Q psy8167         132 PKLMDEQMARGSADFLEVVLNED  154 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~~  154 (167)
                      |.|..|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            34555666666666666665543


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.35  E-value=5e-05  Score=55.50  Aligned_cols=53  Identities=15%  Similarity=0.151  Sum_probs=44.6

Q ss_pred             cCceeccc--ccccccChhHHHHHHHhhc-------------------CCCCCCCCchhhhcCCHHHHHHHHhh
Q psy8167         101 IDRIRCEL--CDKSFTRKDSLKKHNRIFH-------------------GGADPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       101 ~k~~~C~~--C~k~f~~~~~l~~H~~~h~-------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +|+|+|++  |.|.|.....|+-|+..-|                   ..|||.|.+|+|.+..-.-|+-|...
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            58899987  8999999999999976433                   14899999999999999988888764


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.33  E-value=0.0002  Score=32.39  Aligned_cols=24  Identities=42%  Similarity=0.737  Sum_probs=21.4

Q ss_pred             eecccccccccChhHHHHHHHhhc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFH  127 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~  127 (167)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            479999999999999999999754


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=97.22  E-value=0.00019  Score=48.27  Aligned_cols=38  Identities=21%  Similarity=0.368  Sum_probs=33.6

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCH
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSA  144 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  144 (167)
                      +|.|. |++   ....+++|.++|.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            58998 997   777889999999999999999999988754


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.19  E-value=0.00036  Score=31.30  Aligned_cols=23  Identities=35%  Similarity=0.670  Sum_probs=11.1

Q ss_pred             eecccccccccChhHHHHHHHhhc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFH  127 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~  127 (167)
                      |+|+.|..... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34555555554 555555555544


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.15  E-value=0.00014  Score=32.72  Aligned_cols=24  Identities=13%  Similarity=-0.042  Sum_probs=19.3

Q ss_pred             CCCCchhhhcCCHHHHHHHHhhcCC
Q psy8167         132 PKLMDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                      |+|..|++... ...|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999998 9999999998653


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.12  E-value=0.00019  Score=32.58  Aligned_cols=21  Identities=14%  Similarity=-0.137  Sum_probs=12.8

Q ss_pred             CCCchhhhcCCHHHHHHHHhh
Q psy8167         133 KLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       133 ~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      .|.+|++.|.+...|+.|++.
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCcCCHHHHHHHHCc
Confidence            466666666666666666653


No 45 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.91  E-value=0.0008  Score=30.41  Aligned_cols=23  Identities=39%  Similarity=0.869  Sum_probs=20.8

Q ss_pred             eecccccccccChhHHHHHHHhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIF  126 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h  126 (167)
                      |.|.+|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57999999999999999999863


No 46 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.64  E-value=0.00046  Score=31.94  Aligned_cols=21  Identities=10%  Similarity=-0.189  Sum_probs=12.5

Q ss_pred             CCCCchhhhcCCHHHHHHHHh
Q psy8167         132 PKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666666554


No 47 
>KOG1146|consensus
Probab=96.50  E-value=0.00073  Score=58.00  Aligned_cols=103  Identities=15%  Similarity=0.132  Sum_probs=71.2

Q ss_pred             CCCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhcc----ccccccCceecccccccccChhHHHHHHHh
Q psy8167          50 PIDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGAR----ANAAFIDRIRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~----~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      ..+.++|+.|+..|++...|..||+..|.....-.|.. +..-...    ....-.++|.|..|...+..+.+|.+|+..
T Consensus       462 ~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~-gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  462 FFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKA-GQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccccCCccchhhhhHHHhhhcccccccccchhHhHh-ccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            35779999999999999999999977675443312211 0000000    001116778999999999999999998764


Q ss_pred             hcC-------------------------------------------CCCCCCCchhhhcCCHHHHHHHHhh
Q psy8167         126 FHG-------------------------------------------GADPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       126 h~~-------------------------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      -..                                           .-.+.|.+|++--.-..+|+-|+..
T Consensus       541 ~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc~yetniarnlrihmts  611 (1406)
T KOG1146|consen  541 DLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVCSYETNIARNLRIHMTA  611 (1406)
T ss_pred             HhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhhcchhhhhhcccccccc
Confidence            210                                           1137899999988888889889874


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=96.29  E-value=0.0021  Score=43.29  Aligned_cols=38  Identities=11%  Similarity=0.121  Sum_probs=31.5

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhc
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGA   94 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~   94 (167)
                      -+|.|. |+.   ....+.+|. ++|.++++|.|..|+..|..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~-ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHN-RVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHH-HHhcCCccEECCCCCceeEE
Confidence            469998 997   677788999 88999999888888777654


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.15  E-value=0.0023  Score=29.52  Aligned_cols=22  Identities=36%  Similarity=0.833  Sum_probs=20.1

Q ss_pred             eecccccccccChhHHHHHHHh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      |.|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6799999999999999999875


No 50 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.94  E-value=0.0034  Score=33.85  Aligned_cols=29  Identities=10%  Similarity=-0.138  Sum_probs=21.2

Q ss_pred             cCCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         127 HGGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       127 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      .|+.-+.|+.||+.|.....+.+|+...|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            45666778888888888888888876433


No 51 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=95.82  E-value=0.022  Score=35.79  Aligned_cols=27  Identities=19%  Similarity=0.415  Sum_probs=20.6

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCC
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQ   79 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~   79 (167)
                      +...|..|+.+..- ..+..|++..|..
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~   36 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHI   36 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhccc
Confidence            55789999987666 7788999756643


No 52 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.75  E-value=0.0083  Score=27.16  Aligned_cols=19  Identities=16%  Similarity=-0.225  Sum_probs=9.0

Q ss_pred             CCCchhhhcCCHHHHHHHHh
Q psy8167         133 KLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       133 ~C~~C~~~f~~~~~l~~H~~  152 (167)
                      .|..||+.| ....|.+|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            345555555 4444444443


No 53 
>KOG1146|consensus
Probab=95.56  E-value=0.012  Score=50.90  Aligned_cols=52  Identities=17%  Similarity=0.275  Sum_probs=43.4

Q ss_pred             CceecccccccccChhHHHHHHHhhc-------------------------CCCCCCCCchhhhcCCHHHHHHHHhh
Q psy8167         102 DRIRCELCDKSFTRKDSLKKHNRIFH-------------------------GGADPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       102 k~~~C~~C~k~f~~~~~l~~H~~~h~-------------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +.+.|+.|+-.|.....|..|||.-|                         +.++|.|..|..++....+|..|+..
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            45788888888888888888888722                         24689999999999999999999963


No 54 
>KOG2231|consensus
Probab=95.55  E-value=0.021  Score=46.63  Aligned_cols=100  Identities=22%  Similarity=0.280  Sum_probs=62.5

Q ss_pred             ccccccccccC---------------CHHHHHHHHHHhcCCCCcccccchhhh---hhc------cccccc---------
Q psy8167          54 IPCTLCDKTFT---------------RKDSLKKHIRIFHTQNQPQHTNVIEVA---LGA------RANAAF---------  100 (167)
Q Consensus        54 ~~C~~C~~~f~---------------~~~~l~~H~~~~h~~~~~~~c~~c~~~---~~~------~~~~~l---------  100 (167)
                      +.|.+|++.|.               ....|..|+...|.   .+.|..|...   |..      +..+..         
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H~---~~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~  176 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQHK---LHLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDD  176 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhhh---hhccccccccceeeeeeeehehHHHHHHHHhcCCCcc
Confidence            55888888773               67899999977774   3555555432   211      000000         


Q ss_pred             ---cCceecccccccccChhHHHHHHHhhcCCCCCCC---CchhhhcCCHHHHHHHHhhcCCC
Q psy8167         101 ---IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKL---MDEQMARGSADFLEVVLNEDGEG  157 (167)
Q Consensus       101 ---~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C---~~C~~~f~~~~~l~~H~~~~~~~  157 (167)
                         ...-.|..|...|.....|.+|++.+|-. -.-|   +.++..|.....|..|-+.+|..
T Consensus       177 ~s~rGhp~C~~C~~~fld~~el~rH~~~~h~~-chfC~~~~~~neyy~~~~dLe~HfR~~Hfl  238 (669)
T KOG2231|consen  177 ESCRGHPLCKFCHERFLDDDELYRHLRFDHEF-CHFCDYKTGQNEYYNDYDDLEEHFRKGHFL  238 (669)
T ss_pred             ccccCCccchhhhhhhccHHHHHHhhccceeh-eeecCcccccchhcccchHHHHHhhhcCcc
Confidence               11125888888999998988888875522 1222   22357777888888888876643


No 55 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.45  E-value=0.01  Score=29.00  Aligned_cols=23  Identities=9%  Similarity=-0.224  Sum_probs=17.9

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +|.|.+|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            56788888888888888888763


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.25  E-value=0.011  Score=31.89  Aligned_cols=32  Identities=19%  Similarity=0.384  Sum_probs=27.5

Q ss_pred             ccCCCCcccccccccccCCHHHHHHHHHHhcC
Q psy8167          47 PVVPIDRIPCTLCDKTFTRKDSLKKHIRIFHT   78 (167)
Q Consensus        47 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~   78 (167)
                      ...++..+.|+-|++.|.....+.+|....|.
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34567789999999999999999999977774


No 57 
>KOG2893|consensus
Probab=94.80  E-value=0.0095  Score=42.22  Aligned_cols=32  Identities=19%  Similarity=0.387  Sum_probs=24.1

Q ss_pred             cccccccccCCHHHHHHHHHHhcCCCCcccccchhhh
Q psy8167          55 PCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVA   91 (167)
Q Consensus        55 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~   91 (167)
                      .|=+|++.|....-|..|++..|     |+|-+|-+.
T Consensus        12 wcwycnrefddekiliqhqkakh-----fkchichkk   43 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKAKH-----FKCHICHKK   43 (341)
T ss_pred             eeeecccccchhhhhhhhhhhcc-----ceeeeehhh
Confidence            48899999999999999996655     445544443


No 58 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=94.35  E-value=0.072  Score=33.47  Aligned_cols=25  Identities=4%  Similarity=-0.120  Sum_probs=23.0

Q ss_pred             CCC----CchhhhcCCHHHHHHHHhhcCC
Q psy8167         132 PKL----MDEQMARGSADFLEVVLNEDGE  156 (167)
Q Consensus       132 ~~C----~~C~~~f~~~~~l~~H~~~~~~  156 (167)
                      |.|    ..|++.+.+...|++|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998774


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.95  E-value=0.055  Score=26.29  Aligned_cols=21  Identities=38%  Similarity=0.749  Sum_probs=19.3

Q ss_pred             cccccccccccCCHHHHHHHH
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHI   73 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~   73 (167)
                      +|.|..|++.|.....+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            588999999999999998988


No 60 
>KOG2186|consensus
Probab=93.85  E-value=0.033  Score=39.85  Aligned_cols=46  Identities=15%  Similarity=0.156  Sum_probs=34.8

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      |.|..||-...- ..+.+|+.. .....|.|..|++.|-. ..++.|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~sr-Crn~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSR-CRNAYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHh-ccCCeeEEeeccccccc-chhhhhhh
Confidence            678888866544 456678877 44478999999999988 78888875


No 61 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.24  E-value=0.065  Score=25.94  Aligned_cols=10  Identities=10%  Similarity=-0.546  Sum_probs=5.9

Q ss_pred             CCCCCCchhh
Q psy8167         130 ADPKLMDEQM  139 (167)
Q Consensus       130 ~~~~C~~C~~  139 (167)
                      .+..|++|+.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4566666653


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.07  E-value=0.016  Score=44.62  Aligned_cols=59  Identities=20%  Similarity=0.158  Sum_probs=52.9

Q ss_pred             CceecccccccccChhHHHHHHH--hhcCC--CCCCCC--chhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         102 DRIRCELCDKSFTRKDSLKKHNR--IFHGG--ADPKLM--DEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       102 k~~~C~~C~k~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      ..+.|..|...|.....+..|.+  .|.++  +++.|.  .|++.|.+...+.+|...|....+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            36789999999999999999999  78999  899999  7999999999999999988765543


No 63 
>KOG2482|consensus
Probab=93.06  E-value=0.14  Score=38.36  Aligned_cols=100  Identities=19%  Similarity=0.334  Sum_probs=65.0

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCC-Ccccccchhhh-----------------------hhc--cc---cccc---
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQN-QPQHTNVIEVA-----------------------LGA--RA---NAAF---  100 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~-~~~~c~~c~~~-----------------------~~~--~~---~~~l---  100 (167)
                      .+.|-.|.+.|..+..|..||+.....+ .| +-....+-                       +..  .+   +..+   
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinP-knreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed  273 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINP-KNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNED  273 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCC-CccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcC
Confidence            4889999999999999999995532111 12 11111110                       000  00   0000   


Q ss_pred             ---cCceecccccccccChhHHHHHHHhhcC---------------------------CCCCCCCchhhhcCCHHHHHHH
Q psy8167         101 ---IDRIRCELCDKSFTRKDSLKKHNRIFHG---------------------------GADPKLMDEQMARGSADFLEVV  150 (167)
Q Consensus       101 ---~k~~~C~~C~k~f~~~~~l~~H~~~h~~---------------------------~~~~~C~~C~~~f~~~~~l~~H  150 (167)
                         .-...|-.|.........|..||.+-|.                           .+...|..|.-.|-....|..|
T Consensus       274 ~a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~h  353 (423)
T KOG2482|consen  274 DAEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIH  353 (423)
T ss_pred             CCCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhh
Confidence               1113799999888888899999987663                           1235588899999999999999


Q ss_pred             Hhh
Q psy8167         151 LNE  153 (167)
Q Consensus       151 ~~~  153 (167)
                      +..
T Consensus       354 m~e  356 (423)
T KOG2482|consen  354 MVE  356 (423)
T ss_pred             ccc
Confidence            963


No 64 
>KOG4173|consensus
Probab=92.87  E-value=0.053  Score=37.65  Aligned_cols=75  Identities=17%  Similarity=0.318  Sum_probs=56.2

Q ss_pred             cccccc--cccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhc---
Q psy8167          53 RIPCTL--CDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFH---  127 (167)
Q Consensus        53 ~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~---  127 (167)
                      .|.|++  |-..|.....+..|....|+                         ..|..|.+.|.....|..|+..-|   
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~-------------------------~sCs~C~r~~Pt~hLLd~HI~E~HDs~  133 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG-------------------------NSCSFCKRAFPTGHLLDAHILEWHDSL  133 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc-------------------------chhHHHHHhCCchhhhhHHHHHHHHHH
Confidence            366776  66777777777777633332                         258999999999999988876544   


Q ss_pred             -------CCCCCCCCc--hhhhcCCHHHHHHHHh
Q psy8167         128 -------GGADPKLMD--EQMARGSADFLEVVLN  152 (167)
Q Consensus       128 -------~~~~~~C~~--C~~~f~~~~~l~~H~~  152 (167)
                             |...|+|-+  |+-.|.+...-+.|+-
T Consensus       134 Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I  167 (253)
T KOG4173|consen  134 FQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMI  167 (253)
T ss_pred             HHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHH
Confidence                   345688987  9999999999888884


No 65 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=92.44  E-value=0.068  Score=33.57  Aligned_cols=30  Identities=17%  Similarity=0.275  Sum_probs=17.6

Q ss_pred             ccccchhhhhhccccccccCceecccccccccCh
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDKSFTRK  116 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~  116 (167)
                      ..|+.||..|..  ...  .+..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYD--Lnk--~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD--LNK--DPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc--CCC--CCccCCCCCCccCcc
Confidence            456666666665  332  445577777666554


No 66 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=92.05  E-value=0.087  Score=26.23  Aligned_cols=33  Identities=21%  Similarity=0.371  Sum_probs=19.6

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR  141 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  141 (167)
                      ..|+.|+..|.-...     ++..++...+|+.|+..|
T Consensus         3 i~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             EECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            357777777666544     112344467777777666


No 67 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=91.66  E-value=0.029  Score=39.77  Aligned_cols=43  Identities=21%  Similarity=0.258  Sum_probs=26.6

Q ss_pred             CceecccccccccChhHHHHHHHhhc----------CCCC-----CCCCchhhhcCCH
Q psy8167         102 DRIRCELCDKSFTRKDSLKKHNRIFH----------GGAD-----PKLMDEQMARGSA  144 (167)
Q Consensus       102 k~~~C~~C~k~f~~~~~l~~H~~~h~----------~~~~-----~~C~~C~~~f~~~  144 (167)
                      +.+.|++|++.|..........+.-.          +.-|     ..|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            45678888887777655444443211          1112     5699999988755


No 68 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.34  E-value=0.13  Score=25.44  Aligned_cols=33  Identities=18%  Similarity=0.248  Sum_probs=20.6

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR  141 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  141 (167)
                      +.|+.|+..|.-....     +-..+...+|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            4677777777766552     22334467777777766


No 69 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.13  E-value=0.11  Score=40.09  Aligned_cols=108  Identities=18%  Similarity=0.181  Sum_probs=71.6

Q ss_pred             CcccccccccccCCHHHHHHHHHH-hcCCC--Cccccc--chhhhhhccccccc--------------------------
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRI-FHTQN--QPQHTN--VIEVALGARANAAF--------------------------  100 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~c~--~c~~~~~~~~~~~l--------------------------  100 (167)
                      .++.|..|...|.....|..|.+. .|.++  +++.|+  .|++.|..  ...+                          
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  365 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSR--NDALKRHILLHTSISPAKEKLLNSSSKFSP  365 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccc--cccccCCcccccCCCccccccccCcccccc
Confidence            368889999999999999999842 78888  888888  78888866  3322                          


Q ss_pred             ------------------cCceec--ccccccccChhHHHHHHHhhcCCC--CCCCCchhhhcCCHHHHHHHHhhcCCCC
Q psy8167         101 ------------------IDRIRC--ELCDKSFTRKDSLKKHNRIFHGGA--DPKLMDEQMARGSADFLEVVLNEDGEGE  158 (167)
Q Consensus       101 ------------------~k~~~C--~~C~k~f~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~~~~~~  158 (167)
                                        .+.+.+  ..|...+.....+..|...|....  .+.+..|.+.|.....+..|++.+....
T Consensus       366 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  445 (467)
T COG5048         366 LLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHA  445 (467)
T ss_pred             ccCCCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCC
Confidence                              000111  224445555555555555544444  4556678888888888888888776555


Q ss_pred             Ccc
Q psy8167         159 PVS  161 (167)
Q Consensus       159 ~~~  161 (167)
                      ++.
T Consensus       446 ~~~  448 (467)
T COG5048         446 PLL  448 (467)
T ss_pred             cee
Confidence            443


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.78  E-value=0.13  Score=26.89  Aligned_cols=9  Identities=33%  Similarity=1.040  Sum_probs=4.9

Q ss_pred             eeccccccc
Q psy8167         104 IRCELCDKS  112 (167)
Q Consensus       104 ~~C~~C~k~  112 (167)
                      ++|+.||..
T Consensus        22 ~~Cp~CG~~   30 (46)
T PRK00398         22 VRCPYCGYR   30 (46)
T ss_pred             eECCCCCCe
Confidence            456666543


No 71 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.63  E-value=0.15  Score=27.98  Aligned_cols=31  Identities=10%  Similarity=0.084  Sum_probs=16.2

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      |.|+.||..-..+..--+     .-..+|.|+.||.
T Consensus        28 F~CPnCGe~~I~Rc~~CR-----k~g~~Y~Cp~CGF   58 (61)
T COG2888          28 FPCPNCGEVEIYRCAKCR-----KLGNPYRCPKCGF   58 (61)
T ss_pred             eeCCCCCceeeehhhhHH-----HcCCceECCCcCc
Confidence            556666644444332111     1234788888875


No 72 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.36  E-value=0.38  Score=36.26  Aligned_cols=78  Identities=19%  Similarity=0.171  Sum_probs=46.5

Q ss_pred             cccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcCCCCCCC
Q psy8167          55 PCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKL  134 (167)
Q Consensus        55 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C  134 (167)
                      .|..|...|-....|..|++..|     -.|-+|.+.-..  ..            .-|.....|..|.+.    .-|.|
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-----E~ChICD~v~p~--~~------------QYFK~Y~~Le~HF~~----~hy~c  278 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-----EACHICDMVGPI--RY------------QYFKSYEDLEAHFRN----AHYCC  278 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-----hhhhhhhccCcc--ch------------hhhhCHHHHHHHhhc----CceEE
Confidence            59999999999999999997766     345555443211  00            134444555555443    23555


Q ss_pred             Cc--h----hhhcCCHHHHHHHHhhcC
Q psy8167         135 MD--E----QMARGSADFLEVVLNEDG  155 (167)
Q Consensus       135 ~~--C----~~~f~~~~~l~~H~~~~~  155 (167)
                      ..  |    -..|.....|..|+...|
T Consensus       279 t~qtc~~~k~~vf~~~~el~~h~~~~h  305 (493)
T COG5236         279 TFQTCRVGKCYVFPYHTELLEHLTRFH  305 (493)
T ss_pred             EEEEEecCcEEEeccHHHHHHHHHHHh
Confidence            53  3    145666667777765433


No 73 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=90.14  E-value=0.15  Score=25.40  Aligned_cols=33  Identities=24%  Similarity=0.261  Sum_probs=16.4

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR  141 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  141 (167)
                      +.|+.|+..|.-.....     ...+....|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCEEECCCCCCEE
Confidence            45666666655543321     1112245666666555


No 74 
>KOG2893|consensus
Probab=89.91  E-value=0.058  Score=38.38  Aligned_cols=41  Identities=20%  Similarity=0.216  Sum_probs=33.1

Q ss_pred             cccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHH
Q psy8167         106 CELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVV  150 (167)
Q Consensus       106 C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  150 (167)
                      |=+|++.|.....|.+|++.    +-|+|.+|-|...+.--|.-|
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceee
Confidence            78899999999999999876    679999998776665555444


No 75 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.89  E-value=0.17  Score=23.09  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=5.0

Q ss_pred             ccccccccc
Q psy8167         106 CELCDKSFT  114 (167)
Q Consensus       106 C~~C~k~f~  114 (167)
                      |+.||..|.
T Consensus        17 Cp~CG~~F~   25 (26)
T PF10571_consen   17 CPHCGYDFE   25 (26)
T ss_pred             CCCCCCCCc
Confidence            555655553


No 76 
>KOG2231|consensus
Probab=89.75  E-value=0.43  Score=39.32  Aligned_cols=53  Identities=25%  Similarity=0.465  Sum_probs=33.6

Q ss_pred             cccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhc
Q psy8167          55 PCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFH  127 (167)
Q Consensus        55 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~  127 (167)
                      .|..|...|.....|.+|++..|     |.|..|.+.               ..++.-|.....|..|-+.+|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~---------------~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYK---------------TGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecCcc---------------cccchhcccchHHHHHhhhcC
Confidence            58888888888888888885544     445554321               112345666677777777655


No 77 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.36  E-value=0.28  Score=23.88  Aligned_cols=9  Identities=11%  Similarity=-0.382  Sum_probs=5.3

Q ss_pred             CCCCCchhh
Q psy8167         131 DPKLMDEQM  139 (167)
Q Consensus       131 ~~~C~~C~~  139 (167)
                      |..|++|+.
T Consensus        18 p~~CP~Cg~   26 (34)
T cd00729          18 PEKCPICGA   26 (34)
T ss_pred             CCcCcCCCC
Confidence            456666654


No 78 
>KOG2482|consensus
Probab=89.34  E-value=0.37  Score=36.23  Aligned_cols=70  Identities=26%  Similarity=0.524  Sum_probs=41.1

Q ss_pred             ccccccccccC-CHHHHHHHHHHhcCCC--CcccccchhhhhhccccccccCceecccccccccChhHHHHHHHh
Q psy8167          54 IPCTLCDKTFT-RKDSLKKHIRIFHTQN--QPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus        54 ~~C~~C~~~f~-~~~~l~~H~~~~h~~~--~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      ..|-.|+..+. .++....|+...|.-.  .|-.--.+.+....  ...-...+.|-.|.+.|..+..|+.||+.
T Consensus       145 lqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLeh--LkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  145 LQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEH--LKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHH--HHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            56888887655 6677778876666322  11111111111100  00002346899999999999999999985


No 79 
>PHA00626 hypothetical protein
Probab=88.83  E-value=0.075  Score=28.78  Aligned_cols=14  Identities=14%  Similarity=-0.055  Sum_probs=8.9

Q ss_pred             CCCCCchhhhcCCH
Q psy8167         131 DPKLMDEQMARGSA  144 (167)
Q Consensus       131 ~~~C~~C~~~f~~~  144 (167)
                      .|+|..||+.|..-
T Consensus        23 rYkCkdCGY~ft~~   36 (59)
T PHA00626         23 DYVCCDCGYNDSKD   36 (59)
T ss_pred             ceEcCCCCCeechh
Confidence            56666676666544


No 80 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=88.35  E-value=0.77  Score=28.96  Aligned_cols=22  Identities=18%  Similarity=0.434  Sum_probs=17.7

Q ss_pred             CcccccccccccCCHHHHHHHH
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHI   73 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~   73 (167)
                      -|..|+.||-.......|.+-.
T Consensus        14 LP~~CpiCgLtLVss~HLARSy   35 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSY   35 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhh
Confidence            4577999999888888887765


No 81 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=88.30  E-value=0.096  Score=37.01  Aligned_cols=23  Identities=4%  Similarity=-0.158  Sum_probs=10.6

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +|.|..|+|.|......+.|+..
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHH
T ss_pred             EECCCCCCcccCChHHHHHHHhh
Confidence            35555555555555555555543


No 82 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=88.09  E-value=0.13  Score=35.34  Aligned_cols=29  Identities=14%  Similarity=0.192  Sum_probs=14.8

Q ss_pred             cccccchhhhhhccccccccCceeccccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKS  112 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~  112 (167)
                      -|.|+.|+..|..  ..++...|.|+.||..
T Consensus       117 ~Y~Cp~C~~rytf--~eA~~~~F~Cp~Cg~~  145 (178)
T PRK06266        117 FFFCPNCHIRFTF--DEAMEYGFRCPQCGEM  145 (178)
T ss_pred             EEECCCCCcEEeH--HHHhhcCCcCCCCCCC
Confidence            3555555555554  3344444555555543


No 83 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=87.76  E-value=0.48  Score=34.02  Aligned_cols=12  Identities=25%  Similarity=0.684  Sum_probs=8.8

Q ss_pred             CCCccccccccc
Q psy8167          50 PIDRIPCTLCDK   61 (167)
Q Consensus        50 ~~~~~~C~~C~~   61 (167)
                      ..+.|.|..|..
T Consensus       109 ~drqFaC~~Cd~  120 (278)
T PF15135_consen  109 VDRQFACSSCDH  120 (278)
T ss_pred             cceeeeccccch
Confidence            346788888875


No 84 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=87.69  E-value=0.16  Score=36.64  Aligned_cols=89  Identities=13%  Similarity=0.203  Sum_probs=50.5

Q ss_pred             CCCcccccccccccCCHHHHHHHHHHhc-CCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHh---
Q psy8167          50 PIDRIPCTLCDKTFTRKDSLKKHIRIFH-TQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRI---  125 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h-~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~---  125 (167)
                      +.+.|+|.+|+...-....| .|+..-. .....|+|..|.+.- +         |.|..|.-.|-..     |.+.   
T Consensus       139 GGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlG-q---------~sCLRCK~cfCdd-----HvrrKg~  202 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLG-Q---------YSCLRCKICFCDD-----HVRRKGF  202 (314)
T ss_pred             CCeEEEeecCCCeeeccchh-hhhhhhhhhhccccccccccccc-c---------hhhhheeeeehhh-----hhhhccc
Confidence            34678888888655555544 6662211 223467777776432 2         3455554444332     3332   


Q ss_pred             -hcCCCCCCCCchhhhcCCHHHHHHHHhhc
Q psy8167         126 -FHGGADPKLMDEQMARGSADFLEVVLNED  154 (167)
Q Consensus       126 -h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  154 (167)
                       -...+++.|+.|++-...-..|..-.|.|
T Consensus       203 ky~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  203 KYEKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             ccccCCCCCCCCCCCcccccccceeeeecc
Confidence             13457888999988777777665555544


No 85 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.56  E-value=0.17  Score=27.08  Aligned_cols=29  Identities=14%  Similarity=0.244  Sum_probs=16.1

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      |+|..||..|.....+.       .+....|+.||.
T Consensus         6 y~C~~Cg~~fe~~~~~~-------~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMS-------DDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEecC-------CCCCCCCCCCCC
Confidence            66777777666442211       134556777765


No 86 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=87.29  E-value=0.34  Score=32.64  Aligned_cols=29  Identities=17%  Similarity=0.111  Sum_probs=15.2

Q ss_pred             cccccchhhhhhccccccccCceeccccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKS  112 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~  112 (167)
                      -|.|+.|+..|..  .-++...|.|+.||..
T Consensus       109 ~Y~Cp~c~~r~tf--~eA~~~~F~Cp~Cg~~  137 (158)
T TIGR00373       109 FFICPNMCVRFTF--NEAMELNFTCPRCGAM  137 (158)
T ss_pred             eEECCCCCcEeeH--HHHHHcCCcCCCCCCE
Confidence            4555555555555  4444444566666543


No 87 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=87.06  E-value=0.38  Score=32.60  Aligned_cols=23  Identities=17%  Similarity=0.174  Sum_probs=15.5

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchh
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQ  138 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~  138 (167)
                      .|.|++||..             +-++.|-+|++||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            4778888743             3456677788886


No 88 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.09  E-value=0.28  Score=25.09  Aligned_cols=13  Identities=38%  Similarity=0.807  Sum_probs=7.0

Q ss_pred             eecccccccccCh
Q psy8167         104 IRCELCDKSFTRK  116 (167)
Q Consensus       104 ~~C~~C~k~f~~~  116 (167)
                      |+|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            4555555555543


No 89 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=86.04  E-value=0.79  Score=23.56  Aligned_cols=27  Identities=26%  Similarity=0.604  Sum_probs=17.5

Q ss_pred             CCcccccccccccCCH----HHHHHHHHHhc
Q psy8167          51 IDRIPCTLCDKTFTRK----DSLKKHIRIFH   77 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~----~~l~~H~~~~h   77 (167)
                      .....|..|++.+...    ..|.+|++..|
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            3567899999988875    78888885544


No 90 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.93  E-value=0.72  Score=24.50  Aligned_cols=21  Identities=33%  Similarity=0.893  Sum_probs=16.0

Q ss_pred             eecccccccccCh-----hHHHHHHH
Q psy8167         104 IRCELCDKSFTRK-----DSLKKHNR  124 (167)
Q Consensus       104 ~~C~~C~k~f~~~-----~~l~~H~~  124 (167)
                      -.|..|++.+...     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3688888888665     58888887


No 91 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=85.80  E-value=1.6  Score=33.08  Aligned_cols=92  Identities=20%  Similarity=0.234  Sum_probs=62.1

Q ss_pred             ccccc--cccccCCHHHHHHHHHHhcCCCCcccccchhh---hhhccccccc---------------cCce----ecccc
Q psy8167          54 IPCTL--CDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEV---ALGARANAAF---------------IDRI----RCELC  109 (167)
Q Consensus        54 ~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~---~~~~~~~~~l---------------~k~~----~C~~C  109 (167)
                      |.|+.  |.........|..|.+..|.   -+-|..|-.   .|..  ...|               +..|    .|..|
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~---~~~C~~C~~nKk~F~~--E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC  226 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG---FVLCSECIGNKKDFWN--EIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFC  226 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC---cEEhHhhhcCcccCcc--ceeeeecccccccccCCccccCcCCCchhhhc
Confidence            77874  77777778889999866663   355655543   2222  1111               1112    59999


Q ss_pred             cccccChhHHHHHHHhhcCCCCCCCCchh-------hhcCCHHHHHHHHhhc
Q psy8167         110 DKSFTRKDSLKKHNRIFHGGADPKLMDEQ-------MARGSADFLEVVLNED  154 (167)
Q Consensus       110 ~k~f~~~~~l~~H~~~h~~~~~~~C~~C~-------~~f~~~~~l~~H~~~~  154 (167)
                      .+.|-....|..|+|..|    -.|-+|+       +.|....+|..|-+.-
T Consensus       227 ~~~FYdDDEL~~HcR~~H----E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~  274 (493)
T COG5236         227 KIYFYDDDELRRHCRLRH----EACHICDMVGPIRYQYFKSYEDLEAHFRNA  274 (493)
T ss_pred             cceecChHHHHHHHHhhh----hhhhhhhccCccchhhhhCHHHHHHHhhcC
Confidence            999999999999998744    2455664       5788999999998743


No 92 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=85.74  E-value=0.33  Score=31.61  Aligned_cols=23  Identities=43%  Similarity=0.700  Sum_probs=13.2

Q ss_pred             eecccccccccChhHHHHHHHhhcCC
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGG  129 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~  129 (167)
                      ..|-+||+.|...   .+|++.|||.
T Consensus        73 i~clecGk~~k~L---krHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFKTL---KRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EESBH---HHHHHHTT-S
T ss_pred             eEEccCCcccchH---HHHHHHccCC
Confidence            4677788777663   6777777665


No 93 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.58  E-value=0.42  Score=30.71  Aligned_cols=30  Identities=3%  Similarity=-0.120  Sum_probs=15.5

Q ss_pred             ccccchhhhhhccccccccCceecccccccccCh
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDKSFTRK  116 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~  116 (167)
                      ..|+.||..|..  ..  ..+..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD--Ln--k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD--LN--RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc--cC--CCCccCCCcCCccCcc
Confidence            455566655554  22  1334566666655444


No 94 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=84.98  E-value=0.29  Score=32.56  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=7.2

Q ss_pred             eecccccccccCh
Q psy8167         104 IRCELCDKSFTRK  116 (167)
Q Consensus       104 ~~C~~C~k~f~~~  116 (167)
                      |.|+.|+..|...
T Consensus       100 Y~Cp~C~~~y~~~  112 (147)
T smart00531      100 YKCPNCQSKYTFL  112 (147)
T ss_pred             EECcCCCCEeeHH
Confidence            5566666555543


No 95 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=84.88  E-value=0.41  Score=32.47  Aligned_cols=23  Identities=13%  Similarity=0.114  Sum_probs=16.4

Q ss_pred             cccccchhhhhhccccccccCceeccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCD  110 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~  110 (167)
                      .|.|++||..+..      +-|-.|++||
T Consensus       134 ~~vC~vCGy~~~g------e~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTHEG------EAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcccC------CCCCcCCCCC
Confidence            4777777777665      5556788887


No 96 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.46  E-value=0.49  Score=26.07  Aligned_cols=10  Identities=0%  Similarity=-0.323  Sum_probs=7.0

Q ss_pred             CCCCCCchhh
Q psy8167         130 ADPKLMDEQM  139 (167)
Q Consensus       130 ~~~~C~~C~~  139 (167)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            4777777775


No 97 
>KOG2785|consensus
Probab=83.84  E-value=1.2  Score=34.01  Aligned_cols=50  Identities=18%  Similarity=0.125  Sum_probs=43.3

Q ss_pred             eecccccccccChhHHHHHHHhhcCC-----------------------CCCCCCchh---hhcCCHHHHHHHHhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGG-----------------------ADPKLMDEQ---MARGSADFLEVVLNE  153 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~  153 (167)
                      -.|-.|++.+........||..+|+-                       .-+-|-.|+   +.|.+-...+.||..
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            46999999999999999999999872                       236788898   999999999999973


No 98 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=83.82  E-value=0.46  Score=31.88  Aligned_cols=12  Identities=0%  Similarity=-0.114  Sum_probs=6.3

Q ss_pred             ccccchhhhhhc
Q psy8167          83 QHTNVIEVALGA   94 (167)
Q Consensus        83 ~~c~~c~~~~~~   94 (167)
                      +.|+.||++|..
T Consensus        29 ~~c~~c~~~f~~   40 (154)
T PRK00464         29 RECLACGKRFTT   40 (154)
T ss_pred             eeccccCCcceE
Confidence            455555555544


No 99 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=83.68  E-value=0.69  Score=30.16  Aligned_cols=31  Identities=6%  Similarity=-0.187  Sum_probs=19.8

Q ss_pred             cCCCCCCCCchhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         127 HGGADPKLMDEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       127 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      ..+....|-+||+.|..-   ++|++.||+..|.
T Consensus        68 I~~d~i~clecGk~~k~L---krHL~~~~gltp~   98 (132)
T PF05443_consen   68 ITPDYIICLECGKKFKTL---KRHLRTHHGLTPE   98 (132)
T ss_dssp             B-SS-EE-TBT--EESBH---HHHHHHTT-S-HH
T ss_pred             cccCeeEEccCCcccchH---HHHHHHccCCCHH
Confidence            455678899999999885   9999999876654


No 100
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=83.60  E-value=0.53  Score=28.29  Aligned_cols=27  Identities=15%  Similarity=0.354  Sum_probs=13.2

Q ss_pred             CcccccchhhhhhccccccccCceeccccc
Q psy8167          81 QPQHTNVIEVALGARANAAFIDRIRCELCD  110 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~  110 (167)
                      +|-.|..||+.|..   ..+.++-+|+.|.
T Consensus        57 ~Pa~CkkCGfef~~---~~ik~pSRCP~CK   83 (97)
T COG3357          57 RPARCKKCGFEFRD---DKIKKPSRCPKCK   83 (97)
T ss_pred             cChhhcccCccccc---cccCCcccCCcch
Confidence            35556666555544   2233344555553


No 101
>KOG2785|consensus
Probab=83.49  E-value=1.5  Score=33.60  Aligned_cols=73  Identities=19%  Similarity=0.248  Sum_probs=46.4

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCc---ccccchhhhhhccccccccCceeccccc---ccccChhHHHHHHH
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQP---QHTNVIEVALGARANAAFIDRIRCELCD---KSFTRKDSLKKHNR  124 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~---~~c~~c~~~~~~~~~~~l~k~~~C~~C~---k~f~~~~~l~~H~~  124 (167)
                      ..|--|-.|+..+.....-..||...|.---|   |--..=|-.-.-  ...+...|.|-.|.   +.|......+.||.
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YL--geKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYL--GEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHH--HHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            34567999999999999999999665532111   111111100000  11115557788888   99999999999997


Q ss_pred             h
Q psy8167         125 I  125 (167)
Q Consensus       125 ~  125 (167)
                      -
T Consensus       242 ~  242 (390)
T KOG2785|consen  242 D  242 (390)
T ss_pred             h
Confidence            4


No 102
>KOG2186|consensus
Probab=83.07  E-value=0.68  Score=33.38  Aligned_cols=38  Identities=11%  Similarity=0.237  Sum_probs=23.4

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhh
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALG   93 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~   93 (167)
                      .|.|..||....-. .+.+|+.+.+.  .-|.|..|+..|.
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn--~~fSCIDC~k~F~   40 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN--AYFSCIDCGKTFE   40 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC--CeeEEeecccccc
Confidence            58899999876544 46679855442  3444544444443


No 103
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.96  E-value=0.53  Score=23.62  Aligned_cols=12  Identities=42%  Similarity=0.935  Sum_probs=6.7

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      |+|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            456666655544


No 104
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=82.84  E-value=0.15  Score=36.20  Aligned_cols=22  Identities=32%  Similarity=0.703  Sum_probs=15.3

Q ss_pred             CcccccccccccCCHHHHHHHH
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHI   73 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~   73 (167)
                      +...|++|+..|....-.....
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~   25 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKI   25 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCc
Confidence            4578999999888775443333


No 105
>KOG4167|consensus
Probab=82.63  E-value=0.34  Score=40.06  Aligned_cols=27  Identities=22%  Similarity=0.406  Sum_probs=23.8

Q ss_pred             cCceecccccccccChhHHHHHHHhhc
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFH  127 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~  127 (167)
                      ..-|.|..|+|.|..-..+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            344899999999999999999999975


No 106
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=82.48  E-value=0.86  Score=23.62  Aligned_cols=11  Identities=0%  Similarity=-0.408  Sum_probs=5.0

Q ss_pred             ccccchhhhhh
Q psy8167          83 QHTNVIEVALG   93 (167)
Q Consensus        83 ~~c~~c~~~~~   93 (167)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44444444443


No 107
>PF14353 CpXC:  CpXC protein
Probab=82.30  E-value=0.63  Score=30.07  Aligned_cols=11  Identities=27%  Similarity=0.776  Sum_probs=6.6

Q ss_pred             cccccccccCC
Q psy8167          55 PCTLCDKTFTR   65 (167)
Q Consensus        55 ~C~~C~~~f~~   65 (167)
                      .|+.|+..|..
T Consensus         3 tCP~C~~~~~~   13 (128)
T PF14353_consen    3 TCPHCGHEFEF   13 (128)
T ss_pred             CCCCCCCeeEE
Confidence            46666665543


No 108
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.29  E-value=1.3  Score=20.07  Aligned_cols=19  Identities=16%  Similarity=0.546  Sum_probs=13.5

Q ss_pred             ecccccccccChhHHHHHHH
Q psy8167         105 RCELCDKSFTRKDSLKKHNR  124 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~  124 (167)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            578888777 5567777765


No 109
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=82.16  E-value=0.65  Score=24.82  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=4.7

Q ss_pred             Cceeccccc
Q psy8167         102 DRIRCELCD  110 (167)
Q Consensus       102 k~~~C~~C~  110 (167)
                      ..|.|++|+
T Consensus        33 ~~w~CP~C~   41 (50)
T cd00730          33 DDWVCPVCG   41 (50)
T ss_pred             CCCCCCCCC
Confidence            335555555


No 110
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=82.02  E-value=0.98  Score=32.02  Aligned_cols=31  Identities=32%  Similarity=0.568  Sum_probs=23.9

Q ss_pred             CCCcccccccccccCCHHHHHHHHHHhcCCC
Q psy8167          50 PIDRIPCTLCDKTFTRKDSLKKHIRIFHTQN   80 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~   80 (167)
                      .+..|.|..|+|.|.-......|+...|...
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            3456999999999999999999998888653


No 111
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=80.62  E-value=0.8  Score=24.29  Aligned_cols=7  Identities=57%  Similarity=1.488  Sum_probs=3.7

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      .+|+.||
T Consensus        25 irCp~Cg   31 (49)
T COG1996          25 IRCPYCG   31 (49)
T ss_pred             eeCCCCC
Confidence            4555555


No 112
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.15  E-value=1.4  Score=29.33  Aligned_cols=33  Identities=6%  Similarity=0.079  Sum_probs=16.4

Q ss_pred             cccccchhhhhhccccccc---cCceeccccccccc
Q psy8167          82 PQHTNVIEVALGARANAAF---IDRIRCELCDKSFT  114 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l---~k~~~C~~C~k~f~  114 (167)
                      -|.|+.|+..|.......+   ...|.|+.||....
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l~  134 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEELE  134 (147)
T ss_pred             EEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEEE
Confidence            4566666655554111111   22277777776543


No 113
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=78.53  E-value=1.2  Score=26.58  Aligned_cols=12  Identities=25%  Similarity=0.794  Sum_probs=6.6

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      +.|..||..|..
T Consensus        54 W~C~kCg~~fAG   65 (89)
T COG1997          54 WKCRKCGAKFAG   65 (89)
T ss_pred             EEcCCCCCeecc
Confidence            456666655543


No 114
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.95  E-value=1.5  Score=29.57  Aligned_cols=33  Identities=9%  Similarity=-0.077  Sum_probs=26.4

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcC
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARG  142 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  142 (167)
                      ...|.|+.|+..|+....+.         .-|.|+.||....
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLD  139 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEee
Confidence            45588999999999888875         2799999986543


No 115
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.18  E-value=1.4  Score=30.33  Aligned_cols=34  Identities=12%  Similarity=0.054  Sum_probs=26.6

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCC
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGS  143 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  143 (167)
                      ...|.|+.|+..|.....+.         .-|.|+.||-....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            45588999999998887653         37999999876544


No 116
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=76.66  E-value=0.58  Score=27.06  Aligned_cols=17  Identities=0%  Similarity=-0.246  Sum_probs=9.7

Q ss_pred             CCCCCCC--chhhhcCCHH
Q psy8167         129 GADPKLM--DEQMARGSAD  145 (167)
Q Consensus       129 ~~~~~C~--~C~~~f~~~~  145 (167)
                      +.-++|.  .||..|....
T Consensus        25 ~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             eeeeecCCCCCCCEEEEEE
Confidence            3456666  5666665543


No 117
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=76.47  E-value=0.63  Score=39.02  Aligned_cols=15  Identities=0%  Similarity=-0.093  Sum_probs=11.3

Q ss_pred             hcCCCCCCCCchhhh
Q psy8167         126 FHGGADPKLMDEQMA  140 (167)
Q Consensus       126 h~~~~~~~C~~C~~~  140 (167)
                      +....|..|+.||-.
T Consensus       470 ~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         470 YQEPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            455678999999854


No 118
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=76.28  E-value=1.2  Score=23.47  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=3.7

Q ss_pred             cCceeccccc
Q psy8167         101 IDRIRCELCD  110 (167)
Q Consensus       101 ~k~~~C~~C~  110 (167)
                      ...|.|++|+
T Consensus        32 p~~w~CP~C~   41 (47)
T PF00301_consen   32 PDDWVCPVCG   41 (47)
T ss_dssp             -TT-B-TTTS
T ss_pred             CCCCcCcCCC
Confidence            3445566555


No 119
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=75.82  E-value=2.4  Score=22.52  Aligned_cols=39  Identities=15%  Similarity=0.244  Sum_probs=22.6

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhh
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEV   90 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~   90 (167)
                      +.+.|..||..|.--..-+......-....|-.|+.|..
T Consensus         3 k~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR~   41 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCRQ   41 (49)
T ss_pred             eeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHHH
Confidence            568899999888766554444422122234555655543


No 120
>KOG4167|consensus
Probab=75.66  E-value=1.6  Score=36.41  Aligned_cols=28  Identities=32%  Similarity=0.572  Sum_probs=23.9

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCC
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQ   79 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~   79 (167)
                      ...|.|..|++.|....++..|| +.|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHM-K~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHM-KTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHH-HHHHH
Confidence            46799999999999999999999 55643


No 121
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=74.95  E-value=0.73  Score=32.79  Aligned_cols=41  Identities=22%  Similarity=0.332  Sum_probs=26.5

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCC---------------CCCCchhhhc
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGAD---------------PKLMDEQMAR  141 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~---------------~~C~~C~~~f  141 (167)
                      .+.+.|++|+..|....-+..-.|+-.++..               ..|+.|..+-
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~yAa   72 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYYAA   72 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhHHH
Confidence            5667888888888877655555555444321               4599997653


No 122
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=73.88  E-value=1.9  Score=24.40  Aligned_cols=8  Identities=50%  Similarity=1.481  Sum_probs=2.1

Q ss_pred             cccccccc
Q psy8167          56 CTLCDKTF   63 (167)
Q Consensus        56 C~~C~~~f   63 (167)
                      |..|++.|
T Consensus        12 C~~C~~~F   19 (69)
T PF01363_consen   12 CMICGKKF   19 (69)
T ss_dssp             -TTT--B-
T ss_pred             CcCcCCcC
Confidence            55555554


No 123
>PF12907 zf-met2:  Zinc-binding
Probab=73.07  E-value=2.9  Score=21.17  Aligned_cols=32  Identities=34%  Similarity=0.611  Sum_probs=22.8

Q ss_pred             cccccccccc---CCHHHHHHHHHHhcCCCCcccc
Q psy8167          54 IPCTLCDKTF---TRKDSLKKHIRIFHTQNQPQHT   85 (167)
Q Consensus        54 ~~C~~C~~~f---~~~~~l~~H~~~~h~~~~~~~c   85 (167)
                      +.|.+|...|   .....|..|....|.......|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~C   36 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEEC   36 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHc
Confidence            5799999544   5667899999778876544333


No 124
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.06  E-value=1.5  Score=19.28  Aligned_cols=6  Identities=33%  Similarity=1.093  Sum_probs=3.1

Q ss_pred             cccccc
Q psy8167         106 CELCDK  111 (167)
Q Consensus       106 C~~C~k  111 (167)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555553


No 125
>KOG0978|consensus
Probab=73.01  E-value=1.1  Score=37.30  Aligned_cols=14  Identities=14%  Similarity=0.821  Sum_probs=8.7

Q ss_pred             CcccccccccccCC
Q psy8167          52 DRIPCTLCDKTFTR   65 (167)
Q Consensus        52 ~~~~C~~C~~~f~~   65 (167)
                      ...+|+.|+..++.
T Consensus       642 ~~LkCs~Cn~R~Kd  655 (698)
T KOG0978|consen  642 ELLKCSVCNTRWKD  655 (698)
T ss_pred             hceeCCCccCchhh
Confidence            34678888854443


No 126
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=71.70  E-value=1.6  Score=26.42  Aligned_cols=32  Identities=16%  Similarity=0.244  Sum_probs=16.7

Q ss_pred             CcccccchhhhhhccccccccCceecccccccccC
Q psy8167          81 QPQHTNVIEVALGARANAAFIDRIRCELCDKSFTR  115 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~  115 (167)
                      ..|.|+.|++.-..+....   -+.|..|++.|..
T Consensus        34 ~ky~Cp~Cgk~~vkR~a~G---IW~C~~C~~~~AG   65 (90)
T PF01780_consen   34 AKYTCPFCGKTSVKRVATG---IWKCKKCGKKFAG   65 (90)
T ss_dssp             S-BEESSSSSSEEEEEETT---EEEETTTTEEEE-
T ss_pred             CCCcCCCCCCceeEEeeeE---EeecCCCCCEEeC
Confidence            3577777776543311111   1677777776653


No 127
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=71.34  E-value=11  Score=19.42  Aligned_cols=27  Identities=19%  Similarity=0.160  Sum_probs=11.9

Q ss_pred             ccccchhhhhhccccccccCceecccccc
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDK  111 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k  111 (167)
                      +.|+.|+..-..  ...-...|+|..|++
T Consensus        19 ~~CP~Cg~~~~~--~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGSTKHY--RLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCeeeE--EeCCCCeEECCCCCC
Confidence            446666654111  111134456666553


No 128
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=68.78  E-value=0.76  Score=30.61  Aligned_cols=12  Identities=25%  Similarity=0.722  Sum_probs=5.9

Q ss_pred             ecccccccccCh
Q psy8167         105 RCELCDKSFTRK  116 (167)
Q Consensus       105 ~C~~C~k~f~~~  116 (167)
                      -|..||+.|+|-
T Consensus        70 YC~~CGkpyPWt   81 (158)
T PF10083_consen   70 YCHNCGKPYPWT   81 (158)
T ss_pred             hHHhCCCCCchH
Confidence            355555555444


No 129
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=68.68  E-value=0.88  Score=27.92  Aligned_cols=39  Identities=8%  Similarity=0.031  Sum_probs=18.0

Q ss_pred             ccCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcC
Q psy8167         100 FIDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARG  142 (167)
Q Consensus       100 l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  142 (167)
                      |.+.|.|+.||..-...-.+.    .-...-...|..||.+|.
T Consensus        19 L~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CCceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEE
Confidence            456667777764433322211    101112345666666654


No 130
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=68.64  E-value=2  Score=36.22  Aligned_cols=46  Identities=13%  Similarity=0.192  Sum_probs=29.8

Q ss_pred             ccccccccccCCH---HHHHHHHHHhcCCCCcccccchhhhhhccccccccCceeccccccc
Q psy8167          54 IPCTLCDKTFTRK---DSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKS  112 (167)
Q Consensus        54 ~~C~~C~~~f~~~---~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~  112 (167)
                      ..|..||..+.-.   ..|     ..|.......|-.||..-        ..+..|+.||-.
T Consensus       436 l~C~~Cg~v~~Cp~Cd~~l-----t~H~~~~~L~CH~Cg~~~--------~~p~~Cp~Cgs~  484 (730)
T COG1198         436 LLCRDCGYIAECPNCDSPL-----TLHKATGQLRCHYCGYQE--------PIPQSCPECGSE  484 (730)
T ss_pred             eecccCCCcccCCCCCcce-----EEecCCCeeEeCCCCCCC--------CCCCCCCCCCCC
Confidence            4577777655533   233     445566778999998662        345789999954


No 131
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=68.01  E-value=2.2  Score=19.20  Aligned_cols=6  Identities=33%  Similarity=1.065  Sum_probs=3.0

Q ss_pred             cccccc
Q psy8167         106 CELCDK  111 (167)
Q Consensus       106 C~~C~k  111 (167)
                      |+.||.
T Consensus        19 C~~CG~   24 (26)
T PF13248_consen   19 CPNCGA   24 (26)
T ss_pred             ChhhCC
Confidence            555553


No 132
>PRK04023 DNA polymerase II large subunit; Validated
Probab=68.00  E-value=2.7  Score=36.44  Aligned_cols=12  Identities=0%  Similarity=-0.205  Sum_probs=7.6

Q ss_pred             CCCCCchhhhcC
Q psy8167         131 DPKLMDEQMARG  142 (167)
Q Consensus       131 ~~~C~~C~~~f~  142 (167)
                      ++.|+.||..-.
T Consensus       663 ~y~CPKCG~El~  674 (1121)
T PRK04023        663 EDECEKCGREPT  674 (1121)
T ss_pred             CCcCCCCCCCCC
Confidence            466888865443


No 133
>PRK14873 primosome assembly protein PriA; Provisional
Probab=67.68  E-value=2  Score=35.90  Aligned_cols=26  Identities=15%  Similarity=0.208  Sum_probs=13.8

Q ss_pred             cCCCCcccccchhhhhhccccccccCceecccccc
Q psy8167          77 HTQNQPQHTNVIEVALGARANAAFIDRIRCELCDK  111 (167)
Q Consensus        77 h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k  111 (167)
                      |.......|..||....         ++.|+.||.
T Consensus       405 h~~~~~l~Ch~CG~~~~---------p~~Cp~Cgs  430 (665)
T PRK14873        405 PSAGGTPRCRWCGRAAP---------DWRCPRCGS  430 (665)
T ss_pred             ecCCCeeECCCCcCCCc---------CccCCCCcC
Confidence            43444566666664322         256666664


No 134
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.63  E-value=2.6  Score=26.37  Aligned_cols=10  Identities=30%  Similarity=0.391  Sum_probs=5.0

Q ss_pred             eecccccccc
Q psy8167         104 IRCELCDKSF  113 (167)
Q Consensus       104 ~~C~~C~k~f  113 (167)
                      .-|++||++|
T Consensus        27 iVsPytG~s~   36 (129)
T COG4530          27 IVSPYTGKSY   36 (129)
T ss_pred             cccCcccccc
Confidence            3455555555


No 135
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=67.35  E-value=3.3  Score=22.52  Aligned_cols=7  Identities=29%  Similarity=0.871  Sum_probs=3.0

Q ss_pred             ccccccc
Q psy8167          55 PCTLCDK   61 (167)
Q Consensus        55 ~C~~C~~   61 (167)
                      .|+.||.
T Consensus         4 ~CP~CG~   10 (54)
T TIGR01206         4 ECPDCGA   10 (54)
T ss_pred             CCCCCCC
Confidence            3444444


No 136
>KOG3408|consensus
Probab=66.86  E-value=4.3  Score=25.93  Aligned_cols=23  Identities=9%  Similarity=-0.129  Sum_probs=18.6

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      .|-|..|.+.|.....|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            47788888888888888888863


No 137
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=64.61  E-value=5.2  Score=26.52  Aligned_cols=19  Identities=21%  Similarity=0.443  Sum_probs=12.8

Q ss_pred             ceecccccccccChhHHHH
Q psy8167         103 RIRCELCDKSFTRKDSLKK  121 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~  121 (167)
                      -+.|+.||+.|..-+++.+
T Consensus       124 f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen  124 FWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             EEECCCCCCEecccccHHH
Confidence            3567777777777666554


No 138
>KOG4602|consensus
Probab=64.38  E-value=11  Score=27.43  Aligned_cols=46  Identities=11%  Similarity=0.280  Sum_probs=23.5

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccc
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDK  111 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k  111 (167)
                      .++.-|.+|...-....-+..     |..+.++.--.|.+          .+.|-|++||-
T Consensus       231 ~r~l~CvFC~nN~E~~A~y~t-----H~lkd~dgRVLCPk----------LR~YVCPiCGA  276 (318)
T KOG4602|consen  231 PRPLCCVFCFNNAEEFARYHT-----HPLKDKDGRVLCPK----------LRSYVCPICGA  276 (318)
T ss_pred             CCceeEEeecCCCchhhheec-----ccccCCCCcEechh----------HhhhcCccccc
Confidence            355678888764444444333     43333332222222          34468888883


No 139
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=63.49  E-value=5.8  Score=31.59  Aligned_cols=30  Identities=23%  Similarity=0.377  Sum_probs=26.5

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCC
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQ   81 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~   81 (167)
                      +.|.|+.|.+.|.....+..|+...|.+.-
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~l   85 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAGL   85 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhhc
Confidence            458899999999999999999988897763


No 140
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=63.23  E-value=3.9  Score=18.18  Aligned_cols=7  Identities=29%  Similarity=0.937  Sum_probs=4.3

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            5666665


No 141
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=63.21  E-value=3.1  Score=19.58  Aligned_cols=10  Identities=30%  Similarity=0.962  Sum_probs=4.2

Q ss_pred             eecccccccc
Q psy8167         104 IRCELCDKSF  113 (167)
Q Consensus       104 ~~C~~C~k~f  113 (167)
                      |.|+.|+..+
T Consensus        14 Y~Cp~C~~~~   23 (30)
T PF04438_consen   14 YRCPRCGARY   23 (30)
T ss_dssp             EE-TTT--EE
T ss_pred             EECCCcCCce
Confidence            6676666543


No 142
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=62.61  E-value=2.5  Score=29.55  Aligned_cols=22  Identities=27%  Similarity=0.744  Sum_probs=0.0

Q ss_pred             cCceeccccc-ccccChhHHHHH
Q psy8167         101 IDRIRCELCD-KSFTRKDSLKKH  122 (167)
Q Consensus       101 ~k~~~C~~C~-k~f~~~~~l~~H  122 (167)
                      .+.|.|.+|| ..|..+..+.+|
T Consensus        99 ~~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen   99 GVEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             -----------------------
T ss_pred             CCeeeeEeCCCcceecHHHHHHh
Confidence            3335555555 345555555555


No 143
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=61.65  E-value=4.4  Score=24.53  Aligned_cols=31  Identities=16%  Similarity=0.213  Sum_probs=16.0

Q ss_pred             cccccchhhhhhccccccccCceecccccccccC
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKSFTR  115 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~  115 (167)
                      .|.|+.|++.-..+..   ..-+.|..|++.|..
T Consensus        36 ~y~CpfCgk~~vkR~a---~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         36 KYFCPFCGKHAVKRQA---VGIWRCKGCKKTVAG   66 (90)
T ss_pred             CccCCCCCCCceeeee---eEEEEcCCCCCEEeC
Confidence            5677777643222001   122567777776654


No 144
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=61.63  E-value=4  Score=36.35  Aligned_cols=11  Identities=0%  Similarity=-0.233  Sum_probs=6.7

Q ss_pred             CCCCCchhhhc
Q psy8167         131 DPKLMDEQMAR  141 (167)
Q Consensus       131 ~~~C~~C~~~f  141 (167)
                      ...|+.|+...
T Consensus       709 a~~CP~CGtpl  719 (1337)
T PRK14714        709 RVECPRCDVEL  719 (1337)
T ss_pred             cccCCCCCCcc
Confidence            34688887443


No 145
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=61.18  E-value=4.2  Score=24.67  Aligned_cols=32  Identities=13%  Similarity=0.140  Sum_probs=16.4

Q ss_pred             cccccchhhhhhccccccccCceecccccccccCh
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKSFTRK  116 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~  116 (167)
                      .|.|+.|++.-..+..   ..-+.|..|++.|..-
T Consensus        35 ~y~CpfCgk~~vkR~a---~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        35 KYVCPFCGKKTVKRGS---TGIWTCRKCGAKFAGG   66 (91)
T ss_pred             CccCCCCCCCceEEEe---eEEEEcCCCCCEEeCC
Confidence            5677777643222111   1125677777766543


No 146
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=61.06  E-value=3.2  Score=26.99  Aligned_cols=22  Identities=36%  Similarity=0.380  Sum_probs=13.4

Q ss_pred             ecccccccccChhHHHHHHHhhcCC
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGG  129 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~  129 (167)
                      -|-.+|+.|.   .|++|+.+|++-
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCC
Confidence            4666666664   356666666654


No 147
>KOG2593|consensus
Probab=61.01  E-value=7.1  Score=30.61  Aligned_cols=31  Identities=10%  Similarity=0.127  Sum_probs=18.3

Q ss_pred             Ccccccchhhhhhccccccc----cCceecccccc
Q psy8167          81 QPQHTNVIEVALGARANAAF----IDRIRCELCDK  111 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l----~k~~~C~~C~k  111 (167)
                      .-|.|+.|.+.|..-....|    ...|.|..|+-
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHHhhcccCceEEEecCCC
Confidence            34777777777766333333    34577777764


No 148
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=60.95  E-value=5.3  Score=20.31  Aligned_cols=9  Identities=22%  Similarity=0.641  Sum_probs=4.1

Q ss_pred             eeccccccc
Q psy8167         104 IRCELCDKS  112 (167)
Q Consensus       104 ~~C~~C~k~  112 (167)
                      +-|..||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            455555543


No 149
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=60.78  E-value=5.5  Score=21.39  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=5.9

Q ss_pred             ceeccccccccc
Q psy8167         103 RIRCELCDKSFT  114 (167)
Q Consensus       103 ~~~C~~C~k~f~  114 (167)
                      .+.|..||+.|-
T Consensus        18 k~~Cr~Cg~~~C   29 (57)
T cd00065          18 RHHCRNCGRIFC   29 (57)
T ss_pred             ccccCcCcCCcC
Confidence            345555555443


No 150
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=60.42  E-value=3.5  Score=33.31  Aligned_cols=47  Identities=11%  Similarity=0.269  Sum_probs=24.2

Q ss_pred             cccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccc
Q psy8167          55 PCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDK  111 (167)
Q Consensus        55 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k  111 (167)
                      .|..||....-..= ...+ ..|.......|..||....-        +..|+.||.
T Consensus       215 ~C~~Cg~~~~C~~C-~~~l-~~h~~~~~l~Ch~Cg~~~~~--------~~~Cp~C~s  261 (505)
T TIGR00595       215 LCRSCGYILCCPNC-DVSL-TYHKKEGKLRCHYCGYQEPI--------PKTCPQCGS  261 (505)
T ss_pred             EhhhCcCccCCCCC-CCce-EEecCCCeEEcCCCcCcCCC--------CCCCCCCCC
Confidence            46666654332200 0122 34555556777777755432        246777774


No 151
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=59.99  E-value=3.3  Score=26.89  Aligned_cols=13  Identities=31%  Similarity=0.751  Sum_probs=6.8

Q ss_pred             ccccccccccCCH
Q psy8167          54 IPCTLCDKTFTRK   66 (167)
Q Consensus        54 ~~C~~C~~~f~~~   66 (167)
                      ++|..||+.|..-
T Consensus         2 H~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    2 HQCTKCGRVFEDG   14 (131)
T ss_pred             cccCcCCCCcCCC
Confidence            4555555555543


No 152
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=59.95  E-value=7.3  Score=20.15  Aligned_cols=22  Identities=23%  Similarity=0.424  Sum_probs=18.0

Q ss_pred             eecccccccccChhHHHHHHHh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      |+|-+|.....-++.|-.||+.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            4788888888888889888875


No 153
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=59.87  E-value=4.6  Score=19.33  Aligned_cols=6  Identities=50%  Similarity=1.359  Sum_probs=2.4

Q ss_pred             eccccc
Q psy8167         105 RCELCD  110 (167)
Q Consensus       105 ~C~~C~  110 (167)
                      +|+.||
T Consensus        19 rC~~CG   24 (32)
T PF03604_consen   19 RCPECG   24 (32)
T ss_dssp             SBSSSS
T ss_pred             ECCcCC
Confidence            344444


No 154
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=59.83  E-value=5.4  Score=20.36  Aligned_cols=17  Identities=24%  Similarity=0.743  Sum_probs=14.0

Q ss_pred             ecccccccccChhHHHH
Q psy8167         105 RCELCDKSFTRKDSLKK  121 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~  121 (167)
                      .|.+||+.|..+....+
T Consensus        10 ~C~~C~rpf~WRKKW~~   26 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWAR   26 (42)
T ss_pred             cCcccCCcchHHHHHHH
Confidence            49999999999877654


No 155
>COG2879 Uncharacterized small protein [Function unknown]
Probab=59.74  E-value=11  Score=21.10  Aligned_cols=18  Identities=11%  Similarity=0.078  Sum_probs=11.7

Q ss_pred             CHHHHHHHHhhcCCCCCc
Q psy8167         143 SADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       143 ~~~~l~~H~~~~~~~~~~  160 (167)
                      ..+++..|++.+|+.+|+
T Consensus        24 dYdnYVehmr~~hPd~p~   41 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPP   41 (65)
T ss_pred             cHHHHHHHHHHhCcCCCc
Confidence            556666777776666664


No 156
>KOG3214|consensus
Probab=59.52  E-value=3  Score=25.58  Aligned_cols=41  Identities=7%  Similarity=-0.011  Sum_probs=20.4

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHH
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSAD  145 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  145 (167)
                      ...|.|+.|..--.-.-.    +..-+..-...|.+|+.+|....
T Consensus        21 dt~FnClfcnHek~v~~~----~Dk~~~iG~~sC~iC~esFqt~i   61 (109)
T KOG3214|consen   21 DTQFNCLFCNHEKSVSCT----LDKKHNIGKASCRICEESFQTTI   61 (109)
T ss_pred             heeeccCccccccceeee----ehhhcCcceeeeeehhhhhccch
Confidence            444667766632222111    11122233567778887777643


No 157
>KOG3408|consensus
Probab=59.32  E-value=6.9  Score=25.01  Aligned_cols=25  Identities=24%  Similarity=0.505  Sum_probs=22.0

Q ss_pred             CCCcccccccccccCCHHHHHHHHH
Q psy8167          50 PIDRIPCTLCDKTFTRKDSLKKHIR   74 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~~~l~~H~~   74 (167)
                      |...|.|-.|.+.|.+...|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            4467999999999999999999983


No 158
>KOG2593|consensus
Probab=57.72  E-value=6.2  Score=30.94  Aligned_cols=39  Identities=18%  Similarity=0.331  Sum_probs=29.1

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhc
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGA   94 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~   94 (167)
                      .-|.|+.|.+.|.....++    ..-.....|.|..|+.....
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~gelve  165 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGGELVE  165 (436)
T ss_pred             ccccCCccccchhhhHHHH----hhcccCceEEEecCCCchhc
Confidence            4499999999999888763    22333557999999876644


No 159
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=57.61  E-value=3.4  Score=19.12  Aligned_cols=17  Identities=47%  Similarity=0.825  Sum_probs=8.0

Q ss_pred             ecccccccccChhHHHHH
Q psy8167         105 RCELCDKSFTRKDSLKKH  122 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H  122 (167)
                      .|-.|++.| ....++.|
T Consensus         2 sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    2 SCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EETTTTEEE-EGGGTTT-
T ss_pred             eeecCCCCc-CcCCcCCC
Confidence            455666666 33333444


No 160
>PRK04023 DNA polymerase II large subunit; Validated
Probab=57.45  E-value=6.1  Score=34.46  Aligned_cols=11  Identities=36%  Similarity=0.788  Sum_probs=8.1

Q ss_pred             Ccccccccccc
Q psy8167          52 DRIPCTLCDKT   62 (167)
Q Consensus        52 ~~~~C~~C~~~   62 (167)
                      ....|+.||..
T Consensus       625 g~RfCpsCG~~  635 (1121)
T PRK04023        625 GRRKCPSCGKE  635 (1121)
T ss_pred             cCccCCCCCCc
Confidence            45678888875


No 161
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=57.23  E-value=5.3  Score=24.18  Aligned_cols=31  Identities=16%  Similarity=0.215  Sum_probs=16.8

Q ss_pred             cccccchhhhhhccccccccCceecccccccccC
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKSFTR  115 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~  115 (167)
                      .|.|+.|++.-..+..   ..-+.|..|++.|..
T Consensus        36 ~y~CpfCgk~~vkR~a---~GIW~C~~C~~~~AG   66 (90)
T PRK03976         36 KHVCPVCGRPKVKRVG---TGIWECRKCGAKFAG   66 (90)
T ss_pred             CccCCCCCCCceEEEE---EEEEEcCCCCCEEeC
Confidence            5777777643322111   112577777777654


No 162
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=57.01  E-value=10  Score=20.42  Aligned_cols=15  Identities=13%  Similarity=0.521  Sum_probs=10.2

Q ss_pred             eecccccccccChhH
Q psy8167         104 IRCELCDKSFTRKDS  118 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~  118 (167)
                      ++|+.||..|...-.
T Consensus        29 W~C~~Cgh~w~~~v~   43 (55)
T PF14311_consen   29 WKCPKCGHEWKASVN   43 (55)
T ss_pred             EECCCCCCeeEccHh
Confidence            578888777666543


No 163
>KOG1280|consensus
Probab=56.93  E-value=5  Score=30.49  Aligned_cols=29  Identities=17%  Similarity=0.208  Sum_probs=16.4

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGAD  131 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~  131 (167)
                      .|.|++|++.-.....|..|...-|.+..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccC
Confidence            45566666655555566666555554443


No 164
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=56.54  E-value=3.6  Score=35.03  Aligned_cols=13  Identities=0%  Similarity=-0.360  Sum_probs=0.0

Q ss_pred             cccccchhhhhhc
Q psy8167          82 PQHTNVIEVALGA   94 (167)
Q Consensus        82 ~~~c~~c~~~~~~   94 (167)
                      .+.|+.|+.....
T Consensus       655 ~r~Cp~Cg~~t~~  667 (900)
T PF03833_consen  655 RRRCPKCGKETFY  667 (900)
T ss_dssp             -------------
T ss_pred             cccCcccCCcchh
Confidence            3566666665444


No 165
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=56.05  E-value=8.1  Score=20.30  Aligned_cols=10  Identities=20%  Similarity=0.488  Sum_probs=4.9

Q ss_pred             eecccccccc
Q psy8167         104 IRCELCDKSF  113 (167)
Q Consensus       104 ~~C~~C~k~f  113 (167)
                      +.|+.||..+
T Consensus        21 ~vC~~Cg~~~   30 (52)
T smart00661       21 FVCRKCGYEE   30 (52)
T ss_pred             EECCcCCCeE
Confidence            4455555443


No 166
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=55.73  E-value=6.1  Score=25.07  Aligned_cols=12  Identities=25%  Similarity=0.681  Sum_probs=6.8

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            456666655544


No 168
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=55.51  E-value=5.3  Score=26.16  Aligned_cols=16  Identities=19%  Similarity=0.586  Sum_probs=11.2

Q ss_pred             cCceecccccccccCh
Q psy8167         101 IDRIRCELCDKSFTRK  116 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~  116 (167)
                      ...+.|..||..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3457888888777654


No 169
>KOG0782|consensus
Probab=55.18  E-value=4  Score=33.29  Aligned_cols=49  Identities=20%  Similarity=0.366  Sum_probs=33.8

Q ss_pred             HHHHHHHHHHhcCCCCcccccchhhhhhccccccc----cCceecccccccccChh
Q psy8167          66 KDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAF----IDRIRCELCDKSFTRKD  117 (167)
Q Consensus        66 ~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l----~k~~~C~~C~k~f~~~~  117 (167)
                      ...|.+|. +.|.....=+|+.|++.|-+  ...+    ..-..|..|...|-.+-
T Consensus       238 E~~fvrHH-WVHrrRqeGkC~~CgKgFQQ--Kf~FhsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  238 ESGFVRHH-WVHRRRQEGKCNTCGKGFQQ--KFFFHSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cccchHHh-HhhHhhhccccchhhhhhhh--heeeccccEEEEEehHHHHHhhcch
Confidence            34788887 77877777788888888877  4433    12236888877776664


No 170
>KOG0717|consensus
Probab=54.82  E-value=6.4  Score=31.19  Aligned_cols=22  Identities=14%  Similarity=-0.176  Sum_probs=19.9

Q ss_pred             CCCCchhhhcCCHHHHHHHHhh
Q psy8167         132 PKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +-|.+|+|+|.+..+|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999863


No 171
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=54.37  E-value=7.5  Score=24.19  Aligned_cols=23  Identities=4%  Similarity=-0.253  Sum_probs=19.3

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      .+-|..|.+.|.+...|..|.+.
T Consensus        55 qhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          55 QHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             eeeeehhHHHHHHHHHHHHHhcc
Confidence            46788999999999999998863


No 172
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=53.85  E-value=8.3  Score=30.77  Aligned_cols=22  Identities=5%  Similarity=-0.266  Sum_probs=11.9

Q ss_pred             CCCCchhhhcCCHHHHHHHHhh
Q psy8167         132 PKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       132 ~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      +.|+.|.+.|.....+..|+..
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~   79 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQ   79 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHH
Confidence            4455555555555555555553


No 173
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=53.71  E-value=3.9  Score=22.25  Aligned_cols=40  Identities=10%  Similarity=0.066  Sum_probs=25.0

Q ss_pred             eeccc--ccccccChhHHHHHHHhhcCCCCCCCCc----hhhhcCCH
Q psy8167         104 IRCEL--CDKSFTRKDSLKKHNRIFHGGADPKLMD----EQMARGSA  144 (167)
Q Consensus       104 ~~C~~--C~k~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~  144 (167)
                      ..|+.  |...+. +..|..|+...-...+..|..    |+..+...
T Consensus        10 v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen   10 VPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             EE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEHH
T ss_pred             eeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccchh
Confidence            56877  444444 558889998667777888998    88877544


No 174
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=52.45  E-value=4.4  Score=32.76  Aligned_cols=14  Identities=0%  Similarity=-0.273  Sum_probs=9.4

Q ss_pred             cCCCCCCCCchhhh
Q psy8167         127 HGGADPKLMDEQMA  140 (167)
Q Consensus       127 ~~~~~~~C~~C~~~  140 (167)
                      ....|..|+.|+..
T Consensus       249 ~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       249 QEPIPKTCPQCGSE  262 (505)
T ss_pred             cCCCCCCCCCCCCC
Confidence            33457788888753


No 175
>PRK14873 primosome assembly protein PriA; Provisional
Probab=52.27  E-value=4.5  Score=33.87  Aligned_cols=11  Identities=9%  Similarity=-0.215  Sum_probs=8.4

Q ss_pred             CCCCCCchhhh
Q psy8167         130 ADPKLMDEQMA  140 (167)
Q Consensus       130 ~~~~C~~C~~~  140 (167)
                      .+..|+.||..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            47889999764


No 176
>KOG2636|consensus
Probab=52.11  E-value=9.2  Score=30.19  Aligned_cols=23  Identities=17%  Similarity=0.514  Sum_probs=17.0

Q ss_pred             cCceeccccc-ccccChhHHHHHH
Q psy8167         101 IDRIRCELCD-KSFTRKDSLKKHN  123 (167)
Q Consensus       101 ~k~~~C~~C~-k~f~~~~~l~~H~  123 (167)
                      .+.|.|.+|| +++..+..+.+|-
T Consensus       399 ~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  399 DIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             CcccceeeccCccccCcHHHHHHh
Confidence            4556788888 7777888888773


No 177
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=51.74  E-value=16  Score=18.43  Aligned_cols=23  Identities=22%  Similarity=0.554  Sum_probs=17.0

Q ss_pred             ccccccccccCC--HHHHHHHHHHhc
Q psy8167          54 IPCTLCDKTFTR--KDSLKKHIRIFH   77 (167)
Q Consensus        54 ~~C~~C~~~f~~--~~~l~~H~~~~h   77 (167)
                      -.|+.||+.|..  ...-..|. +.|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~-~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHK-KYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHH-HHH
Confidence            479999998874  46667776 545


No 178
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=51.51  E-value=6  Score=25.01  Aligned_cols=13  Identities=31%  Similarity=0.787  Sum_probs=6.7

Q ss_pred             eecccccccccCh
Q psy8167         104 IRCELCDKSFTRK  116 (167)
Q Consensus       104 ~~C~~C~k~f~~~  116 (167)
                      +.|..||+.|.-.
T Consensus        71 ~~C~~Cg~~~~~~   83 (113)
T PF01155_consen   71 ARCRDCGHEFEPD   83 (113)
T ss_dssp             EEETTTS-EEECH
T ss_pred             EECCCCCCEEecC
Confidence            4566666655543


No 179
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=51.40  E-value=7.8  Score=28.09  Aligned_cols=28  Identities=14%  Similarity=0.060  Sum_probs=15.3

Q ss_pred             cccccchhhhhhccccccccCceecccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDK  111 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k  111 (167)
                      .|.|+.|+..|..  ...+..+-.|-.|+.
T Consensus       155 ef~C~~C~h~F~G--~~qm~v~sPCy~C~~  182 (278)
T PF15135_consen  155 EFHCPKCRHNFRG--FAQMGVPSPCYGCGN  182 (278)
T ss_pred             eeecccccccchh--hhhcCCCCCccCCCC
Confidence            4666666666655  444444445555553


No 180
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=51.32  E-value=8.1  Score=17.87  Aligned_cols=7  Identities=57%  Similarity=1.383  Sum_probs=2.4

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      |.|.+|.
T Consensus        16 Y~C~~Cd   22 (30)
T PF07649_consen   16 YRCSECD   22 (30)
T ss_dssp             EE-TTT-
T ss_pred             EECccCC
Confidence            4454444


No 181
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=50.62  E-value=6.3  Score=19.39  Aligned_cols=8  Identities=25%  Similarity=1.103  Sum_probs=3.4

Q ss_pred             cccccccc
Q psy8167         106 CELCDKSF  113 (167)
Q Consensus       106 C~~C~k~f  113 (167)
                      |+.||+.|
T Consensus         4 C~~Cg~~Y   11 (36)
T PF05191_consen    4 CPKCGRIY   11 (36)
T ss_dssp             ETTTTEEE
T ss_pred             cCCCCCcc
Confidence            44444443


No 182
>COG1773 Rubredoxin [Energy production and conversion]
Probab=50.53  E-value=8  Score=21.07  Aligned_cols=15  Identities=27%  Similarity=0.789  Sum_probs=11.5

Q ss_pred             ceecccccccccChh
Q psy8167         103 RIRCELCDKSFTRKD  117 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~  117 (167)
                      .|+|.+||..|.-..
T Consensus         3 ~~~C~~CG~vYd~e~   17 (55)
T COG1773           3 RWRCSVCGYVYDPEK   17 (55)
T ss_pred             ceEecCCceEecccc
Confidence            578999998876543


No 183
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=50.31  E-value=6.4  Score=26.26  Aligned_cols=35  Identities=20%  Similarity=0.369  Sum_probs=23.2

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhh
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMA  140 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  140 (167)
                      .-.|.|. |+..|.+.   ++|-..-.|+ .|.|..|+-.
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            3457899 99886654   4454443444 8999999743


No 184
>KOG2636|consensus
Probab=50.04  E-value=11  Score=29.76  Aligned_cols=29  Identities=3%  Similarity=-0.118  Sum_probs=24.0

Q ss_pred             HhhcCCCCCCCCchh-hhcCCHHHHHHHHh
Q psy8167         124 RIFHGGADPKLMDEQ-MARGSADFLEVVLN  152 (167)
Q Consensus       124 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  152 (167)
                      +.|--+..|.|.+|| +++.....+.+|-.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            455556789999999 99999999999874


No 185
>KOG0978|consensus
Probab=49.88  E-value=4  Score=34.09  Aligned_cols=22  Identities=18%  Similarity=0.095  Sum_probs=16.1

Q ss_pred             CCCCCCCchhhhcCCHHHHHHH
Q psy8167         129 GADPKLMDEQMARGSADFLEVV  150 (167)
Q Consensus       129 ~~~~~C~~C~~~f~~~~~l~~H  150 (167)
                      -+.-+|+.|+.+|...+.++-|
T Consensus       676 tRqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  676 TRQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             HhcCCCCCCCCCCCcccccccC
Confidence            3567899999999877665544


No 186
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=49.72  E-value=4.6  Score=19.03  Aligned_cols=8  Identities=0%  Similarity=-0.546  Sum_probs=3.5

Q ss_pred             CCCCCchh
Q psy8167         131 DPKLMDEQ  138 (167)
Q Consensus       131 ~~~C~~C~  138 (167)
                      -+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 187
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=49.37  E-value=8.4  Score=24.55  Aligned_cols=12  Identities=25%  Similarity=0.825  Sum_probs=6.3

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      +.|..||..|..
T Consensus        72 ~~C~~Cg~~~~~   83 (117)
T PRK00564         72 LECKDCSHVFKP   83 (117)
T ss_pred             EEhhhCCCcccc
Confidence            456666644433


No 188
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=49.01  E-value=12  Score=28.10  Aligned_cols=48  Identities=8%  Similarity=-0.067  Sum_probs=24.9

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhhc
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNED  154 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  154 (167)
                      .|-.|.-.|.-...-..  ......-.|+|..|...|-...+.--|..-|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~--~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPF--DESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCcc--cccccccceechhhhhhhhhhhHHHHHHHHh
Confidence            36666655555432111  1112233577777777777666665565433


No 189
>PHA02998 RNA polymerase subunit; Provisional
Probab=48.97  E-value=2.4  Score=29.00  Aligned_cols=38  Identities=11%  Similarity=0.003  Sum_probs=23.0

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCC----CCCCchhhhcCCH
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGAD----PKLMDEQMARGSA  144 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~----~~C~~C~~~f~~~  144 (167)
                      ...|+.|+..=....    .+++...++|    |.|..||+.|.-.
T Consensus       143 ~v~CPkCg~~~A~f~----qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        143 NTPCPNCKSKNTTPM----MIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCCceEEE----EEeeccCCCCceEEEEcCCCCCccCCc
Confidence            347999984322211    1233345555    8999999988765


No 190
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=48.75  E-value=31  Score=23.31  Aligned_cols=61  Identities=15%  Similarity=0.240  Sum_probs=39.6

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc-CCHHHHHHHHhhcC-CCCCccccc
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR-GSADFLEVVLNEDG-EGEPVSITV  164 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f-~~~~~l~~H~~~~~-~~~~~~~~~  164 (167)
                      ...|+.|.-........ ...|.+...|+-.|..=+=.| .+...|++|.+..| ...|..+.+
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~rP~~vDP  142 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFSGTYSELRKHARSEHPSARPSEVDP  142 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCCccCcccccccccCHHHHHHHHHhhCCCCCCccCCH
Confidence            35799987444433333 346777788888888733333 35678999999644 666766544


No 191
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=48.59  E-value=10  Score=18.48  Aligned_cols=9  Identities=22%  Similarity=0.586  Sum_probs=4.7

Q ss_pred             ecccccccc
Q psy8167         105 RCELCDKSF  113 (167)
Q Consensus       105 ~C~~C~k~f  113 (167)
                      .|..|++.+
T Consensus        22 ~C~~C~Y~~   30 (35)
T PF02150_consen   22 ACRTCGYEE   30 (35)
T ss_dssp             EESSSS-EE
T ss_pred             CCCCCCCcc
Confidence            566666544


No 192
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=48.28  E-value=5  Score=30.66  Aligned_cols=39  Identities=13%  Similarity=0.036  Sum_probs=13.6

Q ss_pred             ccccccccccCCHHHHHHHHHHhcCC------CCcccccchhhhhhc
Q psy8167          54 IPCTLCDKTFTRKDSLKKHIRIFHTQ------NQPQHTNVIEVALGA   94 (167)
Q Consensus        54 ~~C~~C~~~f~~~~~l~~H~~~~h~~------~~~~~c~~c~~~~~~   94 (167)
                      +.|..|.+.+-.....-.-  ..|..      .+-|.|..|++....
T Consensus       253 v~C~~C~yt~~~~~~~C~~--~~H~l~~~~a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  253 VTCKQCKYTAFKPSDRCKE--EGHPLKWHDAVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEETTT--EESS--HHHHH--TT--EEEEEEE-EEEE-T-TS-EEEE
T ss_pred             EEcCCCCCcccCcchhHHh--cCCceEEeeeeeeeEECCCCCCeeee
Confidence            6677777644443332211  11322      234666666665444


No 193
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.12  E-value=6.9  Score=20.56  Aligned_cols=19  Identities=16%  Similarity=0.576  Sum_probs=15.0

Q ss_pred             ecccccccccChhHHHHHH
Q psy8167         105 RCELCDKSFTRKDSLKKHN  123 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~  123 (167)
                      -|++|++.|.++....+-.
T Consensus        14 ICpvCqRPFsWRkKW~~cW   32 (54)
T COG4338          14 ICPVCQRPFSWRKKWARCW   32 (54)
T ss_pred             hhhhhcCchHHHHHHHHHH
Confidence            4999999999987766543


No 194
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=48.09  E-value=6.9  Score=19.03  Aligned_cols=9  Identities=0%  Similarity=-0.182  Sum_probs=2.5

Q ss_pred             ccchhhhhh
Q psy8167          85 TNVIEVALG   93 (167)
Q Consensus        85 c~~c~~~~~   93 (167)
                      |..|++.|.
T Consensus         6 C~eC~~~f~   14 (34)
T PF01286_consen    6 CDECGKPFM   14 (34)
T ss_dssp             -TTT--EES
T ss_pred             HhHhCCHHH
Confidence            444444443


No 195
>KOG4173|consensus
Probab=48.08  E-value=15  Score=25.97  Aligned_cols=47  Identities=17%  Similarity=0.305  Sum_probs=36.2

Q ss_pred             ceeccc--ccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHh
Q psy8167         103 RIRCEL--CDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       103 ~~~C~~--C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      .|.|++  |-..|.....+..|--+.|   --.|..|.+.|.+...|.-|+.
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h---~~sCs~C~r~~Pt~hLLd~HI~  127 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLH---GNSCSFCKRAFPTGHLLDAHIL  127 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcc---cchhHHHHHhCCchhhhhHHHH
Confidence            356766  5577777777777755544   4579999999999999999986


No 196
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=47.99  E-value=12  Score=25.83  Aligned_cols=30  Identities=13%  Similarity=0.138  Sum_probs=18.1

Q ss_pred             CcccccchhhhhhccccccccCceeccccccc
Q psy8167          81 QPQHTNVIEVALGARANAAFIDRIRCELCDKS  112 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~  112 (167)
                      .-|.|+.|...++.  .-++...|.|+.||-.
T Consensus       112 ~~y~C~~~~~r~sf--deA~~~~F~Cp~Cg~~  141 (176)
T COG1675         112 NYYVCPNCHVKYSF--DEAMELGFTCPKCGED  141 (176)
T ss_pred             CceeCCCCCCcccH--HHHHHhCCCCCCCCch
Confidence            44677666666665  4444444777777754


No 197
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=47.85  E-value=12  Score=25.40  Aligned_cols=17  Identities=24%  Similarity=0.616  Sum_probs=9.3

Q ss_pred             eecccccccccChhHHH
Q psy8167         104 IRCELCDKSFTRKDSLK  120 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~  120 (167)
                      +.|+.||+.|..-+++.
T Consensus       131 ~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         131 YRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             eECCCCcccccCchHHH
Confidence            34666666555555544


No 198
>PF12773 DZR:  Double zinc ribbon
Probab=47.80  E-value=13  Score=19.40  Aligned_cols=9  Identities=0%  Similarity=-0.315  Sum_probs=4.2

Q ss_pred             CCCCCchhh
Q psy8167         131 DPKLMDEQM  139 (167)
Q Consensus       131 ~~~C~~C~~  139 (167)
                      ...|..|+.
T Consensus        29 ~~~C~~Cg~   37 (50)
T PF12773_consen   29 KKICPNCGA   37 (50)
T ss_pred             CCCCcCCcC
Confidence            344555544


No 199
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=47.63  E-value=16  Score=30.57  Aligned_cols=7  Identities=29%  Similarity=0.923  Sum_probs=3.6

Q ss_pred             ccccccc
Q psy8167         106 CELCDKS  112 (167)
Q Consensus       106 C~~C~k~  112 (167)
                      |+.||..
T Consensus        44 C~~CG~~   50 (645)
T PRK14559         44 CPNCGAE   50 (645)
T ss_pred             ccccCCc
Confidence            5555543


No 200
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=47.19  E-value=8  Score=27.05  Aligned_cols=48  Identities=13%  Similarity=0.032  Sum_probs=27.3

Q ss_pred             CcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCC
Q psy8167          81 QPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGS  143 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  143 (167)
                      -||.|-+|.+.|..         ---..||..|-..-.++...      +-..|.+|++....
T Consensus       195 IPF~C~iCKkdy~s---------pvvt~CGH~FC~~Cai~~y~------kg~~C~~Cgk~t~G  242 (259)
T COG5152         195 IPFLCGICKKDYES---------PVVTECGHSFCSLCAIRKYQ------KGDECGVCGKATYG  242 (259)
T ss_pred             Cceeehhchhhccc---------hhhhhcchhHHHHHHHHHhc------cCCcceecchhhcc
Confidence            36888888777665         11234565555554444332      24568888775433


No 201
>KOG4118|consensus
Probab=46.82  E-value=14  Score=20.78  Aligned_cols=30  Identities=10%  Similarity=0.055  Sum_probs=21.8

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      -|+|.+|--.......+..|....|+..|+
T Consensus        38 ~~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   38 HHKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             HhhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            377888877777777777887776665554


No 202
>KOG1842|consensus
Probab=46.64  E-value=13  Score=29.30  Aligned_cols=29  Identities=17%  Similarity=0.457  Sum_probs=26.1

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCC
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQ   81 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~   81 (167)
                      -|.|++|..-|.....|..|....|.++.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~ed   43 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFEED   43 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccccc
Confidence            48999999999999999999988887763


No 203
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=46.54  E-value=11  Score=18.88  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=4.3

Q ss_pred             Cceecccccc
Q psy8167         102 DRIRCELCDK  111 (167)
Q Consensus       102 k~~~C~~C~k  111 (167)
                      +.+.|+.|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            3455555554


No 204
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=45.81  E-value=5.1  Score=21.48  Aligned_cols=24  Identities=25%  Similarity=0.527  Sum_probs=11.1

Q ss_pred             ceecccccccccChhHHHHHHHhh
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIF  126 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h  126 (167)
                      .|.|+.|+..|=..-.+-.|..+|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-
T ss_pred             eEECCCCCCccccCcChhhhcccc
Confidence            467777777776666655555543


No 205
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=45.46  E-value=9.7  Score=19.04  Aligned_cols=15  Identities=20%  Similarity=0.600  Sum_probs=11.6

Q ss_pred             cccccccccccCCHH
Q psy8167          53 RIPCTLCDKTFTRKD   67 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~   67 (167)
                      +|.|..|++.|-..-
T Consensus        12 ~f~C~~C~~~FC~~H   26 (39)
T smart00154       12 GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CeECCccCCcccccc
Confidence            688999998887653


No 206
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=44.78  E-value=11  Score=20.59  Aligned_cols=44  Identities=9%  Similarity=0.172  Sum_probs=21.0

Q ss_pred             CcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcCCCCCCCCc
Q psy8167          81 QPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMD  136 (167)
Q Consensus        81 ~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~  136 (167)
                      ..+.|+.....|        ..|.....||..|...+-+. ++   ......+|+.
T Consensus        10 ~~~~CPiT~~~~--------~~PV~s~~C~H~fek~aI~~-~i---~~~~~~~CPv   53 (57)
T PF11789_consen   10 ISLKCPITLQPF--------EDPVKSKKCGHTFEKEAILQ-YI---QRNGSKRCPV   53 (57)
T ss_dssp             --SB-TTTSSB---------SSEEEESSS--EEEHHHHHH-HC---TTTS-EE-SC
T ss_pred             eccCCCCcCChh--------hCCcCcCCCCCeecHHHHHH-HH---HhcCCCCCCC
Confidence            356666654443        33567778888887765543 43   2334566766


No 207
>KOG2807|consensus
Probab=43.82  E-value=36  Score=25.93  Aligned_cols=21  Identities=24%  Similarity=0.569  Sum_probs=12.4

Q ss_pred             cccccccccccCCHHHHHHHH
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHI   73 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~   73 (167)
                      |..|+.|+-.......|.+-.
T Consensus       290 P~eCpiC~ltLVss~hLARSy  310 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLARSY  310 (378)
T ss_pred             CccCCccceeEecchHHHHHH
Confidence            445666666666666665544


No 208
>KOG1701|consensus
Probab=43.65  E-value=18  Score=28.53  Aligned_cols=45  Identities=18%  Similarity=0.217  Sum_probs=27.9

Q ss_pred             ccccccccccCCHHHHHHHHHH-hcCCCCcccccchhhhhhccccccc
Q psy8167          54 IPCTLCDKTFTRKDSLKKHIRI-FHTQNQPQHTNVIEVALGARANAAF  100 (167)
Q Consensus        54 ~~C~~C~~~f~~~~~l~~H~~~-~h~~~~~~~c~~c~~~~~~~~~~~l  100 (167)
                      -.|-.|++...-...-..=|.+ .|  ..=|.|..|.+.+.-++..++
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fH--v~CFtC~~C~r~L~Gq~FY~v  320 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFH--VQCFTCRTCRRQLAGQSFYQV  320 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhc--ccceehHhhhhhhcccccccc
Confidence            3699999866655443333322 34  335899999888776444444


No 209
>KOG1280|consensus
Probab=42.96  E-value=27  Score=26.75  Aligned_cols=39  Identities=10%  Similarity=0.176  Sum_probs=29.1

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCCCC-cccccchh
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQNQ-PQHTNVIE   89 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~-~~~c~~c~   89 (167)
                      ..-|.|++|+..=.....|..|....|.... ..-|+.|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3469999999988888899999988886654 23455553


No 210
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=42.88  E-value=2.9  Score=30.61  Aligned_cols=17  Identities=29%  Similarity=0.524  Sum_probs=11.6

Q ss_pred             CCCcccccccccccCCH
Q psy8167          50 PIDRIPCTLCDKTFTRK   66 (167)
Q Consensus        50 ~~~~~~C~~C~~~f~~~   66 (167)
                      ....|.|++.+..|...
T Consensus       110 ~~~~~~CPvt~~~~~~~  126 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGK  126 (260)
T ss_pred             CCceeECCCCCcccCCc
Confidence            34668898888776433


No 211
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=42.60  E-value=11  Score=23.33  Aligned_cols=11  Identities=27%  Similarity=0.827  Sum_probs=5.5

Q ss_pred             eeccccccccc
Q psy8167         104 IRCELCDKSFT  114 (167)
Q Consensus       104 ~~C~~C~k~f~  114 (167)
                      +.|..||..|.
T Consensus         3 H~CtrCG~vf~   13 (112)
T COG3364           3 HQCTRCGEVFD   13 (112)
T ss_pred             ceecccccccc
Confidence            34555555443


No 212
>PTZ00448 hypothetical protein; Provisional
Probab=42.38  E-value=24  Score=27.26  Aligned_cols=22  Identities=23%  Similarity=0.628  Sum_probs=11.4

Q ss_pred             eecccccccccChhHHHHHHHh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      |.|..|+-.|......+.|+++
T Consensus       315 ~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        315 LLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             ccccccccccCCHHHHHHHhhh
Confidence            4455555555544555555544


No 213
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=41.63  E-value=11  Score=20.17  Aligned_cols=12  Identities=25%  Similarity=0.863  Sum_probs=6.3

Q ss_pred             ecccccccccCh
Q psy8167         105 RCELCDKSFTRK  116 (167)
Q Consensus       105 ~C~~C~k~f~~~  116 (167)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            799999888765


No 214
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=41.51  E-value=15  Score=27.74  Aligned_cols=77  Identities=16%  Similarity=0.091  Sum_probs=41.2

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhc-----
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFH-----  127 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~-----  127 (167)
                      .-.|++||..-.  ..+.... ....|.+-..|..|+..-..       .+..|..||..    ..|. ......     
T Consensus       184 ~~~CPvCGs~P~--~s~~~~~-~~~~G~RyL~CslC~teW~~-------~R~~C~~Cg~~----~~l~-y~~~e~~~~~~  248 (305)
T TIGR01562       184 RTLCPACGSPPV--ASMVRQG-GKETGLRYLSCSLCATEWHY-------VRVKCSHCEES----KHLA-YLSLEHDAEKA  248 (305)
T ss_pred             CCcCCCCCChhh--hhhhccc-CCCCCceEEEcCCCCCcccc-------cCccCCCCCCC----Ccee-eEeecCCCCCc
Confidence            347999996321  1111110 11456678899999754332       34689999953    1222 111111     


Q ss_pred             CCCCCCCCchhhhcCCH
Q psy8167         128 GGADPKLMDEQMARGSA  144 (167)
Q Consensus       128 ~~~~~~C~~C~~~f~~~  144 (167)
                      +.+-..|..|+...+.-
T Consensus       249 ~~r~e~C~~C~~YlK~~  265 (305)
T TIGR01562       249 VLKAETCDSCQGYLKIL  265 (305)
T ss_pred             ceEEeeccccccchhhh
Confidence            12345788888766654


No 215
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=41.31  E-value=13  Score=29.96  Aligned_cols=7  Identities=29%  Similarity=0.904  Sum_probs=3.1

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      |.|+.||
T Consensus       459 ~~cp~c~  465 (479)
T PRK05452        459 FLCPECS  465 (479)
T ss_pred             CcCcCCC
Confidence            3444444


No 216
>KOG2071|consensus
Probab=41.13  E-value=13  Score=30.38  Aligned_cols=28  Identities=0%  Similarity=-0.114  Sum_probs=20.1

Q ss_pred             CCCCCCCCchhhhcCCHHHHHHHHhhcC
Q psy8167         128 GGADPKLMDEQMARGSADFLEVVLNEDG  155 (167)
Q Consensus       128 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~  155 (167)
                      ...+-+|..||..|........|+..|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4556778888888887777777776554


No 217
>COG4640 Predicted membrane protein [Function unknown]
Probab=40.73  E-value=16  Score=28.47  Aligned_cols=16  Identities=31%  Similarity=0.837  Sum_probs=10.4

Q ss_pred             eecccccccccChhHH
Q psy8167         104 IRCELCDKSFTRKDSL  119 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l  119 (167)
                      ..|.+||..|......
T Consensus        16 ~qC~qCG~~~t~~~sq   31 (465)
T COG4640          16 VQCTQCGHKFTSRQSQ   31 (465)
T ss_pred             ccccccCCcCCchhhh
Confidence            4488888777666443


No 218
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=40.48  E-value=8.5  Score=19.20  Aligned_cols=9  Identities=22%  Similarity=0.549  Sum_probs=4.3

Q ss_pred             eeccccccc
Q psy8167         104 IRCELCDKS  112 (167)
Q Consensus       104 ~~C~~C~k~  112 (167)
                      |.|..||+.
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            445555543


No 219
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=40.44  E-value=30  Score=18.70  Aligned_cols=29  Identities=7%  Similarity=-0.033  Sum_probs=16.4

Q ss_pred             cccccccChhHHHHHHHhhcCCCCCCCCchhhhcC
Q psy8167         108 LCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARG  142 (167)
Q Consensus       108 ~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  142 (167)
                      -||..|.+.. +..+++.     ...|+.|++.+.
T Consensus        18 ~~G~v~~~~~-i~~~~~~-----~~~cP~~~~~~~   46 (63)
T smart00504       18 PSGQTYERRA-IEKWLLS-----HGTDPVTGQPLT   46 (63)
T ss_pred             CCCCEEeHHH-HHHHHHH-----CCCCCCCcCCCC
Confidence            4566665443 3445443     346888877764


No 220
>PRK12496 hypothetical protein; Provisional
Probab=40.04  E-value=11  Score=25.52  Aligned_cols=11  Identities=0%  Similarity=-0.212  Sum_probs=5.8

Q ss_pred             ccccchhhhhh
Q psy8167          83 QHTNVIEVALG   93 (167)
Q Consensus        83 ~~c~~c~~~~~   93 (167)
                      +.|.-|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            44555555553


No 221
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=39.92  E-value=17  Score=19.69  Aligned_cols=25  Identities=12%  Similarity=0.248  Sum_probs=13.0

Q ss_pred             ccccchhhhhhccccccccCceeccccccc
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDKS  112 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~  112 (167)
                      -.|..|++.|..  ...+   -.|+.||..
T Consensus         6 ~~C~~Cg~~~~~--~dDi---VvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKD--GDDI---VVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccC--CCCE---EECCCCCCc
Confidence            356666666643  1111   357777744


No 222
>PRK05580 primosome assembly protein PriA; Validated
Probab=39.81  E-value=7.8  Score=32.57  Aligned_cols=13  Identities=0%  Similarity=-0.276  Sum_probs=8.3

Q ss_pred             CCCCCCCCchhhh
Q psy8167         128 GGADPKLMDEQMA  140 (167)
Q Consensus       128 ~~~~~~C~~C~~~  140 (167)
                      ...+..|+.|+..
T Consensus       418 ~~~~~~Cp~Cg~~  430 (679)
T PRK05580        418 EPIPKACPECGST  430 (679)
T ss_pred             CCCCCCCCCCcCC
Confidence            3446778888654


No 223
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=39.72  E-value=4.5  Score=25.65  Aligned_cols=16  Identities=13%  Similarity=0.420  Sum_probs=11.4

Q ss_pred             CcccccccccccCCHH
Q psy8167          52 DRIPCTLCDKTFTRKD   67 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~   67 (167)
                      ..+.|..||..+....
T Consensus        21 ~~l~C~kCgye~~~~~   36 (113)
T COG1594          21 GKLVCRKCGYEEEASN   36 (113)
T ss_pred             cEEECCCCCcchhccc
Confidence            3688999998666553


No 224
>PRK00420 hypothetical protein; Validated
Probab=39.41  E-value=18  Score=22.89  Aligned_cols=29  Identities=17%  Similarity=0.189  Sum_probs=16.5

Q ss_pred             ccccchhhhhhccccccccCceecccccccccC
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDKSFTR  115 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~  115 (167)
                      -.|+.||..+..  .  -.....|+.||....-
T Consensus        24 ~~CP~Cg~pLf~--l--k~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         24 KHCPVCGLPLFE--L--KDGEVVCPVHGKVYIV   52 (112)
T ss_pred             CCCCCCCCccee--c--CCCceECCCCCCeeee
Confidence            567777765442  1  0223468888875544


No 225
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=38.89  E-value=3.8  Score=29.54  Aligned_cols=37  Identities=11%  Similarity=0.143  Sum_probs=12.3

Q ss_pred             Ccccccchhhhh-hccccccccCceecccccccccChh
Q psy8167          81 QPQHTNVIEVAL-GARANAAFIDRIRCELCDKSFTRKD  117 (167)
Q Consensus        81 ~~~~c~~c~~~~-~~~~~~~l~k~~~C~~C~k~f~~~~  117 (167)
                      +...|+.||..- ..-........|-|..|+..|..++
T Consensus        30 ~n~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~eeyELKS   67 (254)
T PF06044_consen   30 ENMYCPNCGSKPLSKFENNRPVADFYCPNCNEEYELKS   67 (254)
T ss_dssp             HH---TTT--SS-EE--------EEE-TTT--EEEEEE
T ss_pred             HCCcCCCCCChhHhhccCCCccceeECCCCchHHhhhh
Confidence            345677776652 1111122255677888877776554


No 226
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=38.66  E-value=17  Score=27.50  Aligned_cols=78  Identities=18%  Similarity=0.147  Sum_probs=43.3

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHH-HHhh-cCC
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKH-NRIF-HGG  129 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H-~~~h-~~~  129 (167)
                      ..-.|++||..-.  ..+ .+. ....|.+-..|..|+..-..       .+..|..||..    ..|.-+ ...- ...
T Consensus       186 ~~~~CPvCGs~P~--~s~-v~~-~~~~G~RyL~CslC~teW~~-------~R~~C~~Cg~~----~~l~y~~~~~~~~~~  250 (309)
T PRK03564        186 QRQFCPVCGSMPV--SSV-VQI-GTTQGLRYLHCNLCESEWHV-------VRVKCSNCEQS----GKLHYWSLDSEQAAV  250 (309)
T ss_pred             CCCCCCCCCCcch--hhe-eec-cCCCCceEEEcCCCCCcccc-------cCccCCCCCCC----CceeeeeecCCCcce
Confidence            3467999996322  111 122 22456778899999754332       33589999952    222211 1100 112


Q ss_pred             CCCCCCchhhhcCCH
Q psy8167         130 ADPKLMDEQMARGSA  144 (167)
Q Consensus       130 ~~~~C~~C~~~f~~~  144 (167)
                      +-..|..|+..++.-
T Consensus       251 r~e~C~~C~~YlK~~  265 (309)
T PRK03564        251 KAESCGDCGTYLKIL  265 (309)
T ss_pred             Eeeecccccccceec
Confidence            347799998777664


No 227
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=38.61  E-value=13  Score=22.84  Aligned_cols=20  Identities=5%  Similarity=-0.184  Sum_probs=14.0

Q ss_pred             HHhhcCCCCCCCCchhhhcCC
Q psy8167         123 NRIFHGGADPKLMDEQMARGS  143 (167)
Q Consensus       123 ~~~h~~~~~~~C~~C~~~f~~  143 (167)
                      +..+ .++++.|..||..|.-
T Consensus        72 ~~l~-~g~~~rC~eCG~~fkL   91 (97)
T cd00924          72 MWLE-KGKPKRCPECGHVFKL   91 (97)
T ss_pred             EEEe-CCCceeCCCCCcEEEE
Confidence            4443 3478999999888753


No 228
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=38.11  E-value=22  Score=18.98  Aligned_cols=9  Identities=33%  Similarity=0.955  Sum_probs=5.3

Q ss_pred             eeccccccc
Q psy8167         104 IRCELCDKS  112 (167)
Q Consensus       104 ~~C~~C~k~  112 (167)
                      ++|+.|+..
T Consensus        25 IKCpRC~ti   33 (51)
T PF10122_consen   25 IKCPRCKTI   33 (51)
T ss_pred             EECCCCCcc
Confidence            456666644


No 229
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=38.08  E-value=17  Score=28.68  Aligned_cols=14  Identities=0%  Similarity=-0.221  Sum_probs=8.6

Q ss_pred             CCCCCchhhhcCCH
Q psy8167         131 DPKLMDEQMARGSA  144 (167)
Q Consensus       131 ~~~C~~C~~~f~~~  144 (167)
                      -|+|..||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666665554


No 230
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=37.92  E-value=16  Score=31.33  Aligned_cols=33  Identities=9%  Similarity=0.000  Sum_probs=14.8

Q ss_pred             cccchhhhhhccccccccCceecccccccccCh
Q psy8167          84 HTNVIEVALGARANAAFIDRIRCELCDKSFTRK  116 (167)
Q Consensus        84 ~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~  116 (167)
                      .|..|++.|..-...-..+++.|..||..|-..
T Consensus       462 tC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~  494 (1374)
T PTZ00303        462 SCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVF  494 (1374)
T ss_pred             cccCcCCcccccccccccccccccCCccccCcc
Confidence            355666555431011112445566666544443


No 231
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=37.89  E-value=31  Score=25.74  Aligned_cols=22  Identities=9%  Similarity=-0.422  Sum_probs=11.1

Q ss_pred             CCCCCchhhhcCCHHHHHHHHh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      -|-|..|=+.|.+...|.+|+.
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHH
Confidence            3445555555555555555544


No 232
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=37.71  E-value=3.5  Score=21.56  Aligned_cols=12  Identities=0%  Similarity=-0.427  Sum_probs=6.7

Q ss_pred             CCCCCc--hhhhcC
Q psy8167         131 DPKLMD--EQMARG  142 (167)
Q Consensus       131 ~~~C~~--C~~~f~  142 (167)
                      -++|..  ||..|.
T Consensus        25 Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   25 YCQCTNPECGHTFV   38 (47)
T ss_pred             EEEECCCcCCCEEE
Confidence            355554  666654


No 233
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=37.71  E-value=15  Score=18.66  Aligned_cols=15  Identities=40%  Similarity=0.758  Sum_probs=8.9

Q ss_pred             CceecccccccccCh
Q psy8167         102 DRIRCELCDKSFTRK  116 (167)
Q Consensus       102 k~~~C~~C~k~f~~~  116 (167)
                      -++.|..|++.|=..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            357899999888654


No 234
>KOG0402|consensus
Probab=37.36  E-value=16  Score=21.67  Aligned_cols=30  Identities=13%  Similarity=0.174  Sum_probs=15.5

Q ss_pred             cccccchhhhhhccccccccCceeccccccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKSFT  114 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~  114 (167)
                      .|.|..||+....+....   -+.|..|.+.|.
T Consensus        36 ky~CsfCGK~~vKR~AvG---iW~C~~C~kv~a   65 (92)
T KOG0402|consen   36 KYTCSFCGKKTVKRKAVG---IWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhhcchhhhhhhcee---EEecCCccceec
Confidence            366777766544311111   256666666554


No 235
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.35  E-value=27  Score=20.53  Aligned_cols=40  Identities=15%  Similarity=0.172  Sum_probs=23.8

Q ss_pred             ccchhhhhhccccccccCceecccccccccChhHHHHHHHh
Q psy8167          85 TNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRI  125 (167)
Q Consensus        85 c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~  125 (167)
                      |++|+-.........++.. .|+.|+-....+..|..-+..
T Consensus         4 CP~C~v~l~~~~rs~vEiD-~CPrCrGVWLDrGELdKli~r   43 (88)
T COG3809           4 CPICGVELVMSVRSGVEID-YCPRCRGVWLDRGELDKLIER   43 (88)
T ss_pred             cCcCCceeeeeeecCceee-eCCccccEeecchhHHHHHHH
Confidence            5555544333222333333 399999998888888766554


No 236
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=37.26  E-value=16  Score=29.19  Aligned_cols=7  Identities=29%  Similarity=0.947  Sum_probs=4.0

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      .+|+.|+
T Consensus        22 g~Cp~C~   28 (454)
T TIGR00416        22 GKCPACH   28 (454)
T ss_pred             EECcCCC
Confidence            4566665


No 237
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=37.19  E-value=15  Score=23.67  Aligned_cols=11  Identities=27%  Similarity=0.510  Sum_probs=5.1

Q ss_pred             cccccccccccC
Q psy8167          53 RIPCTLCDKTFT   64 (167)
Q Consensus        53 ~~~C~~C~~~f~   64 (167)
                      .+.| .||..|.
T Consensus        70 ~~~C-~Cg~~~~   80 (124)
T PRK00762         70 EIEC-ECGYEGV   80 (124)
T ss_pred             eEEe-eCcCccc
Confidence            3445 5554433


No 238
>KOG2071|consensus
Probab=37.18  E-value=20  Score=29.46  Aligned_cols=28  Identities=21%  Similarity=0.418  Sum_probs=23.5

Q ss_pred             CCcccccccccccCCHHHHHHHHHHhcCC
Q psy8167          51 IDRIPCTLCDKTFTRKDSLKKHIRIFHTQ   79 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~   79 (167)
                      ..+-.|..||.+|.+......|| ..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~m-d~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHM-DIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHh-hhhhh
Confidence            45688999999999999999998 66754


No 239
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=37.12  E-value=15  Score=18.62  Aligned_cols=10  Identities=20%  Similarity=0.956  Sum_probs=8.0

Q ss_pred             eecccccccc
Q psy8167         104 IRCELCDKSF  113 (167)
Q Consensus       104 ~~C~~C~k~f  113 (167)
                      -.|++||..|
T Consensus        30 ~~CpYCg~~y   39 (40)
T PF10276_consen   30 VVCPYCGTRY   39 (40)
T ss_dssp             EEETTTTEEE
T ss_pred             EECCCCCCEE
Confidence            5788888776


No 240
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=37.08  E-value=9.3  Score=32.07  Aligned_cols=72  Identities=13%  Similarity=0.105  Sum_probs=37.4

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccc--cCc------e-ecccccccccChhHHHHHH
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAF--IDR------I-RCELCDKSFTRKDSLKKHN  123 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l--~k~------~-~C~~C~k~f~~~~~l~~H~  123 (167)
                      .-.|+.|-+.+.+..+=+-+.       .--.|..||=+|.-  .-.|  .+.      | -|+.|.+.|....+-+-| 
T Consensus       101 ~a~C~~Cl~Ei~dp~~rrY~Y-------PF~~CT~CGPRfTI--i~alPYDR~nTsM~~F~lC~~C~~EY~dP~nRRfH-  170 (750)
T COG0068         101 AATCEDCLEEIFDPNSRRYLY-------PFINCTNCGPRFTI--IEALPYDRENTSMADFPLCPFCDKEYKDPLNRRFH-  170 (750)
T ss_pred             hhhhHHHHHHhcCCCCcceec-------cccccCCCCcceee--eccCCCCcccCccccCcCCHHHHHHhcCccccccc-
Confidence            345777765444443311110       11357777766654  2222  111      2 388888877776664333 


Q ss_pred             HhhcCCCCCCCCchhh
Q psy8167         124 RIFHGGADPKLMDEQM  139 (167)
Q Consensus       124 ~~h~~~~~~~C~~C~~  139 (167)
                          . .|..|+.||=
T Consensus       171 ----A-Qp~aCp~CGP  181 (750)
T COG0068         171 ----A-QPIACPKCGP  181 (750)
T ss_pred             ----c-ccccCcccCC
Confidence                2 2777888863


No 241
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=37.08  E-value=17  Score=19.78  Aligned_cols=7  Identities=29%  Similarity=0.952  Sum_probs=3.6

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      |.|+.||
T Consensus        15 ~~Cp~cG   21 (55)
T PF13824_consen   15 FECPDCG   21 (55)
T ss_pred             CcCCCCC
Confidence            4555555


No 242
>PRK04351 hypothetical protein; Provisional
Probab=36.44  E-value=17  Score=24.34  Aligned_cols=33  Identities=15%  Similarity=0.170  Sum_probs=22.5

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGS  143 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  143 (167)
                      .|.|..||..+.+.       +. +....|.|..|+-.+..
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr-~n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RR-INTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee-------ee-cCCCcEEeCCCCcEeee
Confidence            37898899776542       22 34478999999866543


No 243
>PLN02294 cytochrome c oxidase subunit Vb
Probab=36.40  E-value=14  Score=25.27  Aligned_cols=21  Identities=5%  Similarity=-0.276  Sum_probs=15.7

Q ss_pred             HHhhcCCCCCCCCchhhhcCCH
Q psy8167         123 NRIFHGGADPKLMDEQMARGSA  144 (167)
Q Consensus       123 ~~~h~~~~~~~C~~C~~~f~~~  144 (167)
                      +.. +.+++..|..||..|.-.
T Consensus       134 f~L-~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        134 FWL-EKGKSFECPVCTQYFELE  154 (174)
T ss_pred             EEe-cCCCceeCCCCCCEEEEE
Confidence            444 456799999999988643


No 244
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=36.38  E-value=22  Score=25.97  Aligned_cols=34  Identities=24%  Similarity=0.442  Sum_probs=22.3

Q ss_pred             CceecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         102 DRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       102 k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      ..+.|..|+..+.........    ....+..|+.|+.
T Consensus       121 ~~~~C~~C~~~~~~~~~~~~~----~~~~~p~C~~Cg~  154 (250)
T COG0846         121 KRVRCSKCGNQYYDEDVIKFI----EDGLIPRCPKCGG  154 (250)
T ss_pred             eeeEeCCCcCccchhhhhhhc----ccCCCCcCccCCC
Confidence            445799999888755422211    2226889999987


No 245
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=35.96  E-value=24  Score=19.74  Aligned_cols=9  Identities=0%  Similarity=-0.286  Sum_probs=3.6

Q ss_pred             CCCCchhhh
Q psy8167         132 PKLMDEQMA  140 (167)
Q Consensus       132 ~~C~~C~~~  140 (167)
                      +.|+.||..
T Consensus        47 ~~C~~Cg~~   55 (69)
T PF07282_consen   47 FTCPNCGFE   55 (69)
T ss_pred             EEcCCCCCE
Confidence            344444433


No 246
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=35.89  E-value=25  Score=18.67  Aligned_cols=7  Identities=0%  Similarity=-0.610  Sum_probs=2.9

Q ss_pred             CCCCchh
Q psy8167         132 PKLMDEQ  138 (167)
Q Consensus       132 ~~C~~C~  138 (167)
                      +.|..||
T Consensus        38 ~~C~~Cg   44 (50)
T PRK00432         38 WHCGKCG   44 (50)
T ss_pred             EECCCcC
Confidence            3344443


No 247
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=35.82  E-value=16  Score=24.41  Aligned_cols=12  Identities=0%  Similarity=-0.175  Sum_probs=6.9

Q ss_pred             ccccchhhhhhc
Q psy8167          83 QHTNVIEVALGA   94 (167)
Q Consensus        83 ~~c~~c~~~~~~   94 (167)
                      -.|..|+..|..
T Consensus        29 ReC~~C~~RFTT   40 (156)
T COG1327          29 RECLECGERFTT   40 (156)
T ss_pred             hcccccccccch
Confidence            456666665555


No 248
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=35.56  E-value=19  Score=30.85  Aligned_cols=33  Identities=12%  Similarity=0.165  Sum_probs=19.0

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCH
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSA  144 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  144 (167)
                      .|..|++.|......       .+.+++.|..||..|-..
T Consensus       462 tC~~C~kkFfSlsK~-------L~~RKHHCRkCGrVFC~~  494 (1374)
T PTZ00303        462 SCPSCGRAFISLSRP-------LGTRAHHCRSCGIRLCVF  494 (1374)
T ss_pred             cccCcCCcccccccc-------cccccccccCCccccCcc
Confidence            599999999764210       122345566666555443


No 249
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=35.46  E-value=18  Score=24.05  Aligned_cols=11  Identities=36%  Similarity=0.863  Sum_probs=5.1

Q ss_pred             ecccccccccC
Q psy8167         105 RCELCDKSFTR  115 (167)
Q Consensus       105 ~C~~C~k~f~~  115 (167)
                      .|..||+.|..
T Consensus        30 eC~~C~~RFTT   40 (147)
T TIGR00244        30 ECLECHERFTT   40 (147)
T ss_pred             cCCccCCccce
Confidence            34444444444


No 250
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=35.33  E-value=17  Score=18.21  Aligned_cols=8  Identities=0%  Similarity=-0.484  Sum_probs=3.3

Q ss_pred             CCCCchhh
Q psy8167         132 PKLMDEQM  139 (167)
Q Consensus       132 ~~C~~C~~  139 (167)
                      |.|..|++
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44444443


No 251
>KOG1729|consensus
Probab=35.30  E-value=5.6  Score=29.63  Aligned_cols=6  Identities=0%  Similarity=-0.861  Sum_probs=2.9

Q ss_pred             CCCchh
Q psy8167         133 KLMDEQ  138 (167)
Q Consensus       133 ~C~~C~  138 (167)
                      .|+.|-
T Consensus       216 vC~~CF  221 (288)
T KOG1729|consen  216 VCDICF  221 (288)
T ss_pred             ecHHHH
Confidence            455553


No 252
>PRK11823 DNA repair protein RadA; Provisional
Probab=35.15  E-value=18  Score=28.81  Aligned_cols=7  Identities=43%  Similarity=0.952  Sum_probs=3.6

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      .+|+.|+
T Consensus        22 g~Cp~C~   28 (446)
T PRK11823         22 GRCPECG   28 (446)
T ss_pred             eeCcCCC
Confidence            3455554


No 253
>KOG2907|consensus
Probab=35.02  E-value=29  Score=21.92  Aligned_cols=8  Identities=25%  Similarity=0.787  Sum_probs=6.5

Q ss_pred             cccccccc
Q psy8167          54 IPCTLCDK   61 (167)
Q Consensus        54 ~~C~~C~~   61 (167)
                      .+|+.||-
T Consensus        75 ~kCpkCgh   82 (116)
T KOG2907|consen   75 HKCPKCGH   82 (116)
T ss_pred             ccCcccCC
Confidence            67999985


No 254
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=34.86  E-value=23  Score=23.38  Aligned_cols=33  Identities=15%  Similarity=0.116  Sum_probs=21.4

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcC
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARG  142 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  142 (167)
                      .|.|..|+..+.+      +.+ +.....|.|..|+-.+.
T Consensus       112 ~y~C~~C~~~~~~------~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLR------VRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCce------Ecc-ccCcceEEcCCCCCEEE
Confidence            5789889977642      222 22226799999986553


No 255
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=34.82  E-value=25  Score=23.03  Aligned_cols=57  Identities=12%  Similarity=0.158  Sum_probs=32.8

Q ss_pred             CCCCcccccchhhhhhccccccccCceec---ccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHH
Q psy8167          78 TQNQPQHTNVIEVALGARANAAFIDRIRC---ELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSAD  145 (167)
Q Consensus        78 ~~~~~~~c~~c~~~~~~~~~~~l~k~~~C---~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~  145 (167)
                      ...+-|+|.+|..+...  ...| ||-.|   .+|+--+   .+|..|-.     .-.+|+.|.-+|.+..
T Consensus        76 ~d~~lYeCnIC~etS~e--e~FL-KPneCCgY~iCn~Cy---a~LWK~~~-----~ypvCPvCkTSFKss~  135 (140)
T PF05290_consen   76 LDPKLYECNICKETSAE--ERFL-KPNECCGYSICNACY---ANLWKFCN-----LYPVCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCceeccCcccccch--hhcC-CcccccchHHHHHHH---HHHHHHcc-----cCCCCCcccccccccc
Confidence            44577999999887766  3222 23333   1232222   23444433     3568999998888764


No 256
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=34.75  E-value=17  Score=26.60  Aligned_cols=27  Identities=26%  Similarity=0.381  Sum_probs=21.1

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchh
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQ  138 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~  138 (167)
                      .|+.||........|       |..-.|+|+.|-
T Consensus       222 ~CP~Cg~~W~L~~pl-------h~iFdFKCD~CR  248 (258)
T PF10071_consen  222 KCPSCGGDWRLKEPL-------HDIFDFKCDPCR  248 (258)
T ss_pred             CCCCCCCccccCCch-------hhceeccCCcce
Confidence            699999887776665       455689999985


No 257
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=34.35  E-value=10  Score=23.40  Aligned_cols=12  Identities=0%  Similarity=-0.344  Sum_probs=6.7

Q ss_pred             CCCCchhhhcCC
Q psy8167         132 PKLMDEQMARGS  143 (167)
Q Consensus       132 ~~C~~C~~~f~~  143 (167)
                      ..|..||..+..
T Consensus        43 ~~C~~CG~y~~~   54 (99)
T PRK14892         43 ITCGNCGLYTEF   54 (99)
T ss_pred             EECCCCCCccCE
Confidence            456666655543


No 258
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=34.22  E-value=14  Score=23.02  Aligned_cols=8  Identities=0%  Similarity=-0.429  Sum_probs=5.3

Q ss_pred             CCCCchhh
Q psy8167         132 PKLMDEQM  139 (167)
Q Consensus       132 ~~C~~C~~  139 (167)
                      |.|..|+-
T Consensus        32 y~C~~C~A   39 (102)
T PF11672_consen   32 YVCTPCDA   39 (102)
T ss_pred             EECCCCCc
Confidence            67777753


No 259
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=33.67  E-value=88  Score=24.22  Aligned_cols=22  Identities=18%  Similarity=0.643  Sum_probs=11.1

Q ss_pred             Ccccccccc-cccCCHHHHHHHH
Q psy8167          52 DRIPCTLCD-KTFTRKDSLKKHI   73 (167)
Q Consensus        52 ~~~~C~~C~-~~f~~~~~l~~H~   73 (167)
                      +.|.|.+|| +.+.-+..|.+|.
T Consensus       373 ~ef~CEICgNyvy~GR~~FdrHF  395 (470)
T COG5188         373 IEFECEICGNYVYYGRDRFDRHF  395 (470)
T ss_pred             cceeeeecccccccchHHHHhhh
Confidence            345566665 4444444454443


No 260
>PRK05978 hypothetical protein; Provisional
Probab=33.66  E-value=21  Score=23.82  Aligned_cols=8  Identities=25%  Similarity=0.742  Sum_probs=4.9

Q ss_pred             cccccccc
Q psy8167          54 IPCTLCDK   61 (167)
Q Consensus        54 ~~C~~C~~   61 (167)
                      -+|+.||+
T Consensus        34 grCP~CG~   41 (148)
T PRK05978         34 GRCPACGE   41 (148)
T ss_pred             CcCCCCCC
Confidence            45666665


No 261
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=33.66  E-value=16  Score=24.16  Aligned_cols=31  Identities=16%  Similarity=0.223  Sum_probs=18.9

Q ss_pred             ceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc
Q psy8167         103 RIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR  141 (167)
Q Consensus       103 ~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  141 (167)
                      .|.|..|+..+....      +.  ....|.|..|+-.|
T Consensus       123 ~~~C~~C~~~~~r~~------~~--~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKRHR------RS--KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeeeec------cc--chhhEECCCCCCEE
Confidence            467888887764432      22  22358888887554


No 262
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.63  E-value=19  Score=23.21  Aligned_cols=13  Identities=23%  Similarity=0.654  Sum_probs=9.3

Q ss_pred             ecccccccccChh
Q psy8167         105 RCELCDKSFTRKD  117 (167)
Q Consensus       105 ~C~~C~k~f~~~~  117 (167)
                      -|..||+.|.+-.
T Consensus        70 fchncgs~fpwte   82 (160)
T COG4306          70 FCHNCGSRFPWTE   82 (160)
T ss_pred             hhhcCCCCCCcHH
Confidence            4778888887753


No 263
>KOG1994|consensus
Probab=33.54  E-value=23  Score=25.40  Aligned_cols=21  Identities=19%  Similarity=0.616  Sum_probs=18.5

Q ss_pred             CcccccccccccCCHHHHHHH
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKH   72 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H   72 (167)
                      .-|.|-+||..|.....|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            348899999999999999776


No 264
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=33.16  E-value=17  Score=25.42  Aligned_cols=9  Identities=44%  Similarity=1.099  Sum_probs=6.3

Q ss_pred             ccccccccc
Q psy8167          54 IPCTLCDKT   62 (167)
Q Consensus        54 ~~C~~C~~~   62 (167)
                      ..|+.||..
T Consensus        15 ~~CPvCg~~   23 (201)
T COG1779          15 IDCPVCGGT   23 (201)
T ss_pred             ecCCcccce
Confidence            558888863


No 265
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=32.47  E-value=26  Score=22.87  Aligned_cols=9  Identities=0%  Similarity=-0.525  Sum_probs=4.3

Q ss_pred             CCCCCchhh
Q psy8167         131 DPKLMDEQM  139 (167)
Q Consensus       131 ~~~C~~C~~  139 (167)
                      ...|+.|++
T Consensus       105 ~~~CPwCg~  113 (131)
T PF15616_consen  105 EVTCPWCGN  113 (131)
T ss_pred             CEECCCCCC
Confidence            444555543


No 266
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=31.63  E-value=24  Score=27.43  Aligned_cols=21  Identities=10%  Similarity=0.003  Sum_probs=11.1

Q ss_pred             ccccchhhhhhccccccccCceeccccc
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCD  110 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~  110 (167)
                      |.|..||.....  +     -.+|+.|+
T Consensus         1 ~~c~~cg~~~~~--~-----~g~cp~c~   21 (372)
T cd01121           1 YVCSECGYVSPK--W-----LGKCPECG   21 (372)
T ss_pred             CCCCCCCCCCCC--c-----cEECcCCC
Confidence            456666654443  1     14566666


No 267
>KOG3990|consensus
Probab=31.45  E-value=29  Score=25.35  Aligned_cols=15  Identities=20%  Similarity=0.481  Sum_probs=8.5

Q ss_pred             cccccccccccCCHH
Q psy8167          53 RIPCTLCDKTFTRKD   67 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~   67 (167)
                      .|.|..|..+|....
T Consensus         6 L~aCtkC~~r~p~ea   20 (305)
T KOG3990|consen    6 LYACTKCRQRLPFEA   20 (305)
T ss_pred             HHHHHhHhhhCcHHH
Confidence            456666666655443


No 268
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.43  E-value=19  Score=20.04  Aligned_cols=12  Identities=17%  Similarity=0.741  Sum_probs=9.0

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      -.|++|++.|..
T Consensus        49 v~CPYC~t~y~l   60 (62)
T COG4391          49 VVCPYCSTRYRL   60 (62)
T ss_pred             EecCccccEEEe
Confidence            468888888764


No 269
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=31.40  E-value=24  Score=22.92  Aligned_cols=16  Identities=38%  Similarity=0.719  Sum_probs=9.7

Q ss_pred             CCcccccccccccCCH
Q psy8167          51 IDRIPCTLCDKTFTRK   66 (167)
Q Consensus        51 ~~~~~C~~C~~~f~~~   66 (167)
                      ...|+|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            3456666666666554


No 270
>PTZ00448 hypothetical protein; Provisional
Probab=30.80  E-value=36  Score=26.35  Aligned_cols=23  Identities=0%  Similarity=-0.229  Sum_probs=20.7

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNE  153 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~  153 (167)
                      .|.|..|+-.|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999999999999974


No 271
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=30.66  E-value=31  Score=18.03  Aligned_cols=6  Identities=50%  Similarity=1.492  Sum_probs=2.5

Q ss_pred             eecccc
Q psy8167         104 IRCELC  109 (167)
Q Consensus       104 ~~C~~C  109 (167)
                      |+|..|
T Consensus        16 ~~C~~C   21 (49)
T cd02335          16 IKCAEC   21 (49)
T ss_pred             EECCCC
Confidence            444433


No 272
>PTZ00064 histone acetyltransferase; Provisional
Probab=30.57  E-value=45  Score=27.07  Aligned_cols=31  Identities=13%  Similarity=-0.323  Sum_probs=21.8

Q ss_pred             CCCCCCchhhhcCCHHHHHHHHhhcCCCCCc
Q psy8167         130 ADPKLMDEQMARGSADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       130 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~  160 (167)
                      .-|-|..|=+.|.....|.+|+.......|+
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~~~C~~rhPP  309 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHLSRCQLRHPP  309 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHHhcCCCCCCC
Confidence            4577888888888888888888754433444


No 273
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=30.51  E-value=43  Score=26.77  Aligned_cols=31  Identities=6%  Similarity=-0.254  Sum_probs=23.7

Q ss_pred             CCCCCchhhhcCCHHHHHHHHhhcCCCCCcc
Q psy8167         131 DPKLMDEQMARGSADFLEVVLNEDGEGEPVS  161 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~  161 (167)
                      -|-|..|=+.|.....|.+|+....-..|.-
T Consensus       198 lyiCe~Cl~y~~~~~~~~~H~~~C~~~~PPG  228 (450)
T PLN00104        198 LYFCEFCLKFMKRKEQLQRHMKKCDLKHPPG  228 (450)
T ss_pred             EEEchhhhhhhcCHHHHHHHHhcCCCCCCCc
Confidence            4779999999999999999997555444443


No 274
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=30.29  E-value=26  Score=24.55  Aligned_cols=8  Identities=25%  Similarity=0.800  Sum_probs=4.2

Q ss_pred             cccccccc
Q psy8167          55 PCTLCDKT   62 (167)
Q Consensus        55 ~C~~C~~~   62 (167)
                      .|+.|+..
T Consensus         2 ~Cp~C~~~    9 (192)
T TIGR00310         2 DCPSCGGE    9 (192)
T ss_pred             cCCCCCCC
Confidence            35666543


No 275
>PLN02748 tRNA dimethylallyltransferase
Probab=30.11  E-value=36  Score=27.42  Aligned_cols=24  Identities=8%  Similarity=-0.273  Sum_probs=20.1

Q ss_pred             CCCCCCchhh-hcCCHHHHHHHHhh
Q psy8167         130 ADPKLMDEQM-ARGSADFLEVVLNE  153 (167)
Q Consensus       130 ~~~~C~~C~~-~f~~~~~l~~H~~~  153 (167)
                      +.|.|..|++ .+....++..|++.
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcc
Confidence            5678999997 89999999999863


No 276
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=30.05  E-value=8.7  Score=21.90  Aligned_cols=26  Identities=19%  Similarity=0.331  Sum_probs=10.9

Q ss_pred             ccccchhhhhhccccccccCceecccccccc
Q psy8167          83 QHTNVIEVALGARANAAFIDRIRCELCDKSF  113 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f  113 (167)
                      |.| .||.....+..   .+.-+| .||+..
T Consensus         4 frC-~Cgr~lya~e~---~kTkkC-~CG~~l   29 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEG---AKTKKC-VCGKTL   29 (68)
T ss_dssp             EEE-TTS--EEEETT----SEEEE-TTTEEE
T ss_pred             EEe-cCCCEEEecCC---cceeEe-cCCCee
Confidence            455 46655443111   122357 777653


No 277
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=29.45  E-value=34  Score=17.98  Aligned_cols=6  Identities=33%  Similarity=1.126  Sum_probs=2.4

Q ss_pred             eecccc
Q psy8167         104 IRCELC  109 (167)
Q Consensus       104 ~~C~~C  109 (167)
                      |+|..|
T Consensus        16 ~~C~~C   21 (48)
T cd02341          16 YHCSEC   21 (48)
T ss_pred             EECCCC
Confidence            344443


No 278
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=29.39  E-value=22  Score=26.10  Aligned_cols=33  Identities=12%  Similarity=-0.031  Sum_probs=19.5

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMA  140 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  140 (167)
                      ..|.-||..|-+.-.+..-    +..+.-.|+.|-..
T Consensus       228 ps~t~CgHlFC~~Cl~~~~----t~~k~~~CplCRak  260 (271)
T COG5574         228 PSCTPCGHLFCLSCLLISW----TKKKYEFCPLCRAK  260 (271)
T ss_pred             cccccccchhhHHHHHHHH----HhhccccCchhhhh
Confidence            4577788888777666541    22233338888543


No 279
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=29.31  E-value=35  Score=26.29  Aligned_cols=30  Identities=3%  Similarity=-0.165  Sum_probs=22.6

Q ss_pred             HHhhcCCCCCCCCchh-hhcCCHHHHHHHHh
Q psy8167         123 NRIFHGGADPKLMDEQ-MARGSADFLEVVLN  152 (167)
Q Consensus       123 ~~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  152 (167)
                      .+.|--++.|.|.+|| +.+.....+.+|-.
T Consensus       366 ~klhgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         366 CKLHGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             HHhcCCCcceeeeecccccccchHHHHhhhh
Confidence            4555667889999998 77777777777764


No 280
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=29.21  E-value=45  Score=16.51  Aligned_cols=10  Identities=0%  Similarity=-0.656  Sum_probs=2.5

Q ss_pred             CCCCchhhhc
Q psy8167         132 PKLMDEQMAR  141 (167)
Q Consensus       132 ~~C~~C~~~f  141 (167)
                      |=|+.|+..|
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            4455555444


No 281
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.63  E-value=28  Score=17.16  Aligned_cols=11  Identities=27%  Similarity=0.688  Sum_probs=5.6

Q ss_pred             ceecccccccc
Q psy8167         103 RIRCELCDKSF  113 (167)
Q Consensus       103 ~~~C~~C~k~f  113 (167)
                      -|+|..||...
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            37899988643


No 282
>KOG3362|consensus
Probab=28.55  E-value=16  Score=24.19  Aligned_cols=22  Identities=9%  Similarity=-0.099  Sum_probs=13.0

Q ss_pred             CCCCCchhhhcCCHHHHHHHHh
Q psy8167         131 DPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       131 ~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      +|.|.-||-.+-+..-|..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            4566666666666655555543


No 283
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=28.52  E-value=28  Score=17.98  Aligned_cols=13  Identities=15%  Similarity=0.296  Sum_probs=8.0

Q ss_pred             eecccccccccCh
Q psy8167         104 IRCELCDKSFTRK  116 (167)
Q Consensus       104 ~~C~~C~k~f~~~  116 (167)
                      |-|..|+..+-..
T Consensus        12 ~~CL~C~~~~c~~   24 (50)
T smart00290       12 WLCLTCGQVGCGR   24 (50)
T ss_pred             EEecCCCCcccCC
Confidence            5677777665544


No 284
>KOG1842|consensus
Probab=28.49  E-value=34  Score=27.23  Aligned_cols=29  Identities=17%  Similarity=0.370  Sum_probs=24.0

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCC
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGG  129 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~  129 (167)
                      ...|.|++|+..|.....|..|...-|.+
T Consensus        13 ~egflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   13 LEGFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             hhcccCchHhhhhhhHHHHHHHHhhhccc
Confidence            34478999999999999999998876654


No 285
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=28.27  E-value=24  Score=23.23  Aligned_cols=12  Identities=0%  Similarity=-0.260  Sum_probs=7.9

Q ss_pred             ccccchhhhhhc
Q psy8167          83 QHTNVIEVALGA   94 (167)
Q Consensus        83 ~~c~~c~~~~~~   94 (167)
                      -+|..||..|..
T Consensus        30 ~kC~~CG~v~~P   41 (140)
T COG1545          30 TKCKKCGRVYFP   41 (140)
T ss_pred             EEcCCCCeEEcC
Confidence            467777766655


No 286
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=28.22  E-value=26  Score=26.07  Aligned_cols=78  Identities=12%  Similarity=0.021  Sum_probs=28.1

Q ss_pred             ccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhccccccccCceecccccccccChhHHHHHHHhhcCCCCCC
Q psy8167          54 IPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGARANAAFIDRIRCELCDKSFTRKDSLKKHNRIFHGGADPK  133 (167)
Q Consensus        54 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~  133 (167)
                      -.|++||..-. -+.+..-.   ..|.+-..|..|+..-..       .+..|+.||-.-...-.+.. ...--+.+-+.
T Consensus       173 g~CPvCGs~P~-~s~l~~~~---~~G~R~L~Cs~C~t~W~~-------~R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~  240 (290)
T PF04216_consen  173 GYCPVCGSPPV-LSVLRGGE---REGKRYLHCSLCGTEWRF-------VRIKCPYCGNTDHEKLEYFT-VEGEPAYRVEV  240 (290)
T ss_dssp             SS-TTT---EE-EEEEE---------EEEEEETTT--EEE---------TTS-TTT---SS-EEE---------SEEEEE
T ss_pred             CcCCCCCCcCc-eEEEecCC---CCccEEEEcCCCCCeeee-------cCCCCcCCCCCCCcceeeEe-cCCCCcEEEEE
Confidence            46999985311 11111111   125567888888754332       23579999955333222110 01101122366


Q ss_pred             CCchhhhcCC
Q psy8167         134 LMDEQMARGS  143 (167)
Q Consensus       134 C~~C~~~f~~  143 (167)
                      |..|+..++.
T Consensus       241 C~~C~~YlK~  250 (290)
T PF04216_consen  241 CESCGSYLKT  250 (290)
T ss_dssp             ETTTTEEEEE
T ss_pred             CCcccchHHH
Confidence            8888765543


No 287
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=27.76  E-value=23  Score=20.92  Aligned_cols=11  Identities=36%  Similarity=1.068  Sum_probs=4.6

Q ss_pred             ecccccccccC
Q psy8167         105 RCELCDKSFTR  115 (167)
Q Consensus       105 ~C~~C~k~f~~  115 (167)
                      .|..||..|..
T Consensus        48 ~C~~Cg~~~~~   58 (81)
T PF05129_consen   48 SCRVCGESFQT   58 (81)
T ss_dssp             EESSS--EEEE
T ss_pred             EecCCCCeEEE
Confidence            45555555443


No 288
>KOG4317|consensus
Probab=27.59  E-value=15  Score=27.72  Aligned_cols=12  Identities=0%  Similarity=-0.161  Sum_probs=7.6

Q ss_pred             ccccchhhhhhc
Q psy8167          83 QHTNVIEVALGA   94 (167)
Q Consensus        83 ~~c~~c~~~~~~   94 (167)
                      |.|+-|...+.+
T Consensus        20 YtCPRCn~~YCs   31 (383)
T KOG4317|consen   20 YTCPRCNLLYCS   31 (383)
T ss_pred             ccCCCCCcccee
Confidence            667776665555


No 289
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=27.46  E-value=35  Score=16.53  Aligned_cols=6  Identities=0%  Similarity=-0.546  Sum_probs=2.3

Q ss_pred             CCCchh
Q psy8167         133 KLMDEQ  138 (167)
Q Consensus       133 ~C~~C~  138 (167)
                      .|+.||
T Consensus        24 vC~~Cg   29 (34)
T PF14803_consen   24 VCPACG   29 (34)
T ss_dssp             EETTTT
T ss_pred             ECCCCC
Confidence            333333


No 290
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=27.33  E-value=26  Score=23.69  Aligned_cols=6  Identities=33%  Similarity=1.110  Sum_probs=3.5

Q ss_pred             cccccc
Q psy8167          56 CTLCDK   61 (167)
Q Consensus        56 C~~C~~   61 (167)
                      |+.|+.
T Consensus         3 Cp~C~~    8 (160)
T smart00709        3 CPSCGG    8 (160)
T ss_pred             CCCCCC
Confidence            666654


No 291
>KOG0782|consensus
Probab=26.54  E-value=21  Score=29.41  Aligned_cols=30  Identities=10%  Similarity=0.071  Sum_probs=15.8

Q ss_pred             HHHHHHHhhcCCCCCCCCchhhhcCCHHHH
Q psy8167         118 SLKKHNRIFHGGADPKLMDEQMARGSADFL  147 (167)
Q Consensus       118 ~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  147 (167)
                      .+.+|.=.|.....-+|..|+|.|..+..+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F  269 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQKFFF  269 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhhheee
Confidence            455554444444445666666666655433


No 292
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=26.44  E-value=41  Score=15.51  Aligned_cols=7  Identities=29%  Similarity=0.814  Sum_probs=4.0

Q ss_pred             eeccccc
Q psy8167         104 IRCELCD  110 (167)
Q Consensus       104 ~~C~~C~  110 (167)
                      |.|..|+
T Consensus        16 Y~C~~c~   22 (30)
T PF03107_consen   16 YHCSECC   22 (30)
T ss_pred             EEeCCCC
Confidence            5565555


No 293
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=26.35  E-value=70  Score=22.44  Aligned_cols=12  Identities=17%  Similarity=0.639  Sum_probs=8.1

Q ss_pred             Cccccccccccc
Q psy8167          52 DRIPCTLCDKTF   63 (167)
Q Consensus        52 ~~~~C~~C~~~f   63 (167)
                      +.+.|.+|-..+
T Consensus        17 ~~~~CpICld~~   28 (193)
T PLN03208         17 GDFDCNICLDQV   28 (193)
T ss_pred             CccCCccCCCcC
Confidence            457788887654


No 294
>KOG1819|consensus
Probab=26.00  E-value=37  Score=27.51  Aligned_cols=8  Identities=0%  Similarity=-0.263  Sum_probs=3.4

Q ss_pred             ccchhhhh
Q psy8167          85 TNVIEVAL   92 (167)
Q Consensus        85 c~~c~~~~   92 (167)
                      |..||..|
T Consensus       920 crncggif  927 (990)
T KOG1819|consen  920 CRNCGGIF  927 (990)
T ss_pred             hcccCcee
Confidence            44444443


No 295
>KOG1044|consensus
Probab=25.52  E-value=30  Score=28.44  Aligned_cols=36  Identities=22%  Similarity=0.396  Sum_probs=21.7

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCC-----CCCCchhhhcCCHHHH
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGAD-----PKLMDEQMARGSADFL  147 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~-----~~C~~C~~~f~~~~~l  147 (167)
                      +|..|.+-+..+- |+      .|++.     -.|..|+..|.....|
T Consensus       194 kc~~c~~fisgkv-Lq------ag~kh~HPtCARCsRCgqmF~eGEEM  234 (670)
T KOG1044|consen  194 KCEECEKFISGKV-LQ------AGDKHFHPTCARCSRCGQMFGEGEEM  234 (670)
T ss_pred             ehHHhhhhhhhhh-hh------ccCcccCcchhhhhhhccccccchhe
Confidence            6788876555542 22      33333     3477788888776554


No 296
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=25.50  E-value=40  Score=23.46  Aligned_cols=51  Identities=12%  Similarity=0.032  Sum_probs=27.2

Q ss_pred             eeccc----ccccccChhHHHHHHHhhcCCCCCCCCc----hhhhcCCHHHHHHHHhhcCCC
Q psy8167         104 IRCEL----CDKSFTRKDSLKKHNRIFHGGADPKLMD----EQMARGSADFLEVVLNEDGEG  157 (167)
Q Consensus       104 ~~C~~----C~k~f~~~~~l~~H~~~h~~~~~~~C~~----C~~~f~~~~~l~~H~~~~~~~  157 (167)
                      ++|..    |...+... ....|.+. ..-+|+.|+.    |+..-.. ..|..|....|..
T Consensus        15 ~pC~~~~~GC~~~~~~~-~~~~HE~~-C~~~p~~CP~~~~~C~~~G~~-~~l~~Hl~~~H~~   73 (198)
T PF03145_consen   15 FPCKNAKYGCTETFPYS-EKREHEEE-CPFRPCSCPFPGSGCDWQGSY-KELLDHLRDKHSW   73 (198)
T ss_dssp             EE-CCGGGT---EE-GG-GHHHHHHT--TTSEEE-SSSSTT---EEEC-CCHHHHHHHHTTT
T ss_pred             ecCCCCCCCCccccccc-ChhhHhcc-CCCcCCcCCCCCCCccccCCH-HHHHHHHHHHCCC
Confidence            45655    66665444 55668775 6677888987    7665543 4677899876655


No 297
>PRK06450 threonine synthase; Validated
Probab=25.31  E-value=31  Score=26.34  Aligned_cols=10  Identities=30%  Similarity=0.527  Sum_probs=5.2

Q ss_pred             cccccccccc
Q psy8167          54 IPCTLCDKTF   63 (167)
Q Consensus        54 ~~C~~C~~~f   63 (167)
                      ++|..||+.|
T Consensus         4 ~~C~~Cg~~~   13 (338)
T PRK06450          4 EVCMKCGKER   13 (338)
T ss_pred             eEECCcCCcC
Confidence            4555555543


No 298
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=25.29  E-value=68  Score=23.75  Aligned_cols=34  Identities=18%  Similarity=0.281  Sum_probs=18.7

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQ  138 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~  138 (167)
                      ..|..|+..+.....+...+.......+..|+ ||
T Consensus       138 ~~C~~C~~~~~~~~~~~~~~~~~~~~~~P~C~-Cg  171 (271)
T PTZ00409        138 ARCCTCRKTIQLNKIMLQKTSHFMHQLPPECP-CG  171 (271)
T ss_pred             ceeCCCCCCcccCHHHHhhhhhhccCCCCCCC-CC
Confidence            47999998876544433221111122356788 86


No 299
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=25.24  E-value=45  Score=16.24  Aligned_cols=9  Identities=22%  Similarity=0.892  Sum_probs=4.1

Q ss_pred             ecccccccc
Q psy8167         105 RCELCDKSF  113 (167)
Q Consensus       105 ~C~~C~k~f  113 (167)
                      .|..||-.+
T Consensus        23 sC~~CGPr~   31 (35)
T PF07503_consen   23 SCTNCGPRY   31 (35)
T ss_dssp             -BTTCC-SC
T ss_pred             cCCCCCCCE
Confidence            466666544


No 300
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=24.80  E-value=24  Score=25.21  Aligned_cols=28  Identities=21%  Similarity=0.265  Sum_probs=0.0

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCC
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADP  132 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~  132 (167)
                      ..|++||....- +.|..|||+...+..|
T Consensus       169 ~~cPitGe~IP~-~e~~eHmRi~LlDP~w  196 (229)
T PF12230_consen  169 IICPITGEMIPA-DEMDEHMRIELLDPRW  196 (229)
T ss_dssp             -----------------------------
T ss_pred             cccccccccccc-cccccccccccccccc
Confidence            578888877654 4778899987765444


No 301
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=24.55  E-value=38  Score=18.15  Aligned_cols=16  Identities=25%  Similarity=0.733  Sum_probs=10.0

Q ss_pred             cCceecccccccccCh
Q psy8167         101 IDRIRCELCDKSFTRK  116 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~  116 (167)
                      ...|+|.+|++.+...
T Consensus        33 ~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   33 PIKLRCHYCERIITED   48 (52)
T ss_dssp             TCEEEETTT--EEEHH
T ss_pred             CCEEEeeCCCCEeccc
Confidence            4557899999877654


No 302
>PLN03239 histone acetyltransferase; Provisional
Probab=24.49  E-value=67  Score=24.77  Aligned_cols=23  Identities=4%  Similarity=-0.492  Sum_probs=13.7

Q ss_pred             CCCCCCchhhhcCCHHHHHHHHh
Q psy8167         130 ADPKLMDEQMARGSADFLEVVLN  152 (167)
Q Consensus       130 ~~~~C~~C~~~f~~~~~l~~H~~  152 (167)
                      .-|-|..|-+.|.+...|.+|+.
T Consensus       105 ~lYiCE~Clky~~~~~~l~~H~~  127 (351)
T PLN03239        105 VLYVCEFSFGFFARKSELLRFQA  127 (351)
T ss_pred             eEEEeccchhhhcCHHHHHHHHH
Confidence            34666666666666666666654


No 303
>KOG0320|consensus
Probab=24.35  E-value=29  Score=23.96  Aligned_cols=10  Identities=10%  Similarity=-0.161  Sum_probs=5.4

Q ss_pred             CCCCCchhhh
Q psy8167         131 DPKLMDEQMA  140 (167)
Q Consensus       131 ~~~C~~C~~~  140 (167)
                      ..+|+.|++.
T Consensus       167 ~~~CP~C~kk  176 (187)
T KOG0320|consen  167 TNKCPTCRKK  176 (187)
T ss_pred             CCCCCCcccc
Confidence            4556666553


No 304
>cd01396 MeCP2_MBD MeCP2, MBD1, MBD2, MBD3, and MBD4 are members of a protein family that share the methyl-CpG-binding domain (MBD). The MBD, consists of about 70 residues and is defined as the minimal region required for binding to methylated DNA by a methyl-CpG-binding protein which binds specifically to methylated DNA. The MBD can recognize a single symmetrically methylated CpG either as naked DNA or within chromatin.  MeCP2, MBD1 and MBD2 (and likely MBD3) form complexes with histone deacetylase and are involved in histone deacetylase-dependent repression of transcription. MBD4 is an endonuclease that forms a complex with the DNA mismatch-repair protein MLH1.
Probab=24.33  E-value=64  Score=18.83  Aligned_cols=18  Identities=17%  Similarity=-0.051  Sum_probs=10.0

Q ss_pred             hhhhcCCHHHHHHHHhhc
Q psy8167         137 EQMARGSADFLEVVLNED  154 (167)
Q Consensus       137 C~~~f~~~~~l~~H~~~~  154 (167)
                      ||+.|.+...|.+.+..+
T Consensus        34 ~Gkk~RS~~ev~~yL~~~   51 (77)
T cd01396          34 TGKKFRSKVELARYLEKN   51 (77)
T ss_pred             CCCEEECHHHHHHHHHhC
Confidence            455555555555555544


No 305
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=24.32  E-value=74  Score=24.43  Aligned_cols=53  Identities=11%  Similarity=0.059  Sum_probs=32.8

Q ss_pred             ecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCHHHHHHHHhh-cCCCCCccccccc
Q psy8167         105 RCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSADFLEVVLNE-DGEGEPVSITVYL  166 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-~~~~~~~~~~~~~  166 (167)
                      .|..|...|......         .-.+.|+.||..+.....-+.-... -.++.|..--+||
T Consensus       248 AC~rC~t~y~le~A~---------~~~wrCpkCGg~ikKGV~dRv~ELad~~~~~p~~RPPYl  301 (403)
T COG1379         248 ACSRCYTRYSLEEAK---------SLRWRCPKCGGKIKKGVSDRVLELADTEPEHPKHRPPYL  301 (403)
T ss_pred             HHHHhhhccCcchhh---------hhcccCcccccchhhhHHHHHHHhhccCcccCCCCCCce
Confidence            378887777654332         1257899998877766555444332 2356666666775


No 306
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=23.92  E-value=25  Score=26.21  Aligned_cols=11  Identities=18%  Similarity=0.661  Sum_probs=7.8

Q ss_pred             ccccccccccc
Q psy8167          53 RIPCTLCDKTF   63 (167)
Q Consensus        53 ~~~C~~C~~~f   63 (167)
                      ..+|+.|+...
T Consensus        26 ~~~c~~c~~~~   36 (285)
T TIGR00515        26 WTKCPKCGQVL   36 (285)
T ss_pred             eeECCCCcchh
Confidence            56788888643


No 307
>PLN02748 tRNA dimethylallyltransferase
Probab=23.48  E-value=55  Score=26.40  Aligned_cols=25  Identities=16%  Similarity=0.389  Sum_probs=20.8

Q ss_pred             cCceecccccc-cccChhHHHHHHHh
Q psy8167         101 IDRIRCELCDK-SFTRKDSLKKHNRI  125 (167)
Q Consensus       101 ~k~~~C~~C~k-~f~~~~~l~~H~~~  125 (167)
                      -+.|.|..|++ .+.....+..|++.
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhcc
Confidence            45678999997 79999999988764


No 308
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=23.22  E-value=27  Score=26.19  Aligned_cols=11  Identities=18%  Similarity=0.392  Sum_probs=7.8

Q ss_pred             ccccccccccc
Q psy8167          53 RIPCTLCDKTF   63 (167)
Q Consensus        53 ~~~C~~C~~~f   63 (167)
                      ..+|+.|+...
T Consensus        38 w~kc~~C~~~~   48 (296)
T CHL00174         38 WVQCENCYGLN   48 (296)
T ss_pred             eeECCCccchh
Confidence            56788888643


No 309
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=23.03  E-value=76  Score=23.02  Aligned_cols=32  Identities=22%  Similarity=0.362  Sum_probs=20.2

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      ..|..|++.|.....+.    .........|+.|+-
T Consensus       120 ~~C~~C~~~~~~~~~~~----~~~~~~~p~Cp~Cgg  151 (244)
T PRK14138        120 YYCVRCGKRYTVEDVIE----KLEKSDVPRCDDCSG  151 (244)
T ss_pred             eEECCCCCcccHHHHHH----HHhcCCCCCCCCCCC
Confidence            47999998887654433    112223577999973


No 310
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=22.89  E-value=77  Score=19.68  Aligned_cols=37  Identities=8%  Similarity=0.092  Sum_probs=24.8

Q ss_pred             CcccccccccccCCHHHHHHHHHHhcCCCCcccccchhh
Q psy8167          52 DRIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEV   90 (167)
Q Consensus        52 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~   90 (167)
                      ..|.|+.-|..|.+...+...+ . .-..+.|.|...|+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~-~-~y~~~vwtC~~TGk   38 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRM-I-LYNQRVWTCEITGK   38 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHH-H-HHhCCeeEEecCCC
Confidence            4688999999999988777666 3 22334555555443


No 311
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=22.84  E-value=38  Score=18.63  Aligned_cols=12  Identities=25%  Similarity=0.922  Sum_probs=6.2

Q ss_pred             eecccccccccC
Q psy8167         104 IRCELCDKSFTR  115 (167)
Q Consensus       104 ~~C~~C~k~f~~  115 (167)
                      ..|++||+.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            479999988776


No 312
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=22.77  E-value=59  Score=22.80  Aligned_cols=10  Identities=0%  Similarity=-0.124  Sum_probs=5.1

Q ss_pred             CCCCchhhhc
Q psy8167         132 PKLMDEQMAR  141 (167)
Q Consensus       132 ~~C~~C~~~f  141 (167)
                      ..|..||..+
T Consensus        31 vrC~eCG~V~   40 (201)
T COG1326          31 VRCEECGTVH   40 (201)
T ss_pred             EEccCCCcEe
Confidence            4455555444


No 313
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=22.72  E-value=35  Score=27.04  Aligned_cols=6  Identities=33%  Similarity=1.337  Sum_probs=3.5

Q ss_pred             eccccc
Q psy8167         105 RCELCD  110 (167)
Q Consensus       105 ~C~~C~  110 (167)
                      +|+.||
T Consensus        23 kCp~Cg   28 (456)
T COG1066          23 KCPACG   28 (456)
T ss_pred             cCCCCC
Confidence            466665


No 314
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.39  E-value=50  Score=21.58  Aligned_cols=27  Identities=15%  Similarity=0.160  Sum_probs=14.9

Q ss_pred             cccccchhhhhhccccccccCceecccccccc
Q psy8167          82 PQHTNVIEVALGARANAAFIDRIRCELCDKSF  113 (167)
Q Consensus        82 ~~~c~~c~~~~~~~~~~~l~k~~~C~~C~k~f  113 (167)
                      ...|+.||-....     -....-|++||+.+
T Consensus        28 ~~hCp~Cg~PLF~-----KdG~v~CPvC~~~~   54 (131)
T COG1645          28 AKHCPKCGTPLFR-----KDGEVFCPVCGYRE   54 (131)
T ss_pred             HhhCcccCCccee-----eCCeEECCCCCceE
Confidence            3567777765433     01223588888543


No 315
>PRK07218 replication factor A; Provisional
Probab=22.36  E-value=37  Score=26.93  Aligned_cols=7  Identities=29%  Similarity=1.056  Sum_probs=3.4

Q ss_pred             ccccccc
Q psy8167          55 PCTLCDK   61 (167)
Q Consensus        55 ~C~~C~~   61 (167)
                      +|+.|++
T Consensus       299 rCP~C~r  305 (423)
T PRK07218        299 RCPECGR  305 (423)
T ss_pred             cCcCccc
Confidence            3555554


No 316
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.35  E-value=43  Score=24.96  Aligned_cols=27  Identities=15%  Similarity=0.162  Sum_probs=19.0

Q ss_pred             cCceecccccccccChhHHHHHHHhhcCCCCCCCCchhhhc
Q psy8167         101 IDRIRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMAR  141 (167)
Q Consensus       101 ~k~~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  141 (167)
                      ...|-|++|.-.|-.              .|..|..|+-.|
T Consensus       253 ~~GyvCs~Clsi~C~--------------~p~~C~~Cgt~f  279 (279)
T TIGR00627       253 SIGFVCSVCLSVLCQ--------------YTPICKTCKTAF  279 (279)
T ss_pred             cceEECCCccCCcCC--------------CCCCCCCCCCCC
Confidence            444889999865543              356899998765


No 317
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.31  E-value=22  Score=20.76  Aligned_cols=9  Identities=33%  Similarity=0.822  Sum_probs=5.3

Q ss_pred             ccccccccc
Q psy8167          54 IPCTLCDKT   62 (167)
Q Consensus        54 ~~C~~C~~~   62 (167)
                      |.|..|+..
T Consensus        13 Y~c~~cg~~   21 (82)
T COG2331          13 YECTECGNR   21 (82)
T ss_pred             EeecccchH
Confidence            566666653


No 318
>PRK07591 threonine synthase; Validated
Probab=21.90  E-value=40  Score=26.62  Aligned_cols=28  Identities=11%  Similarity=0.161  Sum_probs=16.4

Q ss_pred             cccccccccccCCHHHHHHHHHHhcCCCCcccccchhhhhhc
Q psy8167          53 RIPCTLCDKTFTRKDSLKKHIRIFHTQNQPQHTNVIEVALGA   94 (167)
Q Consensus        53 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~~~~   94 (167)
                      .+.|..||+.|..             ... +.|+.|+..+.-
T Consensus        18 ~l~C~~Cg~~~~~-------------~~~-~~C~~cg~~l~~   45 (421)
T PRK07591         18 ALKCRECGAEYPL-------------GPI-HVCEECFGPLEV   45 (421)
T ss_pred             EEEeCCCCCcCCC-------------CCC-ccCCCCCCeEEE
Confidence            3778888875531             112 667777655443


No 319
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=21.80  E-value=37  Score=23.06  Aligned_cols=6  Identities=33%  Similarity=1.392  Sum_probs=3.3

Q ss_pred             cccccc
Q psy8167          56 CTLCDK   61 (167)
Q Consensus        56 C~~C~~   61 (167)
                      |+.||.
T Consensus         1 CP~Cg~    6 (163)
T TIGR00340         1 CPVCGS    6 (163)
T ss_pred             CCCCCC
Confidence            555654


No 320
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=21.80  E-value=26  Score=23.32  Aligned_cols=6  Identities=33%  Similarity=1.088  Sum_probs=2.8

Q ss_pred             eccccc
Q psy8167         105 RCELCD  110 (167)
Q Consensus       105 ~C~~C~  110 (167)
                      +|+.||
T Consensus       132 ~Cp~C~  137 (146)
T PF07295_consen  132 PCPKCG  137 (146)
T ss_pred             CCCCCC
Confidence            345554


No 321
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=21.71  E-value=78  Score=22.54  Aligned_cols=31  Identities=10%  Similarity=0.173  Sum_probs=19.1

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      ..|..|++.|.....     +.........|+.|+-
T Consensus       114 ~~C~~C~~~~~~~~~-----~~~~~~~~p~C~~Cgg  144 (222)
T cd01413         114 AYCVNCGSKYDLEEV-----KYAKKHEVPRCPKCGG  144 (222)
T ss_pred             ceECCCCCCcchhHH-----HHhccCCCCcCCCCCC
Confidence            479999988765533     1112234578988863


No 322
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=21.70  E-value=30  Score=25.95  Aligned_cols=11  Identities=18%  Similarity=0.480  Sum_probs=8.1

Q ss_pred             Ccccccccccc
Q psy8167          52 DRIPCTLCDKT   62 (167)
Q Consensus        52 ~~~~C~~C~~~   62 (167)
                      -..+|+.|+..
T Consensus        26 ~~~~c~~c~~~   36 (292)
T PRK05654         26 LWTKCPSCGQV   36 (292)
T ss_pred             CeeECCCccch
Confidence            35679999874


No 323
>KOG3352|consensus
Probab=21.69  E-value=38  Score=22.65  Aligned_cols=17  Identities=6%  Similarity=-0.129  Sum_probs=13.3

Q ss_pred             cCCCCCCCCchhhhcCC
Q psy8167         127 HGGADPKLMDEQMARGS  143 (167)
Q Consensus       127 ~~~~~~~C~~C~~~f~~  143 (167)
                      +.++..+|..||..|.-
T Consensus       129 ~Kge~~rc~eCG~~fkL  145 (153)
T KOG3352|consen  129 EKGETQRCPECGHYFKL  145 (153)
T ss_pred             EcCCcccCCcccceEEe
Confidence            55668889999988863


No 324
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=21.67  E-value=41  Score=16.54  Aligned_cols=16  Identities=25%  Similarity=0.592  Sum_probs=8.8

Q ss_pred             ecccccccccChhHHH
Q psy8167         105 RCELCDKSFTRKDSLK  120 (167)
Q Consensus       105 ~C~~C~k~f~~~~~l~  120 (167)
                      .|+.|++.|-+.+.-+
T Consensus         4 ~CprC~kg~Hwa~~C~   19 (36)
T PF14787_consen    4 LCPRCGKGFHWASECR   19 (36)
T ss_dssp             C-TTTSSSCS-TTT--
T ss_pred             cCcccCCCcchhhhhh
Confidence            4788888877765543


No 325
>PRK01343 zinc-binding protein; Provisional
Probab=21.54  E-value=47  Score=18.26  Aligned_cols=11  Identities=36%  Similarity=0.600  Sum_probs=8.9

Q ss_pred             eeccccccccc
Q psy8167         104 IRCELCDKSFT  114 (167)
Q Consensus       104 ~~C~~C~k~f~  114 (167)
                      ..|++|++.+.
T Consensus        10 ~~CP~C~k~~~   20 (57)
T PRK01343         10 RPCPECGKPST   20 (57)
T ss_pred             CcCCCCCCcCc
Confidence            46999999875


No 326
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=21.45  E-value=30  Score=23.43  Aligned_cols=8  Identities=38%  Similarity=1.003  Sum_probs=2.5

Q ss_pred             eecccccc
Q psy8167         104 IRCELCDK  111 (167)
Q Consensus       104 ~~C~~C~k  111 (167)
                      |.|+.||.
T Consensus        31 f~C~~CGy   38 (161)
T PF03367_consen   31 FECEHCGY   38 (161)
T ss_dssp             EE-TTT--
T ss_pred             eECCCCCC
Confidence            34555553


No 327
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=21.42  E-value=47  Score=15.98  Aligned_cols=20  Identities=15%  Similarity=0.511  Sum_probs=11.3

Q ss_pred             eecccccccccChhHHHHHHH
Q psy8167         104 IRCELCDKSFTRKDSLKKHNR  124 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~  124 (167)
                      +.|+.|++.+... -+-.|+.
T Consensus         5 ~~C~nC~R~v~a~-RfA~HLe   24 (33)
T PF08209_consen    5 VECPNCGRPVAAS-RFAPHLE   24 (33)
T ss_dssp             EE-TTTSSEEEGG-GHHHHHH
T ss_pred             EECCCCcCCcchh-hhHHHHH
Confidence            6788888766543 3334543


No 328
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=20.81  E-value=61  Score=16.02  Aligned_cols=15  Identities=27%  Similarity=0.625  Sum_probs=8.1

Q ss_pred             eecccccccccChhH
Q psy8167         104 IRCELCDKSFTRKDS  118 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~  118 (167)
                      ..|..|++.|.....
T Consensus         7 ~~C~~C~~~~~~~~~   21 (43)
T PF06467_consen    7 KTCSYCKKYIPNKPT   21 (43)
T ss_dssp             EE-TTT--EEECCC-
T ss_pred             CcCcccCCcccCCCc
Confidence            468888888877664


No 329
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=20.60  E-value=89  Score=15.65  Aligned_cols=10  Identities=20%  Similarity=-0.034  Sum_probs=5.3

Q ss_pred             CCCCCCCchh
Q psy8167         129 GADPKLMDEQ  138 (167)
Q Consensus       129 ~~~~~C~~C~  138 (167)
                      .....|++|+
T Consensus        34 ~~~~~CP~C~   43 (44)
T PF14634_consen   34 GKSVKCPICR   43 (44)
T ss_pred             CCCCCCcCCC
Confidence            3455566554


No 330
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=20.50  E-value=22  Score=30.04  Aligned_cols=68  Identities=10%  Similarity=-0.015  Sum_probs=42.6

Q ss_pred             ccccchhhhhhccccccccCce-ecccccccccChhHHHHHHHhhcC-CCCCCCCchhhhcCCHHHHHHHH
Q psy8167          83 QHTNVIEVALGARANAAFIDRI-RCELCDKSFTRKDSLKKHNRIFHG-GADPKLMDEQMARGSADFLEVVL  151 (167)
Q Consensus        83 ~~c~~c~~~~~~~~~~~l~k~~-~C~~C~k~f~~~~~l~~H~~~h~~-~~~~~C~~C~~~f~~~~~l~~H~  151 (167)
                      -.|+.|-+-+.+...-....+| .|..||-.|+--..|--- |.++. ..-..|+.|.+-+....+=+=|-
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRRfHA  171 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRRFHA  171 (750)
T ss_pred             hhhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCcccccccc
Confidence            5677787766553333333333 599999999877665433 22232 23467999999888876655444


No 331
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=20.34  E-value=27  Score=20.02  Aligned_cols=13  Identities=23%  Similarity=0.501  Sum_probs=6.7

Q ss_pred             ccccccccccCCH
Q psy8167          54 IPCTLCDKTFTRK   66 (167)
Q Consensus        54 ~~C~~C~~~f~~~   66 (167)
                      ++++-|++.|.=.
T Consensus        11 ~~~~cC~~~y~C~   23 (71)
T PF05495_consen   11 IRFPCCGKYYPCR   23 (71)
T ss_dssp             EEETTTTEEESSH
T ss_pred             EECCcccCeecHH
Confidence            4455555555543


No 332
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=20.31  E-value=30  Score=23.58  Aligned_cols=31  Identities=13%  Similarity=0.075  Sum_probs=20.4

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhhhcCCH
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQMARGSA  144 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  144 (167)
                      ..|+.|+..|..-.          ....+.|..|-+.|.+.
T Consensus        75 l~C~~C~~Tfk~f~----------~~g~fGCaeCY~tf~~~  105 (176)
T COG3880          75 LGCHNCGMTFKEFI----------QSGLFGCAECYKTFESQ  105 (176)
T ss_pred             hcCccccccHHHHH----------HhcccchHHHHHHHHHH
Confidence            46888887665421          12368888888888765


No 333
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=20.14  E-value=49  Score=23.82  Aligned_cols=17  Identities=6%  Similarity=-0.297  Sum_probs=14.5

Q ss_pred             cCCCCCCCCchhhhcCC
Q psy8167         127 HGGADPKLMDEQMARGS  143 (167)
Q Consensus       127 ~~~~~~~C~~C~~~f~~  143 (167)
                      +.+++..|..||..|.-
T Consensus       177 rEGkpqRCpECGqVFKL  193 (268)
T PTZ00043        177 REGFLYRCGECDQIFML  193 (268)
T ss_pred             cCCCCccCCCCCcEEEE
Confidence            56679999999999975


No 334
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.05  E-value=61  Score=22.62  Aligned_cols=28  Identities=14%  Similarity=0.067  Sum_probs=18.7

Q ss_pred             eecccccccccChhHHHHHHHhhcCCCCCCCCchhh
Q psy8167         104 IRCELCDKSFTRKDSLKKHNRIFHGGADPKLMDEQM  139 (167)
Q Consensus       104 ~~C~~C~k~f~~~~~l~~H~~~h~~~~~~~C~~C~~  139 (167)
                      -.|..||-.|.....        .....|.|+.|.-
T Consensus       135 ~~C~~Cgg~fv~~~~--------e~~~~f~CplC~~  162 (187)
T PRK12722        135 SSCNCCGGHFVTHAH--------DPVGSFVCGLCQP  162 (187)
T ss_pred             ccCCCCCCCeecccc--------ccCCCCcCCCCCC
Confidence            368889988875432        2234788999854


No 335
>PF04328 DUF466:  Protein of unknown function (DUF466);  InterPro: IPR007423 This is a small bacterial protein of unknown function.
Probab=20.01  E-value=1e+02  Score=17.38  Aligned_cols=18  Identities=11%  Similarity=0.067  Sum_probs=10.4

Q ss_pred             CHHHHHHHHhhcCCCCCc
Q psy8167         143 SADFLEVVLNEDGEGEPV  160 (167)
Q Consensus       143 ~~~~l~~H~~~~~~~~~~  160 (167)
                      ....+..|++.||++.|+
T Consensus        24 ~Ye~Yv~H~~~~HP~~p~   41 (65)
T PF04328_consen   24 DYERYVEHMRRHHPDEPP   41 (65)
T ss_pred             HHHHHHHHHHHHCcCCCC
Confidence            344555677766655544


Done!