Diaphorina citri psyllid: psy8191

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MIISGYELIIIKPKKNFFLNKTEKKVIKLDIIYEDNEIIILNKSAGLVVHPAIGNLSGTLFDNLLEIYPFLINVPRAGIVHRLDKNSSGLMVVAKSIKSYIHLVNQLKMHIVQRKYLAMVWGIPKLNGMINAAIMRNPHNRIKMTVSKNFNAKPALTYYERLATGIINKKHISLIRCNLKTGRTHQIRVHMQWLGHGIVGDNLYGKKYSKSLIFNRQALHAYKLGLIHPKNNLKLKWRINLPDDISKLITFSGIKWI
ccccccEEEEEcccccccccccccccccccEEEEcccEEEEEcccccEEcccccccccHHHHHHHHHccccccccccccccccccccccEEEEEccHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEccccccccccEEEEEcccccccccEEEEEEEEEcccccccEEEEEEEccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHccccc
*IISGYELIIIKPKKNFFLNKTEKKVIKLDIIYEDNEIIILNKSAGLVVHPAIGNLSGTLFDNLLEIYPFLINVPRAGIVHRLDKNSSGLMVVAKSIKSYIHLVNQLKMHIVQRKYLAMVWGIPKLNGMINAAIMRNPHNRIKMTVSKNFNAKPALTYYERLATGIINKKHISLIRCNLKTGRTHQIRVHMQWLGHGIVGDNLYGKKYSKSLIFNRQALHAYKLGLIHPKNNLKLKWRINLPDDISKLITFSGIKWI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIISGYELIIIKPKKNFFLNKTEKKVIKLDIIYEDNEIIILNKSAGLVVHPAIGNLSGTLFDNLLEIYPFLINVPRAGIVHRLDKNSSGLMVVAKSIKSYIHLVNQLKMHIVQRKYLAMVWGIPKLNGMINAAIMRNPHNRIKMTVSKNFNAKPALTYYERLATGIINKKHISLIRCNLKTGRTHQIRVHMQWLGHGIVGDNLYGKKYSKSLIFNRQALHAYKLGLIHPKNNLKLKWRINLPDDISKLITFSGIKWI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal large subunit pseudouridine synthase D Responsible for synthesis of pseudouridine from uracil at positions 1911, 1915 and 1917 in 23S ribosomal RNA.confidentQ82WZ5
Ribosomal large subunit pseudouridine synthase D Responsible for synthesis of pseudouridine from uracil at positions 1911, 1915 and 1917 in 23S ribosomal RNA.confidentQ9JVB6
Uncharacterized RNA pseudouridine synthase Rv1540/MT1592 confidentP0A5T2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034470 [BP]ncRNA processingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034660, GO:0006396, GO:0046483
GO:0001522 [BP]pseudouridine synthesisprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:0009451, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V9F, chain A
Confidence level:very confident
Coverage over the Query: 22-253
View the alignment between query and template
View the model in PyMOL