Psyllid ID: psy8192


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MSKFTDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
cccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEEEEEEEEccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccEEEccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccEEEccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEcccccccHHHHHHHHHcccEEEcccccccccEEEHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccc
ccccHHHccHHHcccccccHHHHHHHHHHHHcccccccHHHHHHHccccEEEEEEEEEEcccccEEEEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHccHHHHHHHHHHHHHHHHHHcEcccEEEEcEccEcHHHHHHHHHHHHHHHccccHHHcccccHHHccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEEccEEEEcccccccHHHHHHHHHHHHEccccccccEccHHHHHcccccEEEEccccccEcHHHHccccccEEEccccccEcHHHHHHHHHHccEEEcHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc
mskftdnsrpsylsqndlgpwgvylqqidrvtpylGSLSRWIEILkhpkkilivdvpiehdngevfhyegyrvqhnilrgpgkggvrfhpdvTLSEIIALSGwmtiknaavnipyggakggirvnpknlsnnelMRLTRRYTNEISSiiglnkdipapdvgtdMQIMSWMMDtystkknytipgivtgkpisiggsfgrqkatgrgvFIIGSKIASKINLNIINskisiqgfgnVGSVAANLFFKAGAKIVAiqddkttiynpngfnipklqKYVTFTRSikdfnegekindskefwsipcdilipaaiedqitinnaNNVTAKIILegangpttteaddilrdkgiilapdvitnaGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
mskftdnsrpsylsqndlgpWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGgakggirvnpknlsnneLMRLTRRYTNEISsiiglnkdipapdVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDkttiynpngfnipklqkYVTFTRSIKDFnegekindskefWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
MSKFTDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGskiaskinlniinskisiQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
****************DLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQ*******
********************WGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
***********YLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
**********SYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKFTDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query428 2.2.26 [Sep-21-2011]
P96110416 Glutamate dehydrogenase O yes N/A 0.941 0.968 0.461 1e-109
Q7A1B9414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
Q6GAW8414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
Q6GID0414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
Q7A6H8414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
Q99VD0414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
Q5HHC7414 NAD-specific glutamate de yes N/A 0.894 0.925 0.483 1e-104
P39633424 Catabolic NAD-specific gl yes N/A 0.911 0.919 0.459 1e-102
O74024419 Glutamate dehydrogenase O N/A N/A 0.950 0.971 0.458 1e-100
P29051435 NAD-specific glutamate de no N/A 0.936 0.921 0.431 1e-100
>sp|P96110|DHE3_THEMA Glutamate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gdhA PE=1 SV=4 Back     alignment and function desciption
 Score =  394 bits (1011), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 187/405 (46%), Positives = 271/405 (66%), Gaps = 2/405 (0%)

Query: 25  LQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKG 84
           ++Q +R    +   S   E+L+ PK++LIV+ P+  D+G V  + GYRVQHN+ RGP KG
Sbjct: 11  VEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARGPAKG 70

Query: 85  GVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNE 144
           G+R+HPDVTL E+ AL+ WMT K A +N+P+GG KGG+RV+PK LS NEL RL+RR+ +E
Sbjct: 71  GIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRRFFSE 130

Query: 145 ISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATG 204
           I  IIG   DIPAPDV T+  +M+W MDTYS    +T+ GIVTGKP+ +GGS GR++ATG
Sbjct: 131 IQVIIGPYNDIPAPDVNTNADVMAWYMDTYSMNVGHTVLGIVTGKPVELGGSKGREEATG 190

Query: 205 RGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKA-GAKIVAIQDDKTTIYNP 263
           RGV +        + ++   + +++QGFGNVG  AA L  +  G+K+VA+ D +  IYNP
Sbjct: 191 RGVKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYNP 250

Query: 264 NGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTA 323
            GF++ +L +Y     ++  + +GE+I + +E   +  DIL+PAA+E  I   NA  + A
Sbjct: 251 EGFDVEELIRYKKEHGTVVTYPKGERITN-EELLELDVDILVPAALEGAIHAGNAERIKA 309

Query: 324 KIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINL 383
           K ++EGANGPTT EAD+IL  +GI++ PD++ NAGGV VSYFEWVQ+L +  W   ++  
Sbjct: 310 KAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWVQDLQSFFWDLDQVRN 369

Query: 384 RLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL 428
            L  ++  AF+ + ++     V +RTAA+I+   RV  A K RG+
Sbjct: 370 ALEKMMKGAFNDVMKVKEKYNVDMRTAAYILAIDRVAYATKKRGI 414





Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) (taxid: 243274)
EC: 1EC: .EC: 4EC: .EC: 1EC: .EC: 3
>sp|Q7A1B9|DHE2_STAAW NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|Q6GAW8|DHE2_STAAS NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|Q6GID0|DHE2_STAAR NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|Q7A6H8|DHE2_STAAN NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=gluD PE=1 SV=1 Back     alignment and function description
>sp|Q99VD0|DHE2_STAAM NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gluD PE=1 SV=1 Back     alignment and function description
>sp|Q5HHC7|DHE2_STAAC NAD-specific glutamate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=gluD PE=3 SV=1 Back     alignment and function description
>sp|P39633|DHE2_BACSU Catabolic NAD-specific glutamate dehydrogenase RocG OS=Bacillus subtilis (strain 168) GN=rocG PE=1 SV=3 Back     alignment and function description
>sp|O74024|DHE3_THEPR Glutamate dehydrogenase OS=Thermococcus profundus GN=gdhA PE=1 SV=1 Back     alignment and function description
>sp|P29051|DHE41_HALSI NAD-specific glutamate dehydrogenase A OS=Halobacterium salinarum GN=gdhA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
300313152430 glutamate dehydrogenase [Herbaspirillum 1.0 0.995 0.658 1e-173
409407629430 glutamate dehydrogenase [Herbaspirillum 1.0 0.995 0.658 1e-172
415948934422 Glutamate dehydrogenase [Herbaspirillum 0.978 0.992 0.663 1e-171
398835356430 glutamate dehydrogenase/leucine dehydrog 1.0 0.995 0.649 1e-170
399018371432 glutamate dehydrogenase/leucine dehydrog 0.978 0.969 0.649 1e-169
340789164428 NAD-specific glutamate dehydrogenase [Co 0.978 0.978 0.649 1e-168
374365042435 Glu/Leu/Phe/Val dehydrogenase [Cupriavid 0.983 0.967 0.626 1e-166
73540162435 Glu/Leu/Phe/Val dehydrogenase [Ralstonia 0.981 0.965 0.630 1e-166
113866500435 glutamate dehydrogenase [Ralstonia eutro 0.981 0.965 0.627 1e-165
339324646435 glutamate dehydrogenase [Cupriavidus nec 0.981 0.965 0.627 1e-165
>gi|300313152|ref|YP_003777244.1| glutamate dehydrogenase [Herbaspirillum seropedicae SmR1] gi|300075937|gb|ADJ65336.1| glutamate dehydrogenase (NAD(P)+) protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 282/428 (65%), Positives = 344/428 (80%)

Query: 1   MSKFTDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEH 60
           MS   ++  PSYL  + +GPWGVYL+QIDRVTPYLGSL+RW+E LK PK++L+VDVPIE 
Sbjct: 1   MSNVPNHEVPSYLVPHGIGPWGVYLEQIDRVTPYLGSLARWVETLKRPKRMLVVDVPIER 60

Query: 61  DNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKG 120
           D+G + H+EGYRVQHN  RGPGKGGVRFH DVTLSE++ALS WMTIKNAAVN+PYGGAKG
Sbjct: 61  DDGTIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALSAWMTIKNAAVNVPYGGAKG 120

Query: 121 GIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNY 180
           GIRV+PK LS  EL R+TRRYT+EI  IIG NKDIPAPDV TD QIM+WMMDTYS  +  
Sbjct: 121 GIRVDPKTLSRGELQRVTRRYTSEIGIIIGPNKDIPAPDVNTDSQIMAWMMDTYSMNQGS 180

Query: 181 TIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAA 240
           T  G+VTGKPIS+GGS GR +ATGRGVF++G + A+K  L+I ++K+++QGFGNVG +AA
Sbjct: 181 TSSGVVTGKPISLGGSLGRHEATGRGVFVVGCEAAAKRGLDIKDAKVAVQGFGNVGGIAA 240

Query: 241 NLFFKAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIP 300
            LF +AG+K+VA+QD  TT++N  G ++P LQ YV    S+K F   ++I D  +FWS+ 
Sbjct: 241 RLFAEAGSKVVAVQDHVTTVFNAGGLDVPALQAYVAKNGSVKGFAGADEITDRAQFWSVD 300

Query: 301 CDILIPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGV 360
           CDIL+PAA+E QIT  NAN + AKIILEGANGPTT  ADDILRDKG+++ PDVI NAGGV
Sbjct: 301 CDILVPAALEQQITEANANQIKAKIILEGANGPTTPAADDILRDKGVLIVPDVIANAGGV 360

Query: 361 IVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVL 420
            VSYFEWVQ+ S+  WTE EINLRL  I+  AF A+W+LA+ KKVSLRTAAFI+ CTRVL
Sbjct: 361 TVSYFEWVQDFSSFFWTEDEINLRLTRIMREAFAAVWQLADEKKVSLRTAAFIVACTRVL 420

Query: 421 QAHKTRGL 428
           QA + RGL
Sbjct: 421 QAREMRGL 428




Source: Herbaspirillum seropedicae SmR1

Species: Herbaspirillum seropedicae

Genus: Herbaspirillum

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|409407629|ref|ZP_11256080.1| glutamate dehydrogenase [Herbaspirillum sp. GW103] gi|386433380|gb|EIJ46206.1| glutamate dehydrogenase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|415948934|ref|ZP_11556803.1| Glutamate dehydrogenase [Herbaspirillum frisingense GSF30] gi|407757827|gb|EKF67743.1| Glutamate dehydrogenase [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|398835356|ref|ZP_10592719.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. YR522] gi|398216346|gb|EJN02894.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|399018371|ref|ZP_10720551.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. CF444] gi|398101616|gb|EJL91828.1| glutamate dehydrogenase/leucine dehydrogenase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|340789164|ref|YP_004754629.1| NAD-specific glutamate dehydrogenase [Collimonas fungivorans Ter331] gi|48428786|gb|AAT42434.1| glutamate dehydrogenase [Collimonas fungivorans Ter331] gi|340554431|gb|AEK63806.1| NAD-specific glutamate dehydrogenase [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|374365042|ref|ZP_09623138.1| Glu/Leu/Phe/Val dehydrogenase [Cupriavidus basilensis OR16] gi|373103414|gb|EHP44439.1| Glu/Leu/Phe/Val dehydrogenase [Cupriavidus basilensis OR16] Back     alignment and taxonomy information
>gi|73540162|ref|YP_294682.1| Glu/Leu/Phe/Val dehydrogenase [Ralstonia eutropha JMP134] gi|72117575|gb|AAZ59838.1| Glu/Leu/Phe/Val dehydrogenase, C terminal:Glu/Leu/Phe/Val dehydrogenase, dimerization region [Ralstonia eutropha JMP134] Back     alignment and taxonomy information
>gi|113866500|ref|YP_724989.1| glutamate dehydrogenase [Ralstonia eutropha H16] gi|113525276|emb|CAJ91621.1| glutamate dehydrogenase [Ralstonia eutropha H16] Back     alignment and taxonomy information
>gi|339324646|ref|YP_004684339.1| glutamate dehydrogenase [Cupriavidus necator N-1] gi|338164803|gb|AEI75858.1| glutamate dehydrogenase GdhA [Cupriavidus necator N-1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query428
TIGR_CMR|BA_1511428 BA_1511 "glutamate dehydrogena 0.911 0.911 0.472 1.3e-93
UNIPROTKB|Q5HHC7414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|Q6GAW8414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|Q6GID0414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|Q7A1B9414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|Q7A6H8414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|Q99VD0414 gluD "NAD-specific glutamate d 0.894 0.925 0.470 7.3e-91
UNIPROTKB|P39633424 rocG "Catabolic NAD-specific g 0.911 0.919 0.449 1.1e-89
UNIPROTKB|P50735427 gudB "Cryptic catabolic NAD-sp 0.927 0.929 0.443 3.6e-89
UNIPROTKB|P54386428 gdhA "NADP-specific glutamate 0.936 0.936 0.437 3.7e-87
TIGR_CMR|BA_1511 BA_1511 "glutamate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
 Score = 932 (333.1 bits), Expect = 1.3e-93, P = 1.3e-93
 Identities = 186/394 (47%), Positives = 254/394 (64%)

Query:    35 LGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTL 94
             LG  +   E+LK P +++ V +P+  D+G V  + GYR QHN   GP KGG+RFHP+VT 
Sbjct:    36 LGYPNEVYELLKEPIRMMTVKIPVRMDDGTVKIFTGYRAQHNDAVGPTKGGIRFHPNVTE 95

Query:    95 SEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKD 154
             +E+ ALS WM++K   V++PYGG KGGI  +P+ +S  EL RL+R Y   IS I+G  KD
Sbjct:    96 NEVKALSIWMSLKCGIVDLPYGGGKGGIICDPREMSFRELERLSRGYVRAISQIVGPTKD 155

Query:   155 IPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGXXX 214
             IPAPDV T+ QIM+WMMD YS    +  PG +TGKP+ +GGS GR+ AT +GV I     
Sbjct:   156 IPAPDVFTNSQIMAWMMDEYSRIDEFNSPGFITGKPLVLGGSHGRETATAKGVTICIREA 215

Query:   215 XXXXXXXXXXXXXXXQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNIPKL-QK 273
                            QGFGN GS  A     AGAK++AI D    +++PNG +I  L  +
Sbjct:   216 AKKRDIDIKGARVVVQGFGNAGSFLAKFMHDAGAKVIAISDAYGALHDPNGLDIDYLLDR 275

Query:   274 YVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGP 333
               +F    K FN    I++ KE   + CDIL+PAAIE+QIT  NAN++ AKI++E ANGP
Sbjct:   276 RDSFGTVTKLFNN--TISN-KELLELDCDILVPAAIENQITEENANDIKAKIVVEAANGP 332

Query:   334 TTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAF 393
             TT EA  IL D+GI+L PDV+ +AGGV VSYFEWVQN     WTE+E+  RL  ++  +F
Sbjct:   333 TTLEATKILTDRGILLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEQRLEKVMVRSF 392

Query:   394 DAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRG 427
             D+I+E A  +KV++R AA+++G  ++ +A + RG
Sbjct:   393 DSIYETAQVRKVNMRLAAYMVGVRKMAEASRFRG 426




GO:0004353 "glutamate dehydrogenase [NAD(P)+
GO:0006537 "glutamate biosynthetic process" evidence=ISS
UNIPROTKB|Q5HHC7 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus COL (taxid:93062)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GAW8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MSSA476 (taxid:282459)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GID0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MRSA252 (taxid:282458)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A1B9 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
UNIPROTKB|Q7A6H8 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus N315 (taxid:158879)] Back     alignment and assigned GO terms
UNIPROTKB|Q99VD0 gluD "NAD-specific glutamate dehydrogenase" [Staphylococcus aureus subsp. aureus Mu50 (taxid:158878)] Back     alignment and assigned GO terms
UNIPROTKB|P39633 rocG "Catabolic NAD-specific glutamate dehydrogenase RocG" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|P50735 gudB "Cryptic catabolic NAD-specific glutamate dehydrogenase GudB" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|P54386 gdhA "NADP-specific glutamate dehydrogenase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54KB7DHE3_DICDI1, ., 4, ., 1, ., 30.44470.77570.6613yesN/A
P96110DHE3_THEMA1, ., 4, ., 1, ., 30.46170.94150.9687yesN/A
P80319DHE3_PYRFU1, ., 4, ., 1, ., 30.45380.95090.9690yesN/A
Q6GID0DHE2_STAAR1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
Q38946DHE2_ARATH1, ., 4, ., 1, ., 30.45290.91350.9513yesN/A
Q9YC65DHE3_AERPE1, ., 4, ., 1, ., 30.44440.93450.9569yesN/A
P39633DHE2_BACSU1, ., 4, ., 1, ., 20.45930.91120.9198yesN/A
Q7A1B9DHE2_STAAW1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
Q5HHC7DHE2_STAAC1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
P27346DHE2_CLODI1, ., 4, ., 1, ., 20.40950.96720.9833yesN/A
Q47950DHE3_PYRAB1, ., 4, ., 1, ., 30.44900.95090.9690yesN/A
O59650DHE3_PYRKO1, ., 4, ., 1, ., 30.43460.94620.9619yesN/A
Q7A6H8DHE2_STAAN1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
P0CL72DHE3_PYRHR1, ., 4, ., 1, ., 30.44900.95090.9690yesN/A
P0CL73DHE3_PYRHO1, ., 4, ., 1, ., 30.44900.95090.9690yesN/A
P00368DHE3_CHICK1, ., 4, ., 1, ., 30.41370.77570.6600yesN/A
Q6GAW8DHE2_STAAS1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
Q99VD0DHE2_STAAM1, ., 4, ., 1, ., 20.48310.89480.9251yesN/A
P80053DHE2_SULSO1, ., 4, ., 1, ., 30.40380.94620.9642yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.10.921
3rd Layer1.4.1.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
COG0334411 COG0334, GdhA, Glutamate dehydrogenase/leucine deh 0.0
PLN02477410 PLN02477, PLN02477, glutamate dehydrogenase 1e-149
cd01076227 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain 1e-101
pfam00208237 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenyl 2e-94
PTZ00079454 PTZ00079, PTZ00079, NADP-specific glutamate dehydr 1e-74
pfam02812131 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydr 4e-66
PRK09414445 PRK09414, PRK09414, glutamate dehydrogenase; Provi 9e-66
PRK14030445 PRK14030, PRK14030, glutamate dehydrogenase; Provi 2e-61
PRK14031444 PRK14031, PRK14031, glutamate dehydrogenase; Provi 4e-59
cd05211217 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding 4e-54
smart00839102 smart00839, ELFV_dehydrog, Glutamate/Leucine/Pheny 2e-39
cd05313254 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain 9e-37
cd01075200 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d 8e-16
PTZ003241002 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Pro 1e-07
COG2902 1592 COG2902, COG2902, NAD-specific glutamate dehydroge 2e-04
>gnl|CDD|223411 COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
 Score =  522 bits (1348), Expect = 0.0
 Identities = 190/411 (46%), Positives = 270/411 (65%), Gaps = 1/411 (0%)

Query: 18  LGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNI 77
              +   ++++++    L      +E LK P++++ V +P+  D+G V  + GYRVQHN 
Sbjct: 1   ENEFEQAVKELEKALEPLYLDEGVLERLKEPERVIQVRIPVRMDDGSVKVFRGYRVQHNS 60

Query: 78  LRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRL 137
             GP KGGVRFHP VTL E+ ALS WMT+KNA   +PYGG KGGI V+PK LS+ EL RL
Sbjct: 61  ALGPYKGGVRFHPYVTLEEVKALSFWMTLKNALAGLPYGGGKGGIIVDPKGLSDGELERL 120

Query: 138 TRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISIGGSF 197
           +R +   I  +IG + DIPAPDVGT+ Q M+WMMD YS     + PG+ TGKP+ +GGS 
Sbjct: 121 SRAFGRAIYRLIGPDTDIPAPDVGTNPQDMAWMMDEYSKIVGNSAPGVFTGKPLELGGSL 180

Query: 198 GRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDK 257
           GR +ATG GVF    +    +  ++  +++++QGFGNVG  AA    + GAK+VA+ D K
Sbjct: 181 GRSEATGYGVFYAIREALKALGDDLEGARVAVQGFGNVGQYAAEKLHELGAKVVAVSDSK 240

Query: 258 TTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINN 317
             IY+ +G ++  L +      S+ ++   E I  ++E   + CDILIP A+E+ IT +N
Sbjct: 241 GGIYDEDGLDVEALLELKERRGSVAEYAGAEYI-TNEELLEVDCDILIPCALENVITEDN 299

Query: 318 ANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWT 377
           A+ + AKI++EGANGPTT EAD+IL ++GI++ PD++ NAGGVIVSY EWVQN   L WT
Sbjct: 300 ADQLKAKIVVEGANGPTTPEADEILLERGILVVPDILANAGGVIVSYLEWVQNAQGLYWT 359

Query: 378 EQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL 428
           E+E++ +L  I+ NAF+A+++ A    V LRTAA+I+   RV  A K RG 
Sbjct: 360 EEEVDEKLERIMVNAFEAVYQAAKEYGVDLRTAAYILAFERVADAMKARGW 410


Length = 411

>gnl|CDD|178095 PLN02477, PLN02477, glutamate dehydrogenase Back     alignment and domain information
>gnl|CDD|133445 cd01076, NAD_bind_1_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>gnl|CDD|215789 pfam00208, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|185433 PTZ00079, PTZ00079, NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|202408 pfam02812, ELFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain Back     alignment and domain information
>gnl|CDD|181834 PRK09414, PRK09414, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184463 PRK14030, PRK14030, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184464 PRK14031, PRK14031, glutamate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133450 cd05211, NAD_bind_Glu_Leu_Phe_Val, NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|214847 smart00839, ELFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>gnl|CDD|133455 cd05313, NAD_bind_2_Glu_DH, NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>gnl|CDD|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>gnl|CDD|240359 PTZ00324, PTZ00324, glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>gnl|CDD|225455 COG2902, COG2902, NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 428
PLN02477410 glutamate dehydrogenase 100.0
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 100.0
PRK14030445 glutamate dehydrogenase; Provisional 100.0
PRK09414445 glutamate dehydrogenase; Provisional 100.0
PRK14031444 glutamate dehydrogenase; Provisional 100.0
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 100.0
KOG2250|consensus514 100.0
PTZ003241002 glutamate dehydrogenase 2; Provisional 100.0
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 100.0
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 100.0
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 100.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 100.0
PF02812131 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, di 100.0
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 100.0
smart00839102 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Vali 99.96
COG2902 1592 NAD-specific glutamate dehydrogenase [Amino acid t 99.93
PF05088 1528 Bac_GDH: Bacterial NAD-glutamate dehydrogenase 99.93
PRK08374 336 homoserine dehydrogenase; Provisional 99.36
PRK06392 326 homoserine dehydrogenase; Provisional 99.3
PRK06270 341 homoserine dehydrogenase; Provisional 99.05
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.68
PRK06813 346 homoserine dehydrogenase; Validated 98.41
PLN02700 377 homoserine dehydrogenase family protein 98.4
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.26
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 98.17
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 98.1
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 97.99
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.87
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.82
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 97.79
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.71
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.67
PTZ00075476 Adenosylhomocysteinase; Provisional 97.62
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.55
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.55
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.54
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.39
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.33
PLN02494477 adenosylhomocysteinase 97.31
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.3
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.29
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.23
COG0281432 SfcA Malic enzyme [Energy production and conversio 97.19
PRK07574385 formate dehydrogenase; Provisional 97.16
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.13
PRK13529563 malate dehydrogenase; Provisional 97.13
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.12
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.11
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.1
PLN03129581 NADP-dependent malic enzyme; Provisional 97.1
PLN03139386 formate dehydrogenase; Provisional 97.08
PRK12861 764 malic enzyme; Reviewed 97.07
PRK13243333 glyoxylate reductase; Reviewed 97.05
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.03
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.02
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.02
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.02
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 97.01
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.01
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 96.97
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.96
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.95
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 96.92
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.9
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 96.9
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.88
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 96.88
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.88
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.87
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.85
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 96.82
PRK00676338 hemA glutamyl-tRNA reductase; Validated 96.82
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.8
PLN02928347 oxidoreductase family protein 96.78
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.73
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.73
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 96.71
PRK13940414 glutamyl-tRNA reductase; Provisional 96.69
PRK00048257 dihydrodipicolinate reductase; Provisional 96.68
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.68
PRK06932314 glycerate dehydrogenase; Provisional 96.68
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.66
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 96.65
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.64
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.6
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 96.54
PRK06349 426 homoserine dehydrogenase; Provisional 96.52
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.48
PLN00203519 glutamyl-tRNA reductase 96.47
COG5322351 Predicted dehydrogenase [General function predicti 96.46
PTZ00317559 NADP-dependent malic enzyme; Provisional 96.42
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.4
PRK15059292 tartronate semialdehyde reductase; Provisional 96.38
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.38
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 96.37
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 96.34
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.28
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.28
PRK06436303 glycerate dehydrogenase; Provisional 96.22
PRK12862 763 malic enzyme; Reviewed 96.22
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 96.12
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.11
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.06
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.04
PRK06487317 glycerate dehydrogenase; Provisional 96.04
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.0
PRK06141314 ornithine cyclodeaminase; Validated 95.98
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.98
PRK12480330 D-lactate dehydrogenase; Provisional 95.95
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 95.95
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 95.87
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.86
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 95.86
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 95.85
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 95.85
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 95.84
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.81
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.74
PRK03659601 glutathione-regulated potassium-efflux system prot 95.72
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.72
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.65
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.53
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 95.48
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 95.47
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 95.39
PRK14982340 acyl-ACP reductase; Provisional 95.36
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 95.3
TIGR00036266 dapB dihydrodipicolinate reductase. 95.28
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.27
PRK08223287 hypothetical protein; Validated 95.23
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.23
PRK13303265 L-aspartate dehydrogenase; Provisional 95.22
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 95.19
KOG0068|consensus406 95.19
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.16
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.06
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.06
PLN02858 1378 fructose-bisphosphate aldolase 95.05
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 95.03
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.03
PRK07417279 arogenate dehydrogenase; Reviewed 95.01
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.01
PRK07340304 ornithine cyclodeaminase; Validated 94.97
PRK07680273 late competence protein ComER; Validated 94.93
KOG1370|consensus434 94.91
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 94.91
PRK08328231 hypothetical protein; Provisional 94.86
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.81
PLN02858 1378 fructose-bisphosphate aldolase 94.75
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 94.71
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 94.66
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 94.66
PRK06046326 alanine dehydrogenase; Validated 94.64
PLN02712 667 arogenate dehydrogenase 94.58
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.58
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 94.55
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.53
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.52
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 94.52
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 94.5
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.44
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.42
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 94.42
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.39
PRK08300302 acetaldehyde dehydrogenase; Validated 94.37
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.36
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.33
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 94.32
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.31
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.3
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 94.27
COG2085211 Predicted dinucleotide-binding enzymes [General fu 94.19
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 94.18
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 94.18
PRK05479 330 ketol-acid reductoisomerase; Provisional 94.13
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.08
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 94.07
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.02
PRK03562621 glutathione-regulated potassium-efflux system prot 94.01
PRK14851 679 hypothetical protein; Provisional 93.98
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 93.85
PRK11579 346 putative oxidoreductase; Provisional 93.8
PRK06153393 hypothetical protein; Provisional 93.78
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 93.76
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.76
PRK06719157 precorrin-2 dehydrogenase; Validated 93.7
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 93.68
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.68
PRK08618325 ornithine cyclodeaminase; Validated 93.65
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.57
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 93.54
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 93.36
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.33
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 93.32
PRK10669558 putative cation:proton antiport protein; Provision 93.32
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.29
PLN02688266 pyrroline-5-carboxylate reductase 93.28
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.27
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.24
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.23
PLN02256304 arogenate dehydrogenase 93.15
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.12
PRK14852 989 hypothetical protein; Provisional 93.09
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.04
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 93.01
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 93.01
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.0
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.93
COG0673 342 MviM Predicted dehydrogenases and related proteins 92.89
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.87
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.84
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.8
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 92.78
PLN02306386 hydroxypyruvate reductase 92.75
PRK04148134 hypothetical protein; Provisional 92.75
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 92.69
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 92.68
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.67
PRK09496453 trkA potassium transporter peripheral membrane com 92.61
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 92.55
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.53
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 92.53
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 92.46
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.44
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.41
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.32
COG2344211 AT-rich DNA-binding protein [General function pred 92.32
PRK13403 335 ketol-acid reductoisomerase; Provisional 92.31
KOG2380|consensus 480 92.28
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 92.24
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 92.24
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 92.19
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 92.18
PRK07877 722 hypothetical protein; Provisional 92.15
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 92.1
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.08
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 91.98
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.94
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.89
KOG0069|consensus336 91.86
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 91.85
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 91.7
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 91.69
KOG0409|consensus327 91.64
PRK08291330 ectoine utilization protein EutC; Validated 91.63
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 91.57
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 91.56
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 91.53
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 91.52
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 91.51
PRK05717255 oxidoreductase; Validated 91.48
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 91.46
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 91.33
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.21
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 91.19
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 91.18
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 91.1
KOG2018|consensus 430 91.02
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 91.0
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 90.87
PRK09496 453 trkA potassium transporter peripheral membrane com 90.87
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 90.83
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.82
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 90.81
KOG1257|consensus582 90.8
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 90.79
PLN02712 667 arogenate dehydrogenase 90.75
PRK08605332 D-lactate dehydrogenase; Validated 90.72
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 90.66
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 90.63
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.61
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.47
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 90.29
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.28
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 90.27
KOG0089|consensus309 90.27
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.25
PRK07411 390 hypothetical protein; Validated 90.18
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.14
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.12
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 90.11
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.93
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 89.81
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 89.81
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 89.77
PRK06823315 ornithine cyclodeaminase; Validated 89.65
PRK08507275 prephenate dehydrogenase; Validated 89.63
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.58
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 89.54
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 89.46
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 89.4
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.39
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 89.18
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.14
COG0300265 DltE Short-chain dehydrogenases of various substra 89.12
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 89.12
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 89.08
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 89.08
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.98
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 88.91
PRK08655 437 prephenate dehydrogenase; Provisional 88.85
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 88.84
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 88.82
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.71
PTZ00082 321 L-lactate dehydrogenase; Provisional 88.64
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 88.5
COG2130340 Putative NADP-dependent oxidoreductases [General f 88.4
PLN02353 473 probable UDP-glucose 6-dehydrogenase 88.25
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 87.92
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 87.85
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.77
PRK05225 487 ketol-acid reductoisomerase; Validated 87.0
PRK08265261 short chain dehydrogenase; Provisional 86.87
PRK06545 359 prephenate dehydrogenase; Validated 86.85
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 86.79
PRK06182273 short chain dehydrogenase; Validated 86.72
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.45
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 86.45
PRK06407301 ornithine cyclodeaminase; Provisional 86.33
PRK10206 344 putative oxidoreductase; Provisional 86.28
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 86.2
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.17
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 86.11
PRK08339263 short chain dehydrogenase; Provisional 86.11
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 86.08
PRK08628258 short chain dehydrogenase; Provisional 85.98
PTZ00431260 pyrroline carboxylate reductase; Provisional 85.95
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 85.9
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 85.52
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 85.48
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 85.42
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.28
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.23
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.19
KOG0455|consensus 364 85.11
PRK12742237 oxidoreductase; Provisional 84.96
KOG2741|consensus 351 84.71
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 84.66
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.65
PRK06138252 short chain dehydrogenase; Provisional 84.51
PRK11891429 aspartate carbamoyltransferase; Provisional 84.4
PRK07060245 short chain dehydrogenase; Provisional 84.39
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 84.33
PRK12828239 short chain dehydrogenase; Provisional 84.32
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.22
PRK05562223 precorrin-2 dehydrogenase; Provisional 84.21
PRK06180277 short chain dehydrogenase; Provisional 84.2
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 84.18
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 84.12
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 84.12
PRK05867253 short chain dehydrogenase; Provisional 83.89
PRK05872296 short chain dehydrogenase; Provisional 83.76
PRK07523255 gluconate 5-dehydrogenase; Provisional 83.73
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 83.68
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.65
PTZ00117 319 malate dehydrogenase; Provisional 83.64
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 83.62
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 83.6
PRK09291257 short chain dehydrogenase; Provisional 83.58
PRK06849 389 hypothetical protein; Provisional 83.56
PLN02602 350 lactate dehydrogenase 83.54
PLN02896 353 cinnamyl-alcohol dehydrogenase 83.51
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.48
PRK11730 715 fadB multifunctional fatty acid oxidation complex 83.42
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 83.41
PLN02206 442 UDP-glucuronate decarboxylase 83.39
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 83.37
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.35
PRK05876275 short chain dehydrogenase; Provisional 83.3
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 83.24
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.16
PLN02240 352 UDP-glucose 4-epimerase 83.04
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.02
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.01
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 82.86
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 82.83
PRK12938246 acetyacetyl-CoA reductase; Provisional 82.8
PRK06194287 hypothetical protein; Provisional 82.79
PRK06841255 short chain dehydrogenase; Provisional 82.59
PRK07774250 short chain dehydrogenase; Provisional 82.44
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 82.43
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.34
PRK08192338 aspartate carbamoyltransferase; Provisional 82.3
PRK07825273 short chain dehydrogenase; Provisional 82.21
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.2
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 82.03
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 81.97
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 81.93
PRK07063260 short chain dehydrogenase; Provisional 81.86
PRK12829264 short chain dehydrogenase; Provisional 81.85
PRK08263275 short chain dehydrogenase; Provisional 81.85
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 81.84
PRK06949258 short chain dehydrogenase; Provisional 81.75
PRK06125259 short chain dehydrogenase; Provisional 81.75
PRK09186256 flagellin modification protein A; Provisional 81.65
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 81.64
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 81.56
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 81.51
PRK06523260 short chain dehydrogenase; Provisional 81.45
PRK07589346 ornithine cyclodeaminase; Validated 81.27
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 81.24
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 81.23
PRK08703239 short chain dehydrogenase; Provisional 81.11
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 81.1
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 81.09
PRK09072263 short chain dehydrogenase; Provisional 80.96
PRK08085254 gluconate 5-dehydrogenase; Provisional 80.87
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.85
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 80.81
PRK06172253 short chain dehydrogenase; Provisional 80.71
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 80.58
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This mo 80.46
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 80.41
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 80.4
PLN02586360 probable cinnamyl alcohol dehydrogenase 80.38
PRK05875276 short chain dehydrogenase; Provisional 80.26
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 80.25
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 80.23
PRK06057255 short chain dehydrogenase; Provisional 80.11
KOG2653|consensus 487 80.1
PRK08936261 glucose-1-dehydrogenase; Provisional 80.07
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=2.1e-131  Score=1013.62  Aligned_cols=409  Identities=44%  Similarity=0.769  Sum_probs=404.4

Q ss_pred             CChHHHHHHHHHhhhcccCCChhHHhhcCCCceEEEEEEEEEeCCCeeeeeEEEEEEecCCCCCCCCCeeecCCCCHHHH
Q psy8192          18 LGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEI   97 (428)
Q Consensus        18 ~~~~~~~~~~~~~a~~~~~~~~~~~~~L~~p~r~~~v~~pv~~d~G~~~~~~G~rv~h~~~~GPakGGiR~~p~vt~~ev   97 (428)
                      +++|++++++|++|+++++++|+++++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|++||
T Consensus         1 ~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~v~~p~~~d~g~~~~~~gyRvqh~~~~GP~kGGiR~~p~v~~~ev   80 (410)
T PLN02477          1 MNALAATNRNFREAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEV   80 (410)
T ss_pred             CCHHHHHHHHHHHHHHHcCCCHHHHHHHhcCceEEEEEEEEEECCCcEEEeeeeEeeecCccCCCCCCeeecCCCCHHHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhHhhhhhccccCCCCCceeEEecCCCCCCHHHHHHHHHHHHHHHhcccCCCCcccCCCCCCCHHHHHHHHHHhhhh
Q psy8192          98 IALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTK  177 (428)
Q Consensus        98 ~~LA~~Mt~K~Al~~lp~GGaKggI~~dP~~~s~~ele~~~r~f~~~l~~~iG~~~dipapDvgt~~~~ma~~~d~y~~~  177 (428)
                      ++||+||||||||++||||||||||++||+++|..|+|+++|+|+++|.+++||++|||||||||++++|+||+|+|+++
T Consensus        81 ~~La~~MT~K~Al~~lP~GGgKggI~~dP~~~s~~e~e~l~r~f~~~l~~~iG~~~DipapDvgt~~~~M~w~~d~y~~~  160 (410)
T PLN02477         81 NALAQLMTWKTAVANIPYGGAKGGIGCDPRDLSESELERLTRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKF  160 (410)
T ss_pred             HHHHHHHHHHHHhcCCCCcCceeeeccCCccCCHHHHHHHHHHHHHHHHHhcCCCCCcccCCCCCCHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcCCceeecccccCCCcCCCCChhHHHHHHHHHHHHHHhCCCCCCceEEEEeccHHHHHHHHHHHHCCCEEEEEEcCC
Q psy8192         178 KNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDK  257 (428)
Q Consensus       178 ~g~~~~~~vtGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~GakvVaVsD~~  257 (428)
                      .|++ ++++||||+.+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|.++|+|||+|||++
T Consensus       161 ~g~~-~~~vtGkp~~~gGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~VaIqGfGnVG~~~A~~L~e~GakVVaVsD~~  239 (410)
T PLN02477        161 HGFS-PAVVTGKPIDLGGSLGREAATGRGVVFATEALLAEHGKSIAGQTFVIQGFGNVGSWAAQLIHEKGGKIVAVSDIT  239 (410)
T ss_pred             hCCC-CceEeCCCcccCCCCCCCccchHHHHHHHHHHHHHcCCCccCCEEEEECCCHHHHHHHHHHHHcCCEEEEEECCC
Confidence            9988 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeeCCCCCCHHHHHHHHHhcCCCcCCCCceeccCCCcccccCceEEecccccccccccccccccceEEEecCCCCCCHH
Q psy8192         258 TTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPTTTE  337 (428)
Q Consensus       258 G~i~n~~GlD~~~l~~~~~~~g~l~~~~~~~~i~~~~~il~~~~DIliPaA~~~~It~~na~~l~akiIvegAN~p~t~e  337 (428)
                      |++|||+|||+++|++++++++++.+|++++.++ ++++|..+||||+|||++|+||++||++++||+|+||||+|+||+
T Consensus       240 G~iy~~~GLD~~~L~~~k~~~g~l~~~~~a~~i~-~~e~l~~~~DvliP~Al~~~I~~~na~~i~ak~I~egAN~p~t~e  318 (410)
T PLN02477        240 GAVKNENGLDIPALRKHVAEGGGLKGFPGGDPID-PDDILVEPCDVLIPAALGGVINKENAADVKAKFIVEAANHPTDPE  318 (410)
T ss_pred             CeEECCCCCCHHHHHHHHHhcCchhccccceEec-CccceeccccEEeeccccccCCHhHHHHcCCcEEEeCCCCCCCHH
Confidence            9999999999999999999999999999988888 899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHCCCceeccccccccchhhhHHHHHhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHH
Q psy8192         338 ADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCT  417 (428)
Q Consensus       338 a~~iL~~rGI~viPD~laNaGGVi~s~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~a~~  417 (428)
                      |+++|++|||+|+||+++|+||||+|||||+||+++++|++++|+++|+++|.++|++|++.|+++++++|+|||++|++
T Consensus       319 a~~~L~~rGI~~~PD~~aNaGGVivs~~E~~qn~~~~~w~~~~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~a~~  398 (410)
T PLN02477        319 ADEILRKKGVVVLPDIYANSGGVTVSYFEWVQNIQGFMWEEEKVNRELDRYMTDAFKALKEMCKTHNCSLRMGAFTLGVN  398 (410)
T ss_pred             HHHHHHHCCcEEEChHHhCCCCeeeeHHHhhhccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCcCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCC
Q psy8192         418 RVLQAHKTRGL  428 (428)
Q Consensus       418 rv~~a~~~rG~  428 (428)
                      ||+++|+.|||
T Consensus       399 rv~~a~~~rG~  409 (410)
T PLN02477        399 RVARATVLRGW  409 (410)
T ss_pred             HHHHHHHhhCC
Confidence            99999999997



>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>KOG2250|consensus Back     alignment and domain information
>PTZ00324 glutamate dehydrogenase 2; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02812 ELFV_dehydrog_N: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; InterPro: IPR006097 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>smart00839 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>COG2902 NAD-specific glutamate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05088 Bac_GDH: Bacterial NAD-glutamate dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>KOG1257|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0455|consensus Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
3aoe_A424 Crystal Structure Of Hetero-Hexameric Glutamate Deh 1e-133
3aog_A440 Crystal Structure Of Glutamate Dehydrogenase (Gdhb) 1e-133
1b26_A416 Glutamate Dehydrogenase Length = 416 1e-107
1b3b_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 1e-106
2tmg_A415 Thermotoga Maritima Glutamate Dehydrogenase Mutant 5e-99
3k92_A424 Crystal Structure Of A E93k Mutant Of The Majour Ba 4e-98
1gtm_A419 Structure Of Glutamate Dehydrogenase Length = 419 7e-98
1euz_A419 Glutamate Dehydrogenase From Thermococcus Profundus 6e-97
3k8z_A423 Crystal Structure Of Gudb1 A Decryptified Secondary 1e-94
1bvu_A418 Glutamate Dehydrogenase From Thermococcus Litoralis 2e-94
1v9l_A421 L-Glutamate Dehydrogenase From Pyrobaculum Islandic 6e-86
3aoe_E419 Crystal Structure Of Hetero-Hexameric Glutamate Deh 5e-78
2yfq_A421 Crystal Structure Of Glutamate Dehydrogenase From P 9e-78
3etd_A501 Structure Of Glutamate Dehydrogenase Complexed With 4e-70
1nqt_A496 Crystal Structure Of Bovine Glutamate Dehydrogenase 5e-70
1l1f_A505 Structure Of Human Glutamate Dehydrogenase-Apo Form 6e-70
1nr1_A496 Crystal Structure Of The R463a Mutant Of Human Glut 7e-70
3mw9_A501 Bovine Glutamate Dehydrogenase Complexed With Nadh, 4e-69
1hwy_A501 Bovine Glutamate Dehydrogenase Complexed With Nad A 3e-66
3r3j_A456 Kinetic And Structural Characterization Of Plasmodi 6e-54
2yfh_A448 Structure Of A Chimeric Glutamate Dehydrogenase Len 2e-52
4fcc_A450 Glutamate Dehydrogenase From E. Coli Length = 450 7e-49
3sbo_A447 Structure Of E.Coli Gdh From Native Source Length = 2e-48
2yfg_E447 Structural Determinants Of Cofactor Specificity And 9e-48
1hrd_A449 Glutamate Dehydrogenase Length = 449 5e-47
1k89_A449 K89l Mutant Of Glutamate Dehydrogenase Length = 449 2e-46
1aup_A449 Glutamate Dehydrogenase Length = 449 2e-45
2bma_A470 The Crystal Structure Of Plasmodium Falciparum Glut 4e-40
1c1d_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 3e-15
1c1x_A355 L-Phenylalanine Dehydrogenase Structure In Ternary 3e-15
1bw9_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 3e-15
1c1d_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 3e-15
1c1x_B355 L-Phenylalanine Dehydrogenase Structure In Ternary 4e-15
1bxg_A356 Phenylalanine Dehydrogenase Structure In Ternary Co 5e-15
1bw9_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 5e-15
1bxg_B356 Phenylalanine Dehydrogenase Structure In Ternary Co 5e-15
3vpx_A364 Crystal Structure Of Leucine Dehydrogenase From A P 6e-14
1leh_A364 Leucine Dehydrogenase From Bacillus Sphaericus Leng 1e-08
>pdb|3AOE|A Chain A, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 424 Back     alignment and structure

Iteration: 1

Score = 470 bits (1210), Expect = e-133, Method: Compositional matrix adjust. Identities = 226/418 (54%), Positives = 299/418 (71%), Gaps = 2/418 (0%) Query: 11 SYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEG 70 SYL + D GPW ++ +Q+DRV PYLG L+ E LK PK++LIVDVP+ D+G V ++EG Sbjct: 7 SYLGK-DGGPWEIFTEQVDRVVPYLGRLAPLAESLKRPKRVLIVDVPVRLDDGSVAYFEG 65 Query: 71 YRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLS 130 YRV HN RGP KGGVR+HP+VTLSE++AL+GWMTIKNAAV +PYGG KGGIRV+P+ LS Sbjct: 66 YRVHHNTARGPAKGGVRYHPEVTLSEVMALAGWMTIKNAAVGLPYGGGKGGIRVDPRKLS 125 Query: 131 NNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKP 190 EL RLTRRYT+EI ++G ++DIPAPDV T + M+WMMDTYS T+PG+VTGKP Sbjct: 126 PGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVGRTVPGVVTGKP 185 Query: 191 ISIGGSFGRQKATGRGVFIIGXXXXXXXXXXXXXXXXXXQGFGNVGSVAANLFFKAGAKI 250 I++GGS GR+ ATGRGVFI QGFGNVG+ AA F GA++ Sbjct: 186 IALGGSLGRRDATGRGVFITAAAAAEKIGLQVEGARVAIQGFGNVGNAAARAFHDHGARV 245 Query: 251 VAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIE 310 VA+QD T+YN G + L ++V ++ + + E + + +FW +P + L+PAA+E Sbjct: 246 VAVQDHTGTVYNEAGIDPYDLLRHVQEFGGVRGYPKAEPL-PAADFWGLPVEFLVPAALE 304 Query: 311 DQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQN 370 QIT NA + A+I+ EGANGPTT ADDIL +KG+++ PDVI NAGGV VSYFEWVQ+ Sbjct: 305 KQITEQNAWRIRARIVAEGANGPTTPAADDILLEKGVLVVPDVIANAGGVTVSYFEWVQD 364 Query: 371 LSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHKTRGL 428 ++ WTE+EIN RL ++ NAF+A+W++A KK+ LRTAA+++ TRVL+A RGL Sbjct: 365 FNSYFWTEEEINARLERVLRNAFEAVWQVAQEKKIPLRTAAYVVAATRVLEARALRGL 422
>pdb|3AOG|A Chain A, Crystal Structure Of Glutamate Dehydrogenase (Gdhb) From Thermus Thermophilus (Glu Bound Form) Length = 440 Back     alignment and structure
>pdb|1B26|A Chain A, Glutamate Dehydrogenase Length = 416 Back     alignment and structure
>pdb|1B3B|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant N97d, G376k Length = 415 Back     alignment and structure
>pdb|2TMG|A Chain A, Thermotoga Maritima Glutamate Dehydrogenase Mutant S128r, T158e, N117r, S160e Length = 415 Back     alignment and structure
>pdb|3K92|A Chain A, Crystal Structure Of A E93k Mutant Of The Majour Bacillus Su Glutamate Dehydrogenase Rocg Length = 424 Back     alignment and structure
>pdb|1GTM|A Chain A, Structure Of Glutamate Dehydrogenase Length = 419 Back     alignment and structure
>pdb|1EUZ|A Chain A, Glutamate Dehydrogenase From Thermococcus Profundus In The Unligated State Length = 419 Back     alignment and structure
>pdb|3K8Z|A Chain A, Crystal Structure Of Gudb1 A Decryptified Secondary Glutamate Dehydrogenase From B. Subtilis Length = 423 Back     alignment and structure
>pdb|1BVU|A Chain A, Glutamate Dehydrogenase From Thermococcus Litoralis Length = 418 Back     alignment and structure
>pdb|1V9L|A Chain A, L-Glutamate Dehydrogenase From Pyrobaculum Islandicum Complexed With Nad Length = 421 Back     alignment and structure
>pdb|3AOE|E Chain E, Crystal Structure Of Hetero-Hexameric Glutamate Dehydrogenase From Thermus Thermophilus (Leu Bound Form) Length = 419 Back     alignment and structure
>pdb|2YFQ|A Chain A, Crystal Structure Of Glutamate Dehydrogenase From Peptoniphilus Asaccharolyticus Length = 421 Back     alignment and structure
>pdb|3ETD|A Chain A, Structure Of Glutamate Dehydrogenase Complexed With Bithionol Length = 501 Back     alignment and structure
>pdb|1NQT|A Chain A, Crystal Structure Of Bovine Glutamate Dehydrogenase-adp Complex Length = 496 Back     alignment and structure
>pdb|1L1F|A Chain A, Structure Of Human Glutamate Dehydrogenase-Apo Form Length = 505 Back     alignment and structure
>pdb|1NR1|A Chain A, Crystal Structure Of The R463a Mutant Of Human Glutamate Dehydrogenase Length = 496 Back     alignment and structure
>pdb|3MW9|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nadh, Gtp, Glu Length = 501 Back     alignment and structure
>pdb|1HWY|A Chain A, Bovine Glutamate Dehydrogenase Complexed With Nad And 2-Oxoglutarate Length = 501 Back     alignment and structure
>pdb|3R3J|A Chain A, Kinetic And Structural Characterization Of Plasmodium Falciparum Glutamate Dehydrogenase 2 Length = 456 Back     alignment and structure
>pdb|2YFH|A Chain A, Structure Of A Chimeric Glutamate Dehydrogenase Length = 448 Back     alignment and structure
>pdb|4FCC|A Chain A, Glutamate Dehydrogenase From E. Coli Length = 450 Back     alignment and structure
>pdb|3SBO|A Chain A, Structure Of E.Coli Gdh From Native Source Length = 447 Back     alignment and structure
>pdb|2YFG|E Chain E, Structural Determinants Of Cofactor Specificity And Domain Flexibility In Bacterial Glutamate Dehydrogenases Length = 447 Back     alignment and structure
>pdb|1HRD|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1K89|A Chain A, K89l Mutant Of Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|1AUP|A Chain A, Glutamate Dehydrogenase Length = 449 Back     alignment and structure
>pdb|2BMA|A Chain A, The Crystal Structure Of Plasmodium Falciparum Glutamate Dehydrogenase, A Putative Target For Novel Antimalarial Drugs Length = 470 Back     alignment and structure
>pdb|1C1D|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1C1X|A Chain A, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BW9|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1C1D|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nadh And L-Phenylalanine Length = 355 Back     alignment and structure
>pdb|1C1X|B Chain B, L-Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And L-3-Phenyllactate Length = 355 Back     alignment and structure
>pdb|1BXG|A Chain A, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|1BW9|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Phenylpyruvate Length = 356 Back     alignment and structure
>pdb|1BXG|B Chain B, Phenylalanine Dehydrogenase Structure In Ternary Complex With Nad+ And Beta-Phenylpropionate Length = 356 Back     alignment and structure
>pdb|3VPX|A Chain A, Crystal Structure Of Leucine Dehydrogenase From A Psychrophilic Bacterium Sporosarcina Psychrophila. Length = 364 Back     alignment and structure
>pdb|1LEH|A Chain A, Leucine Dehydrogenase From Bacillus Sphaericus Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query428
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 0.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 0.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 0.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 0.0
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 0.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 0.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 0.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 0.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 1e-161
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 1e-153
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1e-150
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 1e-144
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 1e-143
2yfg_A447 NADP-specific glutamate dehydrogenase; oxidoreduct 1e-136
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Length = 440 Back     alignment and structure
 Score =  649 bits (1678), Expect = 0.0
 Identities = 230/424 (54%), Positives = 309/424 (72%), Gaps = 1/424 (0%)

Query: 5   TDNSRPSYLSQNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGE 64
           +  S P      D GPW ++ +Q+DRV PYLG L+   E LK PK++LIVDVP+  D+G 
Sbjct: 16  SMKSEPLSYLGKDGGPWEIFTEQVDRVVPYLGRLAPLAESLKRPKRVLIVDVPVRLDDGS 75

Query: 65  VFHYEGYRVQHNILRGPGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRV 124
           V ++EGYRV HN  RGP KGGVR+HP+VTLSE++AL+GWMTIKNAAV +PYGG KGGIRV
Sbjct: 76  VAYFEGYRVHHNTARGPAKGGVRYHPEVTLSEVMALAGWMTIKNAAVGLPYGGGKGGIRV 135

Query: 125 NPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPG 184
           +P+ LS  EL RLTRRYT+EI  ++G ++DIPAPDV T  + M+WMMDTYS     T+PG
Sbjct: 136 DPRKLSPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVGRTVPG 195

Query: 185 IVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFF 244
           +VTGKPI++GGS GR+ ATGRGVFI  +  A KI L +  ++++IQGFGNVG+ AA  F 
Sbjct: 196 VVTGKPIALGGSLGRRDATGRGVFITAAAAAEKIGLQVEGARVAIQGFGNVGNAAARAFH 255

Query: 245 KAGAKIVAIQDDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDIL 304
             GA++VA+QD   T+YN  G +   L ++V     ++ + + E +  + +FW +P + L
Sbjct: 256 DHGARVVAVQDHTGTVYNEAGIDPYDLLRHVQEFGGVRGYPKAEPL-PAADFWGLPVEFL 314

Query: 305 IPAAIEDQITINNANNVTAKIILEGANGPTTTEADDILRDKGIILAPDVITNAGGVIVSY 364
           +PAA+E QIT  NA  + A+I+ EGANGPTT  ADDIL +KG+++ PDVI NAGGV VSY
Sbjct: 315 VPAALEKQITEQNAWRIRARIVAEGANGPTTPAADDILLEKGVLVVPDVIANAGGVTVSY 374

Query: 365 FEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFIIGCTRVLQAHK 424
           FEWVQ+ ++  WTE+EIN RL  ++ NAF+A+W++A  KK+ LRTAA+++  TRVL+A  
Sbjct: 375 FEWVQDFNSYFWTEEEINARLERVLRNAFEAVWQVAQEKKIPLRTAAYVVAATRVLEARA 434

Query: 425 TRGL 428
            RGL
Sbjct: 435 LRGL 438


>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Length = 415 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Length = 421 Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Length = 419 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Length = 424 Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Length = 421 Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Length = 419 Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Length = 501 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Length = 364 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Length = 355 Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Length = 449 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Length = 470 Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Length = 456 Back     alignment and structure
>2yfg_A NADP-specific glutamate dehydrogenase; oxidoreductase; 2.50A {Escherichia coli} PDB: 3sbo_A 2yfg_E Length = 447 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 100.0
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 100.0
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 100.0
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 100.0
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 100.0
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 100.0
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 100.0
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 100.0
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 100.0
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 100.0
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 100.0
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 100.0
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 100.0
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 100.0
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 98.35
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.2
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.02
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.96
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.93
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.88
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.87
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.86
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.85
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.84
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.8
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.75
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.64
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.61
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 97.59
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.59
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.58
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 97.54
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.54
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.53
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.52
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.5
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.49
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.47
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.46
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.39
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.39
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.37
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.36
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.36
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.36
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.34
3qha_A296 Putative oxidoreductase; seattle structural genomi 97.34
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.34
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.33
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.32
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.3
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.3
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.21
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.2
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.2
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.19
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.19
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.18
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.17
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.16
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.14
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 97.13
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.12
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.11
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.1
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.08
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.07
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.07
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 97.06
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.04
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.04
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 97.03
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.02
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.01
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.99
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.99
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 96.99
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 96.97
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.96
1pj3_A564 NAD-dependent malic enzyme, mitochondrial; oxidati 96.95
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.93
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.93
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 96.92
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.9
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.89
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.89
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.88
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 96.88
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.88
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.87
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 96.83
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.82
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.81
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.81
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 96.81
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.76
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 96.75
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.75
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.74
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.74
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.73
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.72
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.69
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.69
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.67
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.66
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.65
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.65
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.64
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.63
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 96.62
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.6
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.6
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.6
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 96.6
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 96.59
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.58
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.58
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.57
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.56
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.56
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.54
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.51
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.5
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.49
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.48
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 96.48
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.39
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.39
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.34
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.32
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.31
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.3
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 96.29
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.28
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.26
4had_A 350 Probable oxidoreductase protein; structural genomi 96.25
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.25
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 96.2
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 96.2
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.19
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.16
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.1
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 96.09
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.07
4ezb_A317 Uncharacterized conserved protein; structural geno 96.04
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.02
4h3v_A 390 Oxidoreductase domain protein; structural genomics 96.01
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 96.01
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.0
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 95.98
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 95.97
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 95.95
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 95.93
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 95.93
1ydw_A 362 AX110P-like protein; structural genomics, protein 95.92
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 95.86
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.85
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 95.84
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.83
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.81
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 95.79
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 95.78
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.77
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 95.77
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 95.77
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.76
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 95.76
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 95.76
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 95.75
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 95.71
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.7
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 95.69
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 95.69
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.69
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.66
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.66
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 95.65
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 95.65
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.62
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 95.61
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 95.61
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 95.59
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.58
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.57
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 95.55
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 95.53
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.52
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 95.52
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 95.51
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 95.49
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 95.49
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 95.48
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.47
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.47
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 95.44
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.44
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 95.39
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 95.38
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.38
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 95.34
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.32
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.32
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 95.3
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.29
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.27
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 95.26
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 95.26
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 95.23
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 95.21
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.18
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 95.15
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.15
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.09
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 95.07
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 95.06
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.03
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.03
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 94.98
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.97
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 94.97
1yb4_A295 Tartronic semialdehyde reductase; structural genom 94.96
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 94.95
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 94.85
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 94.83
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 94.77
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.71
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 94.69
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 94.53
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.46
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 94.44
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 94.41
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 94.39
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 94.39
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 94.39
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 94.36
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 94.36
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.34
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 94.23
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.21
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.19
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.16
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.15
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 94.12
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.11
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.04
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 94.01
2d59_A144 Hypothetical protein PH1109; COA binding, structur 94.01
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 94.0
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 93.99
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 93.95
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.94
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 93.92
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 93.87
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 93.73
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 93.73
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 93.71
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.7
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 93.67
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 93.67
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 93.58
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 93.5
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 93.45
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.42
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 93.34
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.31
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.08
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 93.07
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 93.06
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.98
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 92.96
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 92.82
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 92.73
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 92.71
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 92.61
4eso_A255 Putative oxidoreductase; NADP, structural genomics 92.59
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.58
2duw_A145 Putative COA-binding protein; ligand binding prote 92.56
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 92.46
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 92.43
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 92.39
4dqx_A277 Probable oxidoreductase protein; structural genomi 92.37
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 92.25
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 92.18
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 92.12
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 92.03
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 92.01
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 91.98
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 91.93
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 91.82
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 91.77
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 91.66
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 91.6
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 91.57
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 91.53
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 91.53
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 91.52
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.46
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 91.44
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 91.35
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 91.33
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.33
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 91.3
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.26
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 91.13
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.09
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 91.08
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 91.04
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 90.95
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 90.91
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 90.91
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 90.87
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 90.81
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 90.73
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 90.68
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 90.65
1nff_A260 Putative oxidoreductase RV2002; directed evolution 90.65
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.6
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 90.58
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 90.56
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 90.47
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 90.36
1iuk_A140 Hypothetical protein TT1466; structural genomics, 90.33
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 90.27
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 90.1
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 90.1
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 90.06
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 89.93
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.86
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 89.66
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 89.64
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 89.64
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 89.57
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.45
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 89.2
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 89.19
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 89.15
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 89.11
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 89.08
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 89.05
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 88.92
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 88.91
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 88.84
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 88.83
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 88.82
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 88.69
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 88.68
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 88.62
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 88.51
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 88.51
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 88.5
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 88.45
3fbg_A346 Putative arginate lyase; structural genomics, unkn 88.45
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 88.38
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 88.33
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 88.25
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 88.22
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 88.18
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 88.05
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 88.03
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 88.01
1lnq_A336 MTHK channels, potassium channel related protein; 87.92
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 87.81
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 87.76
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 87.75
4hb9_A 412 Similarities with probable monooxygenase; flavin, 87.68
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 87.62
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 87.61
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 87.52
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 87.5
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 87.49
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 87.45
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 87.41
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 87.33
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 87.23
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 87.21
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 87.2
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 87.02
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.02
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 86.98
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 86.9
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 86.85
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 86.84
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 86.75
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 86.65
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 86.63
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 86.63
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.55
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 86.54
3imf_A257 Short chain dehydrogenase; structural genomics, in 86.53
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 86.49
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 86.39
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 86.34
3qlj_A322 Short chain dehydrogenase; structural genomics, se 86.31
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 86.27
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 86.14
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 86.12
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 86.12
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 86.05
3edm_A259 Short chain dehydrogenase; structural genomics, ox 86.04
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 86.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 85.98
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 85.97
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 85.89
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 85.83
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 85.83
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 85.81
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 85.81
3tjr_A301 Short chain dehydrogenase; structural genomics, se 85.76
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 85.64
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 85.63
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 85.61
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 85.47
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 85.47
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 85.45
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 85.44
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 85.43
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 85.36
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 85.34
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 85.32
3tox_A280 Short chain dehydrogenase; structural genomics, PS 85.32
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 85.28
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 85.25
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 85.2
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 85.19
3tl2_A 315 Malate dehydrogenase; center for structural genomi 85.19
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 85.16
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 85.16
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 85.08
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 85.04
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 85.04
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 85.02
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 85.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 84.99
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 84.98
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 84.97
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 84.95
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 84.89
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 84.83
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 84.82
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 84.81
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 84.8
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 84.78
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 84.78
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 84.73
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.68
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 84.6
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 84.5
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 84.49
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 84.47
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 84.47
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 84.44
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 84.42
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 84.41
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 84.39
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 84.38
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 84.23
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 84.19
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 84.17
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 84.1
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 84.04
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 84.02
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 83.99
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 83.89
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 83.82
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 83.74
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 83.73
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 83.68
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 83.66
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 83.65
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 83.6
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 83.58
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 83.55
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 83.53
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 83.52
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 83.51
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 83.48
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 83.43
3cxt_A291 Dehydrogenase with different specificities; rossma 83.43
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 83.42
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 83.37
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 83.93
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 83.33
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 83.25
3e03_A274 Short chain dehydrogenase; structural genomics, PS 83.2
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 83.2
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 83.19
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 83.19
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 83.17
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 83.11
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 83.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 82.87
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 82.72
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 82.7
1xkq_A280 Short-chain reductase family member (5D234); parra 82.59
1xq6_A253 Unknown protein; structural genomics, protein stru 82.58
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 82.55
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 82.53
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 82.52
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 82.52
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
Probab=100.00  E-value=1.8e-130  Score=1008.04  Aligned_cols=412  Identities=44%  Similarity=0.769  Sum_probs=405.3

Q ss_pred             CCCCChHHHHHHHHHhhhcccCCChhHHhhcCCCceEEEEEEEEEeCCCeeeeeEEEEEEecCCCCCCCCCeeecCCCCH
Q psy8192          15 QNDLGPWGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRGPGKGGVRFHPDVTL   94 (428)
Q Consensus        15 ~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~L~~p~r~~~v~~pv~~d~G~~~~~~G~rv~h~~~~GPakGGiR~~p~vt~   94 (428)
                      .+..++|++++++|++|+++++++|+++++|++|+|+++|+|||+||||++++|+|||||||+++||+||||||||++|+
T Consensus        12 ~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~l~~p~r~~~~~vp~~~d~G~~~v~~GyRvqhn~a~GP~kGGiR~~p~v~~   91 (424)
T 3k92_A           12 KEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNE   91 (424)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHSSCSEEEEEEEEEECTTSCEEEEEEEEEECCCSSSSEECCEEEETTCCH
T ss_pred             cccCCHHHHHHHHHHHHHHHcCCCHHHHHHhcCCCeEEEEEEEEEecCCcEEEEEEEEEEECCcCCCCCCCeEecCCCCH
Confidence            34568999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhHhhhhhccccCCCCCceeEEecCCCCCCHHHHHHHHHHHHHHHhcccCCCCcccCCCCCCCHHHHHHHHHHh
Q psy8192          95 SEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRRYTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTY  174 (428)
Q Consensus        95 ~ev~~LA~~Mt~K~Al~~lp~GGaKggI~~dP~~~s~~ele~~~r~f~~~l~~~iG~~~dipapDvgt~~~~ma~~~d~y  174 (428)
                      +|+++||+||||||||++||||||||||++||+.+|+.|+||+||+|+++|.+++||++|||||||||++++|+||+|+|
T Consensus        92 ~ev~~La~~mt~KnAl~~lP~GGgKggi~~DP~~~s~~El~r~~r~f~~~l~~~iG~~~dipApDvgt~~~~m~~~~~~y  171 (424)
T 3k92_A           92 EKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEY  171 (424)
T ss_dssp             HHHHHHHHHHHHHHHHTTCSCEEEEEEEECCGGGSCHHHHHHHHHHHHHHHGGGCBTTTEECCBCTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcCCCCCCcceEEecCCCCCCHHHHHHHHHHHHHHHHHhcCCCCCccCCcCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCCcCCceeecccccCCCcCCCCChhHHHHHHHHHHHHHHhCCCCCCceEEEEeccHHHHHHHHHHHHCCCEEEEEE
Q psy8192         175 STKKNYTIPGIVTGKPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQ  254 (428)
Q Consensus       175 ~~~~g~~~~~~vtGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~GakvVaVs  254 (428)
                      ++++|+++++++||||+.+|||.+|.++|||||+++++++++++|.+++|+||+||||||||+++|++|++.|+|||+||
T Consensus       172 ~~~~g~~~~~~vTGkp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaVqG~GnVG~~aa~~l~e~GakVVavs  251 (424)
T 3k92_A          172 SRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGIS  251 (424)
T ss_dssp             HHHHTSCCGGGCSSCCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCGGGCEEEEECCSHHHHHHHHHHHHHTCEEEEEE
T ss_pred             HHHhCCCCcceeecccccCCCcCCCcccHHHHHHHHHHHHHHHcCCCcccCEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Confidence            99999988999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCeeeCCCCCCHHHHHHHHHhcCCCcCCCCceeccCCCcccccCceEEecccccccccccccccccceEEEecCCCCC
Q psy8192         255 DDKTTIYNPNGFNIPKLQKYVTFTRSIKDFNEGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVTAKIILEGANGPT  334 (428)
Q Consensus       255 D~~G~i~n~~GlD~~~l~~~~~~~g~l~~~~~~~~i~~~~~il~~~~DIliPaA~~~~It~~na~~l~akiIvegAN~p~  334 (428)
                      |++|+||||+|||+++|+++++++|++.+|+ ++.++ ++++|+.+||||+|||++|+||.+||++|+||+|+||||+|+
T Consensus       252 D~~G~iyd~~GlD~~~l~~~~~~~g~i~~~~-a~~~~-~~~i~~~~~DIliPcA~~n~I~~~~a~~l~ak~V~EgAN~p~  329 (424)
T 3k92_A          252 DANGGLYNPDGLDIPYLLDKRDSFGMVTNLF-TDVIT-NEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPT  329 (424)
T ss_dssp             CSSCEEECTTCCCHHHHHHHCCSSSCCGGGC-SCCBC-HHHHHHSCCSEEEECSCSSCBCTTTGGGCCCSEEECCSSSCB
T ss_pred             CCCCcEECCCCCCHHHHHHHHHHhCCCCCCC-cEEec-CccceeccccEEeecCcccccChhhHhhcCceEEEcCCCCCC
Confidence            9999999999999999999999999999998 77777 889999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHCCCceeccccccccchhhhHHHHHhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHH
Q psy8192         335 TTEADDILRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKVSLRTAAFII  414 (428)
Q Consensus       335 t~ea~~iL~~rGI~viPD~laNaGGVi~s~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~~~r~aA~~~  414 (428)
                      ||+|+++|++|||+|+||+++|||||++|||||+||+++++|++|+|+++|+++|.++|++|+++|+++++++|+|||++
T Consensus       330 t~eA~~iL~~rGI~~~PD~~aNAGGV~vS~~E~~qn~~~~~w~~eeV~~~l~~~m~~~~~~v~~~a~~~~~~~~~aA~~~  409 (424)
T 3k92_A          330 TIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMT  409 (424)
T ss_dssp             CHHHHHHHHHTTCEEECHHHHTTHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             CHHHHHHHHHCCCEEECchHhcCCCEEeehhHHHhcccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHhCcCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCC
Q psy8192         415 GCTRVLQAHKTRGL  428 (428)
Q Consensus       415 a~~rv~~a~~~rG~  428 (428)
                      |++||+++|+.|||
T Consensus       410 a~~rva~a~~~~G~  423 (424)
T 3k92_A          410 GIRKSAEASRFRGW  423 (424)
T ss_dssp             HHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHcCC
Confidence            99999999999996



>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 428
d1b26a2175 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermo 1e-64
d1bgva1255 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clost 2e-64
d1gtma2178 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archae 6e-64
d1b26a1234 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Therm 1e-62
d1v9la2176 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyroba 2e-62
d1gtma1239 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archa 9e-61
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 3e-59
d1v9la1242 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrob 7e-59
d1hwxa2208 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (B 2e-57
d1bgva2194 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostr 2e-52
d1leha1230 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillu 3e-51
d1leha2134 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus 5e-37
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 2e-36
d1c1da2148 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rh 3e-34
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 175 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Aminoacid dehydrogenases
domain: Glutamate dehydrogenase
species: Thermotoga maritima [TaxId: 2336]
 Score =  203 bits (517), Expect = 1e-64
 Identities = 89/173 (51%), Positives = 124/173 (71%)

Query: 21  WGVYLQQIDRVTPYLGSLSRWIEILKHPKKILIVDVPIEHDNGEVFHYEGYRVQHNILRG 80
           + + ++Q +R    +   S   E+L+ PK++LIV+ P+  D+G V  + GYRVQHN+ RG
Sbjct: 3   YEMAVEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARG 62

Query: 81  PGKGGVRFHPDVTLSEIIALSGWMTIKNAAVNIPYGGAKGGIRVNPKNLSNNELMRLTRR 140
           P KGG+R+HPDVTL E+ AL+ WMT K A +N+P+GG KGG+RV+PK LS NEL RL+RR
Sbjct: 63  PAKGGIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRR 122

Query: 141 YTNEISSIIGLNKDIPAPDVGTDMQIMSWMMDTYSTKKNYTIPGIVTGKPISI 193
           + +EI  IIG   DIPAPDV T+  +++W MDTYS    +T+ GIVTGKP+ +
Sbjct: 123 FFSEIQVIIGPYNDIPAPDVNTNADVIAWYMDTYSMNVGHTVLGIVTGKPVEL 175


>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 255 Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 178 Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 176 Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 239 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Length = 242 Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 208 Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Length = 194 Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 230 Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Length = 134 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 148 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query428
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1b26a2175 Glutamate dehydrogenase {Thermotoga maritima [TaxI 100.0
d1gtma2178 Glutamate dehydrogenase {Archaeon Pyrococcus furio 100.0
d1v9la2176 Glutamate dehydrogenase {Pyrobaculum islandicum [T 100.0
d1hwxa2208 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 100.0
d1bgva2194 Glutamate dehydrogenase {Clostridium symbiosum [Ta 100.0
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1c1da2148 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 100.0
d1leha2134 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.2
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 98.09
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.06
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.02
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.62
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.57
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.53
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.4
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.35
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.32
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.26
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.26
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.24
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.17
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.16
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.15
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.14
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 97.14
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.11
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.94
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.93
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 96.78
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.73
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.7
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.69
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.68
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.67
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.56
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.48
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.44
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.41
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.41
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.33
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.25
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.13
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.12
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.09
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.0
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.93
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.88
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.88
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.8
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 95.73
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.73
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 95.73
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 95.69
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.57
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.49
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.07
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.06
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 95.02
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.92
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.91
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.91
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.87
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.81
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.73
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.65
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.62
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.6
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.6
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.53
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.5
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.36
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.04
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.92
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.92
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.87
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.74
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 93.62
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 93.6
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 93.6
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.55
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.47
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.38
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 93.36
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.34
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 93.31
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 93.31
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.27
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.25
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.17
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 93.15
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.14
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 93.09
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.08
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.07
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.04
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.04
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.99
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.97
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 92.97
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.97
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.95
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.9
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.82
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.78
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.72
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.71
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.68
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 92.67
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 92.52
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 92.47
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.37
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.29
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.21
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.14
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.09
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.08
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.03
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 91.96
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 91.93
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 91.85
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.82
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.81
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 91.7
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.7
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.61
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 91.6
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.57
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 91.51
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 91.4
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 91.39
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.37
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.36
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.32
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.27
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.25
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.12
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 91.03
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 91.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 90.95
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 90.9
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.84
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.79
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 90.73
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 90.71
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 90.65
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 90.62
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.55
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 90.48
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.48
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 90.47
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.43
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 90.36
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.35
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 90.34
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 90.28
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.24
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.21
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 90.09
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 90.07
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 90.04
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 89.97
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.89
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 89.82
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 89.65
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.59
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 89.56
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 89.5
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 89.29
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.26
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 88.93
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.82
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 88.82
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 88.8
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 88.78
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 88.74
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 88.67
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.64
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 88.56
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 88.41
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 88.32
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 88.24
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.16
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.92
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 87.77
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.56
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 87.07
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 87.06
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 86.98
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.86
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.84
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 86.84
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 86.74
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 86.72
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 86.5
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 86.34
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 86.28
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.24
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 86.18
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 86.15
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 86.13
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 85.95
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.76
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 85.68
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 85.65
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 85.64
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 85.61
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 85.59
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.47
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 85.02
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 84.87
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 84.86
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 84.82
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 84.79
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 84.78
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 84.67
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 84.5
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 84.5
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 84.32
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 84.14
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.69
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.66
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 83.61
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 83.58
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 83.51
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 83.15
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 83.1
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.95
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 82.71
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 82.5
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 82.49
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 82.39
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 82.34
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.31
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 82.27
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 82.09
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 82.0
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 81.36
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 81.13
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 80.88
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 80.85
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 80.83
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 80.8
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 80.75
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 80.44
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 80.44
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 80.02
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Glutamate dehydrogenase
species: Clostridium symbiosum [TaxId: 1512]
Probab=100.00  E-value=4.5e-70  Score=526.79  Aligned_cols=239  Identities=29%  Similarity=0.479  Sum_probs=225.3

Q ss_pred             ccccCCCcCCCCChhHHHHHHHHHHHHHHhCCCCCCceEEEEeccHHHHHHHHHHHHCCCEEEEEEcCCCeeeCCCCCCH
Q psy8192         189 KPISIGGSFGRQKATGRGVFIIGSKIASKINLNIINSKISIQGFGNVGSVAANLFFKAGAKIVAIQDDKTTIYNPNGFNI  268 (428)
Q Consensus       189 kp~~~GGs~~r~~aTg~Gv~~~~~~~~~~~g~~l~g~~vaIqGfGnVG~~~a~~L~~~GakvVaVsD~~G~i~n~~GlD~  268 (428)
                      ||+++|||.||.+||||||++++++++++++.+|+|+||+||||||||+++|++|++.|++||+|||++|+||||+|||+
T Consensus         1 Kp~~~GGs~gR~eATG~Gv~~~~~~~~~~~~~~l~g~~v~IQGfGnVG~~~a~~L~e~GakvvavsD~~G~i~~~~Gld~   80 (255)
T d1bgva1           1 KARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGAKAVTLSGPDGYIYDPEGITT   80 (255)
T ss_dssp             CCGGGTCCTTTTTHHHHHHHHHHHHHHHHTTCCSTTCEEEECCSSHHHHHHHHHHHHHTCEEEEEEETTEEEECTTCSCS
T ss_pred             CCccccCCCCCCccchHHHHHHHHHHHHhCCCCCCCCEEEEECCCHHHHHHHHHHHHcCCeEEEEecCCceEecCCCCCH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHh-----cCCCcCCC---CceeccCCCcccccCceEEeccccccccccccccccc---ceEEEecCCCCCCHH
Q psy8192         269 PKLQKYVTF-----TRSIKDFN---EGEKINDSKEFWSIPCDILIPAAIEDQITINNANNVT---AKIILEGANGPTTTE  337 (428)
Q Consensus       269 ~~l~~~~~~-----~g~l~~~~---~~~~i~~~~~il~~~~DIliPaA~~~~It~~na~~l~---akiIvegAN~p~t~e  337 (428)
                      ++++++..+     .+++.+|.   +.+.++ ++++|+.+||||+|||++++||++|+++|+   ||+|+||||+|+||+
T Consensus        81 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~DiliPcA~~~~I~~~~a~~l~a~~ck~I~EgAN~p~t~e  159 (255)
T d1bgva1          81 EEKINYMLEMRASGRNKVQDYADKFGVQFFP-GEKPWGQKVDIIMPCATQNDVDLEQAKKIVANNVKYYIEVANMPTTNE  159 (255)
T ss_dssp             HHHHHHHHHHHHHCCCCTHHHHHHHTCEEEE-TCCGGGSCCSEEECCSCTTCBCHHHHHHHHHTTCCEEECCSSSCBCHH
T ss_pred             HHHHHHHHHHhhhcCcchhhhhhhcCceeec-hhhcccccccEEeeccccccccHHHHHhhhhcCceEEecCCCCCcchH
Confidence            999988653     34454442   456777 899999999999999999999999999996   799999999999999


Q ss_pred             HHHH-HHHCCCceeccccccccchhhhHHHHHhhcccCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCC--CHHHHHHHH
Q psy8192         338 ADDI-LRDKGIILAPDVITNAGGVIVSYFEWVQNLSNLLWTEQEINLRLNNIICNAFDAIWELANTKKV--SLRTAAFII  414 (428)
Q Consensus       338 a~~i-L~~rGI~viPD~laNaGGVi~s~~E~~qn~~~~~w~~e~v~~~l~~~m~~~~~~v~~~a~~~~~--~~r~aA~~~  414 (428)
                      |+++ |++|||+|+||+++|||||++|||||+||+++++|++++|.++|+++|.++|++++++++++++  ++|+|||++
T Consensus       160 a~~~ll~~~gI~vvPD~laNaGGVivSy~E~~qn~~~~~w~~~ev~~~l~~~m~~~~~~v~~~a~~~~~~~~lr~aA~~~  239 (255)
T d1bgva1         160 ALRFLMQQPNMVVAPSKAVNAGGVLVSGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLGYNLVAGANIV  239 (255)
T ss_dssp             HHHHHHHCTTCEEECHHHHTTHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSCHHHHHHHH
T ss_pred             HHHHHHHhcCCEEehHhhhcCCceeeehhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHH
Confidence            9876 5679999999999999999999999999999999999999999999999999999999999998  899999999


Q ss_pred             HHHHHHHHHHHcCC
Q psy8192         415 GCTRVLQAHKTRGL  428 (428)
Q Consensus       415 a~~rv~~a~~~rG~  428 (428)
                      |++||++||+.||+
T Consensus       240 a~~Rva~A~~~rG~  253 (255)
T d1bgva1         240 GFQKIADAMMAQGI  253 (255)
T ss_dssp             HHHHHHHHHHHHCS
T ss_pred             HHHHHHHHHHHcCC
Confidence            99999999999995



>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b26a2 c.58.1.1 (A:4-178) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtma2 c.58.1.1 (A:3-180) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la2 c.58.1.1 (A:4-179) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa2 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bgva2 c.58.1.1 (A:1-194) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1c1da2 c.58.1.1 (A:1-148) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1leha2 c.58.1.1 (A:1-134) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure