BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy8200
         (530 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EH8|A Chain A, Crystal Structure Of Y2 I-Anii Variant (F13yS111Y)DNA
           COMPLEX WITH Calcium
 pdb|3EH8|D Chain D, Crystal Structure Of Y2 I-Anii Variant (F13yS111Y)DNA
           COMPLEX WITH Calcium
 pdb|3EH8|G Chain G, Crystal Structure Of Y2 I-Anii Variant (F13yS111Y)DNA
           COMPLEX WITH Calcium
          Length = 254

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 149 VEAPYLIKKIIGVDFVYFLQRNELDWRNRTLEIESKNETFSNRVIVLEKCRYFVHPE 205
           V+  Y IKKI+G+  V F +RNE++     L I  KN   S  + + EK   F + +
Sbjct: 41  VQLIYKIKKILGIGIVSFRKRNEIEM--VALRIRDKNHLKSKILPIFEKYPMFSNKQ 95


>pdb|1P8K|Z Chain Z, The Structure And Dna Recognition Of A Bifunctional Homing
           Endonuclease And Group I Intron Splicing Factor
 pdb|2QOJ|Z Chain Z, Coevolution Of A Homing Endonuclease And Its Host Target
           Sequence
          Length = 254

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 149 VEAPYLIKKIIGVDFVYFLQRNELDWRNRTLEIESKNETFSNRVIVLEKCRYFVHPE 205
           V+  Y IKKI+G+  V F +RNE++     L I  KN   S  + + EK   F + +
Sbjct: 41  VQLIYKIKKILGIGIVSFRKRNEIE--XVALRIRDKNHLKSFILPIFEKYPXFSNKQ 95


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,571,668
Number of Sequences: 62578
Number of extensions: 680879
Number of successful extensions: 1575
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1567
Number of HSP's gapped (non-prelim): 9
length of query: 530
length of database: 14,973,337
effective HSP length: 103
effective length of query: 427
effective length of database: 8,527,803
effective search space: 3641371881
effective search space used: 3641371881
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)