Query         psy822
Match_columns 190
No_of_seqs    155 out of 525
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 21:43:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy822.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/822hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3183|consensus              100.0 8.7E-44 1.9E-48  305.1   1.6  161    1-161     2-168 (250)
  2 PF01428 zf-AN1:  AN1-like Zinc  99.3 9.8E-13 2.1E-17   86.0   2.4   41   10-50      1-41  (43)
  3 PF01428 zf-AN1:  AN1-like Zinc  99.2 3.4E-12 7.4E-17   83.4   2.1   40  100-139     1-40  (43)
  4 smart00154 ZnF_AN1 AN1-like Zi  99.2 1.2E-11 2.7E-16   79.7   2.7   34   14-47      3-37  (39)
  5 smart00154 ZnF_AN1 AN1-like Zi  98.9 5.6E-10 1.2E-14   72.0   2.5   33  105-137     4-37  (39)
  6 KOG3183|consensus               97.8   6E-06 1.3E-10   72.1   1.1   41   97-137     8-48  (250)
  7 COG3582 Predicted nucleic acid  97.8 1.4E-05 2.9E-10   66.2   2.6  132   14-152     5-150 (162)
  8 KOG3173|consensus               97.3 0.00025 5.5E-09   58.8   3.4   51   97-150   105-156 (167)
  9 COG3582 Predicted nucleic acid  94.6   0.018 3.8E-07   47.9   1.6   38   14-51    102-139 (162)
 10 KOG3173|consensus               93.3   0.043 9.4E-07   45.5   1.5   31   16-47    113-143 (167)
 11 PF04236 Transp_Tc5_C:  Tc5 tra  88.5    0.39 8.5E-06   34.1   2.3   39    4-44     24-63  (63)
 12 PF04236 Transp_Tc5_C:  Tc5 tra  87.0    0.38 8.2E-06   34.1   1.5   36   97-134    27-63  (63)
 13 smart00734 ZnF_Rad18 Rad18-lik  82.6    0.42 9.1E-06   28.1   0.1   20   55-81      2-21  (26)
 14 PF13465 zf-H2C2_2:  Zinc-finge  77.5    0.93   2E-05   26.2   0.4   12   21-32     13-24  (26)
 15 PF13912 zf-C2H2_6:  C2H2-type   74.8     1.2 2.6E-05   25.2   0.4   12   22-33      1-12  (27)
 16 PF05605 zf-Di19:  Drought indu  71.7     2.1 4.6E-05   28.5   1.1   34   23-63      3-40  (54)
 17 PF01485 IBR:  IBR domain;  Int  71.4     3.3 7.2E-05   27.3   2.0   33   98-130    19-58  (64)
 18 KOG1813|consensus               70.8     2.1 4.4E-05   39.1   1.1   49   17-65    236-286 (313)
 19 PRK00398 rpoP DNA-directed RNA  60.4     7.1 0.00015   25.2   1.9   34   21-68      2-35  (46)
 20 smart00647 IBR In Between Ring  58.9     7.1 0.00015   25.7   1.8   33   98-130    19-58  (64)
 21 PF06524 NOA36:  NOA36 protein;  55.1     6.7 0.00015   35.5   1.4   52   14-70    163-225 (314)
 22 PF07975 C1_4:  TFIIH C1-like d  53.4     5.3 0.00011   27.3   0.4   26   20-45     19-47  (51)
 23 PF00096 zf-C2H2:  Zinc finger,  52.2     5.8 0.00013   21.4   0.4    8   57-64      3-10  (23)
 24 PF06006 DUF905:  Bacterial pro  52.0      25 0.00054   25.6   3.7   37  142-186    10-46  (70)
 25 PF09723 Zn-ribbon_8:  Zinc rib  51.3      10 0.00022   24.3   1.4   30   22-62      5-34  (42)
 26 PLN03086 PRLI-interacting fact  49.2     9.2  0.0002   37.6   1.4   11   22-32    453-463 (567)
 27 PHA00616 hypothetical protein   49.0     5.4 0.00012   26.5  -0.1   12   22-33      1-12  (44)
 28 PF13717 zinc_ribbon_4:  zinc-r  47.3     8.5 0.00019   24.0   0.6   16   55-70      3-18  (36)
 29 PF13894 zf-C2H2_4:  C2H2-type   45.3     9.5 0.00021   20.0   0.5    8   57-64      3-10  (24)
 30 KOG2462|consensus               45.2     9.5 0.00021   34.4   0.8   60   21-86    186-269 (279)
 31 PF13719 zinc_ribbon_5:  zinc-r  43.7     9.5 0.00021   23.8   0.4   16   55-70      3-18  (37)
 32 smart00834 CxxC_CXXC_SSSS Puta  43.6      17 0.00037   22.2   1.6   31   23-64      6-36  (41)
 33 TIGR00599 rad18 DNA repair pro  42.8      11 0.00023   35.6   0.7   26   55-87    182-207 (397)
 34 PF14169 YdjO:  Cold-inducible   42.4      15 0.00032   25.9   1.3   16   52-67     37-52  (59)
 35 PHA02768 hypothetical protein;  41.8      11 0.00024   26.1   0.5   13   20-32      3-15  (55)
 36 PF14634 zf-RING_5:  zinc-RING   40.3      12 0.00027   23.7   0.6   31   22-62     14-44  (44)
 37 KOG1701|consensus               38.6      18 0.00038   34.8   1.5   47   18-76    370-416 (468)
 38 PRK00415 rps27e 30S ribosomal   38.3      20 0.00044   25.2   1.4   42   18-72      7-48  (59)
 39 TIGR02098 MJ0042_CXXC MJ0042 f  37.7      15 0.00033   22.5   0.7   34   23-65      3-36  (38)
 40 KOG4739|consensus               35.9      23  0.0005   31.2   1.7   37   20-68     15-51  (233)
 41 TIGR02605 CxxC_CxxC_SSSS putat  34.6      27 0.00058   22.7   1.5   29   23-62      6-34  (52)
 42 COG5222 Uncharacterized conser  33.9      19 0.00042   33.3   1.0   63    1-74    268-330 (427)
 43 COG2051 RPS27A Ribosomal prote  32.3      23  0.0005   25.6   0.9   42   18-72     15-56  (67)
 44 PF04423 Rad50_zn_hook:  Rad50   30.0      18 0.00038   24.1   0.0   10   56-65     22-31  (54)
 45 PF09538 FYDLN_acid:  Protein o  28.5      40 0.00086   26.1   1.8   26   98-125    10-39  (108)
 46 PHA02565 49 recombination endo  27.8      37 0.00079   28.3   1.6   39   24-66     22-67  (157)
 47 smart00355 ZnF_C2H2 zinc finge  27.4      25 0.00054   18.3   0.4    6   57-62      3-8   (26)
 48 PF02176 zf-TRAF:  TRAF-type zi  27.3      16 0.00036   24.0  -0.5   26   54-86      9-36  (60)
 49 PF11290 DUF3090:  Protein of u  26.3      33 0.00072   28.9   1.0   11   54-64    154-164 (171)
 50 PRK00418 DNA gyrase inhibitor;  26.2      50  0.0011   23.5   1.8   14   53-66      5-18  (62)
 51 PF10571 UPF0547:  Uncharacteri  25.9      51  0.0011   19.3   1.5   18  105-122     6-24  (26)
 52 PF04438 zf-HIT:  HIT zinc fing  25.0      39 0.00084   20.4   0.9   19   14-34      7-25  (30)
 53 PF12230 PRP21_like_P:  Pre-mRN  24.6      25 0.00054   29.8   0.0   23   53-82    167-189 (229)
 54 smart00451 ZnF_U1 U1-like zinc  24.1      36 0.00077   19.9   0.6    8   57-64      6-13  (35)
 55 PF13913 zf-C2HC_2:  zinc-finge  24.0      34 0.00073   19.6   0.5   10  113-122     3-12  (25)
 56 COG3024 Uncharacterized protei  23.9      44 0.00096   24.0   1.2   17   51-67      4-20  (65)
 57 TIGR03847 conserved hypothetic  23.8      39 0.00085   28.7   1.0   11   54-64    156-166 (177)
 58 COG0846 SIR2 NAD-dependent pro  23.5      52  0.0011   29.0   1.8   38   18-63    118-155 (250)
 59 KOG2462|consensus               22.5      38 0.00083   30.6   0.8   25   22-46    215-248 (279)
 60 cd00065 FYVE FYVE domain; Zinc  22.4      52  0.0011   21.3   1.3   25   14-38      7-34  (57)
 61 PLN00209 ribosomal protein S27  22.4      52  0.0011   24.9   1.4   41   19-72     33-73  (86)
 62 PF12171 zf-C2H2_jaz:  Zinc-fin  21.8      46   0.001   18.8   0.8   21   56-82      3-23  (27)
 63 COG1996 RPC10 DNA-directed RNA  21.7      50  0.0011   22.4   1.1   33   21-67      5-37  (49)
 64 PTZ00083 40S ribosomal protein  21.5      56  0.0012   24.7   1.4   41   19-72     32-72  (85)
 65 TIGR02174 CXXU_selWTH selT/sel  21.5      84  0.0018   22.1   2.3   27  151-188    29-55  (72)
 66 PRK03824 hypA hydrogenase nick  21.1      77  0.0017   25.1   2.2   48   21-71     69-125 (135)
 67 PHA00732 hypothetical protein   20.9      41 0.00089   24.5   0.5   12   22-33      1-12  (79)
 68 PF13842 Tnp_zf-ribbon_2:  DDE_  20.9      69  0.0015   19.5   1.5   16  111-126    15-30  (32)
 69 cd00350 rubredoxin_like Rubred  20.8      89  0.0019   18.8   2.0    8   55-62     18-25  (33)
 70 TIGR00595 priA primosomal prot  20.8      76  0.0016   30.4   2.5   22   98-121   241-262 (505)
 71 PF02891 zf-MIZ:  MIZ/SP-RING z  20.1      20 0.00044   23.8  -1.1    9   55-63     42-50  (50)
 72 TIGR00622 ssl1 transcription f  20.0      57  0.0012   25.7   1.2   15   22-36     81-95  (112)

No 1  
>KOG3183|consensus
Probab=100.00  E-value=8.7e-44  Score=305.14  Aligned_cols=161  Identities=50%  Similarity=0.987  Sum_probs=142.4

Q ss_pred             CCCCCCCCCCCcCCCCCccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCcchhhcccc
Q psy822            1 MEFPHLGKHCSIETCKKLDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELPDFAVGLHI   80 (190)
Q Consensus         1 MEf~diG~hC~~~~C~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~pn~~v~~Hi   80 (190)
                      |||||||+||++++|+|||||||+|+.|+..||+|||++++|.|+.+...|++|++||+|++||++.+++.++.+|+.|+
T Consensus         2 ~efpDlGkHCs~~~CkqlDFLPf~Cd~C~~~FC~eHrsye~H~Cp~~~~~~~~v~icp~cs~pv~~~~de~~~~~v~~h~   81 (250)
T KOG3183|consen    2 MEFPDLGKHCSVPYCKQLDFLPFKCDGCSGIFCLEHRSYESHHCPKGLRIDVQVPICPLCSKPVPTKKDEAPDKVVEPHI   81 (250)
T ss_pred             CcccccccccCcchhhhccccceeeCCccchhhhccchHhhcCCCcccccceeecccCCCCCCCCCCCCcchhhhhchhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCchHHhhhccccCCCcCCCCCcCccCc--ccCcccCccccccCcCCCCCCCCc-cchHHHHHHHHH---hhhhhh
Q psy822           81 DNNCDSDTAQERRKIFTNKCSVKNCKGKELIP--VKCYQCAMNFCLKHRHPNDHKCEG-QKNAARNKALLK---MKLWHE  154 (190)
Q Consensus        81 ~~~C~~~~~~kk~k~~~~~Cs~~~Ck~~~~~~--~~C~~C~~~FClkHR~p~dH~C~~-~~~~~~~~a~~k---~~~w~~  154 (190)
                      +++|+..+..+++++++++|+.++|++++.+.  |.|.+|+.+||++||++.||.|.. ++.+...+.+++   +..|+.
T Consensus        82 ~~dC~~~~~~~~~k~~t~kc~~~~c~k~~~~~~~~~c~~c~~~~c~khr~~~dhsc~~~~~~~k~~a~~~~~~~~q~~~~  161 (250)
T KOG3183|consen   82 SNDCDRHPEQKKRKVFTNKCPVPRCKKTLTLANKITCSKCGRNFCLKHRHPLDHSCNKQLGNLKKKAGGDKIGPMQNRIY  161 (250)
T ss_pred             ccccccCchhhhcccccccCCchhhHHHHHHHHhhhhHhhcchhhhhccCCCCchhhhhccCccccccccccccccceee
Confidence            99999988887888999999999999998766  999999999999999999999993 443322333333   345555


Q ss_pred             hcccccc
Q psy822          155 LSNYQCK  161 (190)
Q Consensus       155 ~~~~~~~  161 (190)
                      --+|..+
T Consensus       162 ~~~~~~~  168 (250)
T KOG3183|consen  162 IWTYLSS  168 (250)
T ss_pred             eeEeecC
Confidence            5555544


No 2  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.30  E-value=9.8e-13  Score=85.98  Aligned_cols=41  Identities=44%  Similarity=0.899  Sum_probs=31.3

Q ss_pred             CCcCCCCCccccceeccccccccccCCCCCCCccCCccccc
Q psy822           10 CSIETCKKLDFLPVKCDACLEMFCSDHMSYVGHQCKSAARK   50 (190)
Q Consensus        10 C~~~~C~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~   50 (190)
                      |++++|+++|||||+|+.|++.||.+||.+++|+|++...+
T Consensus         1 C~~~~C~~~~~~~~~C~~C~~~FC~~Hr~~e~H~C~~~~~~   41 (43)
T PF01428_consen    1 CSFPGCKKKDFLPFKCKHCGKSFCLKHRLPEDHNCSKLQKK   41 (43)
T ss_dssp             -SSTTT--BCTSHEE-TTTS-EE-TTTHSTTTCT-SSTTSC
T ss_pred             CccCcCcCccCCCeECCCCCcccCccccCccccCCcchhhc
Confidence            78899999999999999999999999999999999976543


No 3  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.23  E-value=3.4e-12  Score=83.42  Aligned_cols=40  Identities=48%  Similarity=1.138  Sum_probs=30.7

Q ss_pred             CcCCCCCcCccCcccCcccCccccccCcCCCCCCCCccch
Q psy822          100 CSVKNCKGKELIPVKCYQCAMNFCLKHRHPNDHKCEGQKN  139 (190)
Q Consensus       100 Cs~~~Ck~~~~~~~~C~~C~~~FClkHR~p~dH~C~~~~~  139 (190)
                      |++++|++++++++.|+.|++.||++||+|++|.|.....
T Consensus         1 C~~~~C~~~~~~~~~C~~C~~~FC~~Hr~~e~H~C~~~~~   40 (43)
T PF01428_consen    1 CSFPGCKKKDFLPFKCKHCGKSFCLKHRLPEDHNCSKLQK   40 (43)
T ss_dssp             -SSTTT--BCTSHEE-TTTS-EE-TTTHSTTTCT-SSTTS
T ss_pred             CccCcCcCccCCCeECCCCCcccCccccCccccCCcchhh
Confidence            7889999999999999999999999999999999998654


No 4  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=99.18  E-value=1.2e-11  Score=79.73  Aligned_cols=34  Identities=32%  Similarity=0.674  Sum_probs=32.5

Q ss_pred             CCCCcccc-ceeccccccccccCCCCCCCccCCcc
Q psy822           14 TCKKLDFL-PVKCDACLEMFCSDHMSYVGHQCKSA   47 (190)
Q Consensus        14 ~C~qlDFL-Pf~C~~C~~~FC~eHr~~~~H~C~~~   47 (190)
                      .|+++||| ||+|++|++.||++||.+++|+|+..
T Consensus         3 ~C~~~~~l~~f~C~~C~~~FC~~HR~~e~H~C~~~   37 (39)
T smart00154        3 FCRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGD   37 (39)
T ss_pred             ccCCcccccCeECCccCCccccccCCccccCCccc
Confidence            69999999 99999999999999999999999864


No 5  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=98.93  E-value=5.6e-10  Score=72.00  Aligned_cols=33  Identities=42%  Similarity=0.954  Sum_probs=31.1

Q ss_pred             CCcCccC-cccCcccCccccccCcCCCCCCCCcc
Q psy822          105 CKGKELI-PVKCYQCAMNFCLKHRHPNDHKCEGQ  137 (190)
Q Consensus       105 Ck~~~~~-~~~C~~C~~~FClkHR~p~dH~C~~~  137 (190)
                      |++++.+ +++|+.|++.||++||+|++|+|+.+
T Consensus         4 C~~~~~l~~f~C~~C~~~FC~~HR~~e~H~C~~~   37 (39)
T smart00154        4 CRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGD   37 (39)
T ss_pred             cCCcccccCeECCccCCccccccCCccccCCccc
Confidence            8999888 99999999999999999999999865


No 6  
>KOG3183|consensus
Probab=97.82  E-value=6e-06  Score=72.08  Aligned_cols=41  Identities=39%  Similarity=0.873  Sum_probs=38.5

Q ss_pred             cCCCcCCCCCcCccCcccCcccCccccccCcCCCCCCCCcc
Q psy822           97 TNKCSVKNCKGKELIPVKCYQCAMNFCLKHRHPNDHKCEGQ  137 (190)
Q Consensus        97 ~~~Cs~~~Ck~~~~~~~~C~~C~~~FClkHR~p~dH~C~~~  137 (190)
                      ...|+.+.|++.+++||+|..|+..||+.||.-++|+|...
T Consensus         8 GkHCs~~~CkqlDFLPf~Cd~C~~~FC~eHrsye~H~Cp~~   48 (250)
T KOG3183|consen    8 GKHCSVPYCKQLDFLPFKCDGCSGIFCLEHRSYESHHCPKG   48 (250)
T ss_pred             ccccCcchhhhccccceeeCCccchhhhccchHhhcCCCcc
Confidence            35899999999999999999999999999999999999875


No 7  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=97.79  E-value=1.4e-05  Score=66.25  Aligned_cols=132  Identities=17%  Similarity=0.244  Sum_probs=72.0

Q ss_pred             CCCCccccceeccccccccccCCCCCCCccCCcccc-cccccc---cCCCCCCCccCCCCCCcchhhcccccCCCCC---
Q psy822           14 TCKKLDFLPVKCDACLEMFCSDHMSYVGHQCKSAAR-KDIQVP---VCPLCNQPVPTKRGELPDFAVGLHIDNNCDS---   86 (190)
Q Consensus        14 ~C~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~-~d~~v~---~CPlC~~~V~~~~g~~pn~~v~~Hi~~~C~~---   86 (190)
                      ++....=||++|+.+.+.|+.+|+..-.|.++.... +|+.-+   -=-.+.+-+++-.  .....++.+   ++..   
T Consensus         5 s~~~~~~lP~r~~~~~kv~s~~~~~~~~~~f~~~i~~~~r~~i~k~~~~~~~~~~p~i~--~~~~~~~~~---~~~k~s~   79 (162)
T COG3582           5 SRVSETRLPSRGNITAKVSSTDNSLTLFSPFKLFIQLCDRKKIKKPDPGQAMKCLPLIS--SAVSNPSNT---DTPKRST   79 (162)
T ss_pred             ccceeccCCccccceeeeccCccccccccccchhhhhhhhhccccCCCcchhhhcceEE--EEeeccccc---cCccccc
Confidence            344455699999999999999999999999985310 110000   0000001111000  000001111   1110   


Q ss_pred             -----chHHhhhccccCCCcCCCCCcC-ccCcccCcccCccccccCcCCCCCCCCccchHHHHHH-HHHhhhh
Q psy822           87 -----DTAQERRKIFTNKCSVKNCKGK-ELIPVKCYQCAMNFCLKHRHPNDHKCEGQKNAARNKA-LLKMKLW  152 (190)
Q Consensus        87 -----~~~~kk~k~~~~~Cs~~~Ck~~-~~~~~~C~~C~~~FClkHR~p~dH~C~~~~~~~~~~a-~~k~~~w  152 (190)
                           .+...... ...+|....|..+ +.++..|+.|+..||..||+++.|+|..+.. .+... +.+..+|
T Consensus        80 ~~~~~~~~~~~~~-~t~~~a~~~~~g~~s~l~~~c~~c~g~fc~~h~lp~nhdc~~L~s-~r~~~~ip~~~~~  150 (162)
T COG3582          80 RVPLNGPFDSGKG-ITDRCATPQCTGKGSTLAGKCNYCTGYFCAEHRLPENHDCNGLGS-LRVTFVIPRNVIP  150 (162)
T ss_pred             ccccccccccccc-cceeeecceeccCCccccccccCCCCcceeceecccccccccHHH-hhhhcCCCCCcee
Confidence                 01000111 1236666555544 6678999999999999999999999988765 33332 4444444


No 8  
>KOG3173|consensus
Probab=97.25  E-value=0.00025  Score=58.78  Aligned_cols=51  Identities=31%  Similarity=0.696  Sum_probs=41.4

Q ss_pred             cCCCcCCCCCcC-ccCcccCcccCccccccCcCCCCCCCCccchHHHHHHHHHhh
Q psy822           97 TNKCSVKNCKGK-ELIPVKCYQCAMNFCLKHRHPNDHKCEGQKNAARNKALLKMK  150 (190)
Q Consensus        97 ~~~Cs~~~Ck~~-~~~~~~C~~C~~~FClkHR~p~dH~C~~~~~~~~~~a~~k~~  150 (190)
                      .++|-.  |+++ .+..|.| .|+..||..||+++.|+|.-......+.+|.|+.
T Consensus       105 ~~rC~~--C~kk~gltgf~C-rCG~~fC~~HRy~e~H~C~fDyK~~gr~~i~k~n  156 (167)
T KOG3173|consen  105 KKRCFK--CRKKVGLTGFKC-RCGNTFCGTHRYPEQHDCSFDYKQAGREKIAKAN  156 (167)
T ss_pred             chhhhh--hhhhhccccccc-ccCCcccccccCCccccccccHHHHHHHHHHHhC
Confidence            456776  6655 5567999 8999999999999999999988877777777753


No 9  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=94.59  E-value=0.018  Score=47.92  Aligned_cols=38  Identities=26%  Similarity=0.493  Sum_probs=33.7

Q ss_pred             CCCCccccceeccccccccccCCCCCCCccCCcccccc
Q psy822           14 TCKKLDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKD   51 (190)
Q Consensus        14 ~C~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d   51 (190)
                      .|+.---||++|++|+..||.+|+.++.|.|..+..+.
T Consensus       102 ~~g~~s~l~~~c~~c~g~fc~~h~lp~nhdc~~L~s~r  139 (162)
T COG3582         102 CTGKGSTLAGKCNYCTGYFCAEHRLPENHDCNGLGSLR  139 (162)
T ss_pred             eccCCccccccccCCCCcceeceecccccccccHHHhh
Confidence            56677889999999999999999999999999876653


No 10 
>KOG3173|consensus
Probab=93.28  E-value=0.043  Score=45.54  Aligned_cols=31  Identities=32%  Similarity=0.645  Sum_probs=26.9

Q ss_pred             CCccccceeccccccccccCCCCCCCccCCcc
Q psy822           16 KKLDFLPVKCDACLEMFCSDHMSYVGHQCKSA   47 (190)
Q Consensus        16 ~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~   47 (190)
                      .++....|.|. |+.+||..||.++.|.|.--
T Consensus       113 kk~gltgf~Cr-CG~~fC~~HRy~e~H~C~fD  143 (167)
T KOG3173|consen  113 KKVGLTGFKCR-CGNTFCGTHRYPEQHDCSFD  143 (167)
T ss_pred             hhhcccccccc-cCCcccccccCCcccccccc
Confidence            45667789997 99999999999999999843


No 11 
>PF04236 Transp_Tc5_C:  Tc5 transposase C-terminal domain;  InterPro: IPR007350 This domain corresponds to a C-terminal cysteine rich region that probably binds to a metal ion and could be DNA-binding. It is found in association with the DDE superfamily (IPR004875 from INTERPRO) and the Tc5 transposase family (IPR004906 from INTERPRO). More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=88.46  E-value=0.39  Score=34.07  Aligned_cols=39  Identities=26%  Similarity=0.751  Sum_probs=32.9

Q ss_pred             CCCCCCCCcCCCCCccccceeccccccccccCCCCC-CCccC
Q psy822            4 PHLGKHCSIETCKKLDFLPVKCDACLEMFCSDHMSY-VGHQC   44 (190)
Q Consensus         4 ~diG~hC~~~~C~qlDFLPf~C~~C~~~FC~eHr~~-~~H~C   44 (190)
                      .+....|..++|+.+-|  ++|.+|.+.+|-+|+-. +-|.|
T Consensus        24 ~~~~~~C~~~gC~~~s~--I~C~~Ckk~~Cf~Hfiv~~~H~C   63 (63)
T PF04236_consen   24 KNVAGDCDITGCNNTSF--IRCAYCKKSLCFNHFIVSEYHLC   63 (63)
T ss_pred             CCCcCcCCCCCCCCcCE--EEccccCCcccccceeeeeeEcC
Confidence            34556899899999998  58999999999999995 67776


No 12 
>PF04236 Transp_Tc5_C:  Tc5 transposase C-terminal domain;  InterPro: IPR007350 This domain corresponds to a C-terminal cysteine rich region that probably binds to a metal ion and could be DNA-binding. It is found in association with the DDE superfamily (IPR004875 from INTERPRO) and the Tc5 transposase family (IPR004906 from INTERPRO). More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=87.04  E-value=0.38  Score=34.14  Aligned_cols=36  Identities=22%  Similarity=0.784  Sum_probs=29.1

Q ss_pred             cCCCcCCCCCcCccCcccCcccCccccccCcCC-CCCCC
Q psy822           97 TNKCSVKNCKGKELIPVKCYQCAMNFCLKHRHP-NDHKC  134 (190)
Q Consensus        97 ~~~Cs~~~Ck~~~~~~~~C~~C~~~FClkHR~p-~dH~C  134 (190)
                      ...|...+|+...+  ++|..|++.+|.+|-+- +-|.|
T Consensus        27 ~~~C~~~gC~~~s~--I~C~~Ckk~~Cf~Hfiv~~~H~C   63 (63)
T PF04236_consen   27 AGDCDITGCNNTSF--IRCAYCKKSLCFNHFIVSEYHLC   63 (63)
T ss_pred             cCcCCCCCCCCcCE--EEccccCCcccccceeeeeeEcC
Confidence            45788899996554  59999999999999995 56665


No 13 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.61  E-value=0.42  Score=28.12  Aligned_cols=20  Identities=35%  Similarity=0.855  Sum_probs=15.0

Q ss_pred             ccCCCCCCCccCCCCCCcchhhccccc
Q psy822           55 PVCPLCNQPVPTKRGELPDFAVGLHID   81 (190)
Q Consensus        55 ~~CPlC~~~V~~~~g~~pn~~v~~Hi~   81 (190)
                      +.||+|++.|+       ...+++|+|
T Consensus         2 v~CPiC~~~v~-------~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREVP-------ENLINSHLD   21 (26)
T ss_pred             CcCCCCcCccc-------HHHHHHHHH
Confidence            46999999872       245778887


No 14 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=77.52  E-value=0.93  Score=26.18  Aligned_cols=12  Identities=42%  Similarity=0.836  Sum_probs=10.5

Q ss_pred             cceecccccccc
Q psy822           21 LPVKCDACLEMF   32 (190)
Q Consensus        21 LPf~C~~C~~~F   32 (190)
                      -||+|+.|++.|
T Consensus        13 k~~~C~~C~k~F   24 (26)
T PF13465_consen   13 KPYKCPYCGKSF   24 (26)
T ss_dssp             SSEEESSSSEEE
T ss_pred             CCCCCCCCcCee
Confidence            489999999987


No 15 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=74.75  E-value=1.2  Score=25.20  Aligned_cols=12  Identities=42%  Similarity=1.107  Sum_probs=9.5

Q ss_pred             ceeccccccccc
Q psy822           22 PVKCDACLEMFC   33 (190)
Q Consensus        22 Pf~C~~C~~~FC   33 (190)
                      ||+|+.|++.|-
T Consensus         1 ~~~C~~C~~~F~   12 (27)
T PF13912_consen    1 PFECDECGKTFS   12 (27)
T ss_dssp             SEEETTTTEEES
T ss_pred             CCCCCccCCccC
Confidence            688888888874


No 16 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=71.70  E-value=2.1  Score=28.53  Aligned_cols=34  Identities=26%  Similarity=0.669  Sum_probs=19.3

Q ss_pred             eecccccccccc----CCCCCCCccCCcccccccccccCCCCCCC
Q psy822           23 VKCDACLEMFCS----DHMSYVGHQCKSAARKDIQVPVCPLCNQP   63 (190)
Q Consensus        23 f~C~~C~~~FC~----eHr~~~~H~C~~~~~~d~~v~~CPlC~~~   63 (190)
                      |+|++|++.|=.    +|.. +.|.      .+....+||+|...
T Consensus         3 f~CP~C~~~~~~~~L~~H~~-~~H~------~~~~~v~CPiC~~~   40 (54)
T PF05605_consen    3 FTCPYCGKGFSESSLVEHCE-DEHR------SESKNVVCPICSSR   40 (54)
T ss_pred             cCCCCCCCccCHHHHHHHHH-hHCc------CCCCCccCCCchhh
Confidence            789998884311    1111 1111      23446899999973


No 17 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=71.36  E-value=3.3  Score=27.32  Aligned_cols=33  Identities=27%  Similarity=0.589  Sum_probs=21.7

Q ss_pred             CCCcCCCCCcCc-----cCc--ccCcccCccccccCcCCC
Q psy822           98 NKCSVKNCKGKE-----LIP--VKCYQCAMNFCLKHRHPN  130 (190)
Q Consensus        98 ~~Cs~~~Ck~~~-----~~~--~~C~~C~~~FClkHR~p~  130 (190)
                      ..|+.++|....     ...  +.|+.|+..||...+.+-
T Consensus        19 ~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~~   58 (64)
T PF01485_consen   19 RWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEPW   58 (64)
T ss_dssp             C--TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSES
T ss_pred             cCCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCccc
Confidence            378888888752     223  899999999999998754


No 18 
>KOG1813|consensus
Probab=70.76  E-value=2.1  Score=39.07  Aligned_cols=49  Identities=27%  Similarity=0.476  Sum_probs=30.8

Q ss_pred             CccccceeccccccccccCCCCC-CCccCCcccccccc-cccCCCCCCCcc
Q psy822           17 KLDFLPVKCDACLEMFCSDHMSY-VGHQCKSAARKDIQ-VPVCPLCNQPVP   65 (190)
Q Consensus        17 qlDFLPf~C~~C~~~FC~eHr~~-~~H~C~~~~~~d~~-v~~CPlC~~~V~   65 (190)
                      -++-|||.|..|.+.|=..=++- ..|-|.....+..+ .+.|++|++.+.
T Consensus       236 D~~~~Pf~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~  286 (313)
T KOG1813|consen  236 DIELLPFKCFICRKYFYRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTH  286 (313)
T ss_pred             CcccCCccccccccccccchhhcCCceeehhhhccccccCCcceecccccc
Confidence            35679999999999983322221 11225544344433 488999999765


No 19 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=60.40  E-value=7.1  Score=25.20  Aligned_cols=34  Identities=24%  Similarity=0.348  Sum_probs=21.5

Q ss_pred             cceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCC
Q psy822           21 LPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKR   68 (190)
Q Consensus        21 LPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~   68 (190)
                      +.|+|..|+..|=.+-.              .....||.|+.++.+..
T Consensus         2 ~~y~C~~CG~~~~~~~~--------------~~~~~Cp~CG~~~~~~~   35 (46)
T PRK00398          2 AEYKCARCGREVELDEY--------------GTGVRCPYCGYRILFKE   35 (46)
T ss_pred             CEEECCCCCCEEEECCC--------------CCceECCCCCCeEEEcc
Confidence            45778887765533221              12568999999887543


No 20 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=58.89  E-value=7.1  Score=25.75  Aligned_cols=33  Identities=24%  Similarity=0.699  Sum_probs=24.9

Q ss_pred             CCCcCCCCCcCc-------cCcccCcccCccccccCcCCC
Q psy822           98 NKCSVKNCKGKE-------LIPVKCYQCAMNFCLKHRHPN  130 (190)
Q Consensus        98 ~~Cs~~~Ck~~~-------~~~~~C~~C~~~FClkHR~p~  130 (190)
                      ..|+.++|....       ...+.|+.|+..||...+.+-
T Consensus        19 ~~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~fC~~C~~~~   58 (64)
T smart00647       19 KWCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVPW   58 (64)
T ss_pred             cCCCCCCCcceEEecCCCCCCeeECCCCCCeECCCCCCcC
Confidence            458877886641       235889999999999998763


No 21 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=55.09  E-value=6.7  Score=35.49  Aligned_cols=52  Identities=27%  Similarity=0.571  Sum_probs=31.9

Q ss_pred             CCCCccccceecccc-----------ccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCC
Q psy822           14 TCKKLDFLPVKCDAC-----------LEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGE   70 (190)
Q Consensus        14 ~C~qlDFLPf~C~~C-----------~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~   70 (190)
                      +|..|+-=-|+|..|           +--||.+|......    .+.+ .+++.||.|+-.+...++.
T Consensus       163 sCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~----ky~k-~k~~PCPKCg~et~eTkdL  225 (314)
T PF06524_consen  163 SCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGF----KYEK-GKPIPCPKCGYETQETKDL  225 (314)
T ss_pred             hhhhhhcccccccccccccchhhhheeeeehhhhhhhccc----cccc-CCCCCCCCCCCcccccccc
Confidence            444555555555544           45599999764431    1222 2688999999988755443


No 22 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=53.43  E-value=5.3  Score=27.28  Aligned_cols=26  Identities=27%  Similarity=0.617  Sum_probs=13.5

Q ss_pred             ccceeccccccccccCC---CCCCCccCC
Q psy822           20 FLPVKCDACLEMFCSDH---MSYVGHQCK   45 (190)
Q Consensus        20 FLPf~C~~C~~~FC~eH---r~~~~H~C~   45 (190)
                      -..|+|..|++.||.|=   ....-|+||
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH~CP   47 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLHNCP   47 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-SSS
T ss_pred             CCeEECCCCCCccccCcChhhhccccCCc
Confidence            36799999999999873   233466766


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=52.17  E-value=5.8  Score=21.40  Aligned_cols=8  Identities=38%  Similarity=1.489  Sum_probs=3.6

Q ss_pred             CCCCCCCc
Q psy822           57 CPLCNQPV   64 (190)
Q Consensus        57 CPlC~~~V   64 (190)
                      ||.|++..
T Consensus         3 C~~C~~~f   10 (23)
T PF00096_consen    3 CPICGKSF   10 (23)
T ss_dssp             ETTTTEEE
T ss_pred             CCCCCCcc
Confidence            44444433


No 24 
>PF06006 DUF905:  Bacterial protein of unknown function (DUF905);  InterPro: IPR009253 This family consists of several short hypothetical proteobacterial proteins of unknown function.; PDB: 2HJJ_A.
Probab=52.01  E-value=25  Score=25.65  Aligned_cols=37  Identities=22%  Similarity=0.392  Sum_probs=17.7

Q ss_pred             HHHHHHHhhhhhhhccccccccceeeEEEEEeeeeeeeCCCcEee
Q psy822          142 RNKALLKMKLWHELSNYQCKKHHLRLEIKVFYPTAVVCPNGTLVW  186 (190)
Q Consensus       142 ~~~a~~k~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (190)
                      +.+|.+-.....+---=-.+-.|.||.|.        .++|++||
T Consensus        10 r~qA~aV~a~y~NV~IeDdqg~HfRlvvR--------d~~g~mvW   46 (70)
T PF06006_consen   10 REQAEAVAAQYRNVFIEDDQGTHFRLVVR--------DTEGQMVW   46 (70)
T ss_dssp             HHHHHHHHHH-TTEEEES-SSS--EEEEE---------SS--EEE
T ss_pred             HHHHHHHHHHhcceeeccCCCCeEEEEEE--------cCCCcEEE
Confidence            44454444433322222256789999876        68999998


No 25 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=51.27  E-value=10  Score=24.30  Aligned_cols=30  Identities=20%  Similarity=0.431  Sum_probs=20.7

Q ss_pred             ceeccccccccccCCCCCCCccCCcccccccccccCCCCCC
Q psy822           22 PVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQ   62 (190)
Q Consensus        22 Pf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~   62 (190)
                      -|+|..|+..|=......           +...+.||.|+.
T Consensus         5 ey~C~~Cg~~fe~~~~~~-----------~~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSIS-----------EDDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEcC-----------CCCCCcCCCCCC
Confidence            488999998886554321           123567999988


No 26 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=49.23  E-value=9.2  Score=37.61  Aligned_cols=11  Identities=36%  Similarity=0.963  Sum_probs=8.4

Q ss_pred             ceecccccccc
Q psy822           22 PVKCDACLEMF   32 (190)
Q Consensus        22 Pf~C~~C~~~F   32 (190)
                      ++.|+.|++.|
T Consensus       453 H~~C~~Cgk~f  463 (567)
T PLN03086        453 HVHCEKCGQAF  463 (567)
T ss_pred             CccCCCCCCcc
Confidence            46788888877


No 27 
>PHA00616 hypothetical protein
Probab=48.96  E-value=5.4  Score=26.53  Aligned_cols=12  Identities=25%  Similarity=0.514  Sum_probs=8.2

Q ss_pred             ceeccccccccc
Q psy822           22 PVKCDACLEMFC   33 (190)
Q Consensus        22 Pf~C~~C~~~FC   33 (190)
                      ||+|..||+.|-
T Consensus         1 pYqC~~CG~~F~   12 (44)
T PHA00616          1 MYQCLRCGGIFR   12 (44)
T ss_pred             CCccchhhHHHh
Confidence            567777777764


No 28 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=47.33  E-value=8.5  Score=24.04  Aligned_cols=16  Identities=19%  Similarity=0.486  Sum_probs=10.6

Q ss_pred             ccCCCCCCCccCCCCC
Q psy822           55 PVCPLCNQPVPTKRGE   70 (190)
Q Consensus        55 ~~CPlC~~~V~~~~g~   70 (190)
                      ++||-|+..-.++...
T Consensus         3 i~Cp~C~~~y~i~d~~   18 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK   18 (36)
T ss_pred             EECCCCCCEEeCCHHH
Confidence            5788888866655433


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=45.35  E-value=9.5  Score=19.97  Aligned_cols=8  Identities=38%  Similarity=1.489  Sum_probs=3.3

Q ss_pred             CCCCCCCc
Q psy822           57 CPLCNQPV   64 (190)
Q Consensus        57 CPlC~~~V   64 (190)
                      ||+|++..
T Consensus         3 C~~C~~~~   10 (24)
T PF13894_consen    3 CPICGKSF   10 (24)
T ss_dssp             -SSTS-EE
T ss_pred             CcCCCCcC
Confidence            55565544


No 30 
>KOG2462|consensus
Probab=45.17  E-value=9.5  Score=34.42  Aligned_cols=60  Identities=25%  Similarity=0.538  Sum_probs=37.6

Q ss_pred             cceeccccccccc---------cCCCCCCCccCCc----ccc-----------cccccccCCCCCCCccCCCCCCcchhh
Q psy822           21 LPVKCDACLEMFC---------SDHMSYVGHQCKS----AAR-----------KDIQVPVCPLCNQPVPTKRGELPDFAV   76 (190)
Q Consensus        21 LPf~C~~C~~~FC---------~eHr~~~~H~C~~----~~~-----------~d~~v~~CPlC~~~V~~~~g~~pn~~v   76 (190)
                      ||++|..|||.|=         ..|.-.+.+.|+-    +.+           .|+.-..|+.|+|...+.      --+
T Consensus       186 l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~------SyL  259 (279)
T KOG2462|consen  186 LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALK------SYL  259 (279)
T ss_pred             CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHH------HHH
Confidence            7899999999885         3444456666652    111           244456788888766432      245


Q ss_pred             cccccCCCCC
Q psy822           77 GLHIDNNCDS   86 (190)
Q Consensus        77 ~~Hi~~~C~~   86 (190)
                      ++|..++|..
T Consensus       260 nKH~ES~C~~  269 (279)
T KOG2462|consen  260 NKHSESACLK  269 (279)
T ss_pred             HHhhhhcccc
Confidence            6777777753


No 31 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=43.71  E-value=9.5  Score=23.83  Aligned_cols=16  Identities=19%  Similarity=0.509  Sum_probs=11.1

Q ss_pred             ccCCCCCCCccCCCCC
Q psy822           55 PVCPLCNQPVPTKRGE   70 (190)
Q Consensus        55 ~~CPlC~~~V~~~~g~   70 (190)
                      ++||-|+....++..+
T Consensus         3 i~CP~C~~~f~v~~~~   18 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK   18 (37)
T ss_pred             EECCCCCceEEcCHHH
Confidence            5799999877655433


No 32 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=43.59  E-value=17  Score=22.18  Aligned_cols=31  Identities=26%  Similarity=0.562  Sum_probs=18.9

Q ss_pred             eeccccccccccCCCCCCCccCCcccccccccccCCCCCCCc
Q psy822           23 VKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPV   64 (190)
Q Consensus        23 f~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V   64 (190)
                      |+|..|++.|=.....           .+...+.||.|+..+
T Consensus         6 y~C~~Cg~~fe~~~~~-----------~~~~~~~CP~Cg~~~   36 (41)
T smart00834        6 YRCEDCGHTFEVLQKI-----------SDDPLATCPECGGDV   36 (41)
T ss_pred             EEcCCCCCEEEEEEec-----------CCCCCCCCCCCCCcc
Confidence            6888888777433321           112356799998844


No 33 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.77  E-value=11  Score=35.60  Aligned_cols=26  Identities=38%  Similarity=0.868  Sum_probs=21.2

Q ss_pred             ccCCCCCCCccCCCCCCcchhhcccccCCCCCc
Q psy822           55 PVCPLCNQPVPTKRGELPDFAVGLHIDNNCDSD   87 (190)
Q Consensus        55 ~~CPlC~~~V~~~~g~~pn~~v~~Hi~~~C~~~   87 (190)
                      +.||+|++.|+       ...|+.|++++|...
T Consensus       182 v~CPiC~~~~~-------~~~i~~Hld~~Cl~~  207 (397)
T TIGR00599       182 VQCPICQQRMP-------EKAVERHLDSECLGS  207 (397)
T ss_pred             ccCCCcccccC-------HHHHHHHHhccCCCC
Confidence            57999999885       447899999989753


No 34 
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=42.43  E-value=15  Score=25.93  Aligned_cols=16  Identities=44%  Similarity=1.072  Sum_probs=12.3

Q ss_pred             cccccCCCCCCCccCC
Q psy822           52 IQVPVCPLCNQPVPTK   67 (190)
Q Consensus        52 ~~v~~CPlC~~~V~~~   67 (190)
                      ...|+||||+.+....
T Consensus        37 ~~~p~CPlC~s~M~~~   52 (59)
T PF14169_consen   37 EEEPVCPLCKSPMVSG   52 (59)
T ss_pred             CCCccCCCcCCccccc
Confidence            4579999999976533


No 35 
>PHA02768 hypothetical protein; Provisional
Probab=41.77  E-value=11  Score=26.14  Aligned_cols=13  Identities=31%  Similarity=0.840  Sum_probs=10.4

Q ss_pred             ccceecccccccc
Q psy822           20 FLPVKCDACLEMF   32 (190)
Q Consensus        20 FLPf~C~~C~~~F   32 (190)
                      .|-|+|+.|++.|
T Consensus         3 ~~~y~C~~CGK~F   15 (55)
T PHA02768          3 LLGYECPICGEIY   15 (55)
T ss_pred             ccccCcchhCCee
Confidence            5678888888887


No 36 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=40.29  E-value=12  Score=23.67  Aligned_cols=31  Identities=19%  Similarity=0.610  Sum_probs=20.7

Q ss_pred             ceeccccccccccCCCCCCCccCCcccccccccccCCCCCC
Q psy822           22 PVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQ   62 (190)
Q Consensus        22 Pf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~   62 (190)
                      ++.=-.|+-+||.+......          .....||+|++
T Consensus        14 ~~~l~~CgH~~C~~C~~~~~----------~~~~~CP~C~k   44 (44)
T PF14634_consen   14 RPRLTSCGHIFCEKCLKKLK----------GKSVKCPICRK   44 (44)
T ss_pred             CeEEcccCCHHHHHHHHhhc----------CCCCCCcCCCC
Confidence            34445688888888765333          23567999975


No 37 
>KOG1701|consensus
Probab=38.57  E-value=18  Score=34.77  Aligned_cols=47  Identities=23%  Similarity=0.558  Sum_probs=38.5

Q ss_pred             ccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCcchhh
Q psy822           18 LDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELPDFAV   76 (190)
Q Consensus        18 lDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~pn~~v   76 (190)
                      ||=.||+-+.=++++|.+-+.            ++-+|.|-+|++||--..|+++.+.|
T Consensus       370 ldgipFtvd~~n~v~Cv~dfh------------~kfAPrCs~C~~PI~P~~G~~etvRv  416 (468)
T KOG1701|consen  370 LDGIPFTVDSQNNVYCVPDFH------------KKFAPRCSVCGNPILPRDGKDETVRV  416 (468)
T ss_pred             cCCccccccCCCceeeehhhh------------hhcCcchhhccCCccCCCCCcceEEE
Confidence            788888888888888887654            56789999999999988899876544


No 38 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=38.29  E-value=20  Score=25.24  Aligned_cols=42  Identities=24%  Similarity=0.429  Sum_probs=29.2

Q ss_pred             ccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCc
Q psy822           18 LDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELP   72 (190)
Q Consensus        18 lDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~p   72 (190)
                      -.||-.+|+.|++.--             ..++-..++.|+.|+..+..|.|...
T Consensus         7 S~F~~VkCp~C~n~q~-------------vFsha~t~V~C~~Cg~~L~~PtGGKa   48 (59)
T PRK00415          7 SRFLKVKCPDCGNEQV-------------VFSHASTVVRCLVCGKTLAEPTGGKA   48 (59)
T ss_pred             CeEEEEECCCCCCeEE-------------EEecCCcEEECcccCCCcccCCCcce
Confidence            3588899988865321             11123457889999999998887654


No 39 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=37.69  E-value=15  Score=22.46  Aligned_cols=34  Identities=15%  Similarity=0.272  Sum_probs=17.8

Q ss_pred             eeccccccccccCCCCCCCccCCcccccccccccCCCCCCCcc
Q psy822           23 VKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVP   65 (190)
Q Consensus        23 f~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~   65 (190)
                      ++|+.|+..|=.+-...        .. +...+.||.|+.++.
T Consensus         3 ~~CP~C~~~~~v~~~~~--------~~-~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL--------GA-NGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc--------CC-CCCEEECCCCCCEEE
Confidence            56777776664442210        01 112466888877653


No 40 
>KOG4739|consensus
Probab=35.85  E-value=23  Score=31.21  Aligned_cols=37  Identities=30%  Similarity=0.654  Sum_probs=26.4

Q ss_pred             ccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCC
Q psy822           20 FLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKR   68 (190)
Q Consensus        20 FLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~   68 (190)
                      =-||.=..|..+||..+.....        .|    +||+|.++|.+..
T Consensus        15 ~~~f~LTaC~HvfC~~C~k~~~--------~~----~C~lCkk~ir~i~   51 (233)
T KOG4739|consen   15 QDPFFLTACRHVFCEPCLKASS--------PD----VCPLCKKSIRIIQ   51 (233)
T ss_pred             CCceeeeechhhhhhhhcccCC--------cc----ccccccceeeeee
Confidence            3456667899999999875221        22    8999999987553


No 41 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=34.55  E-value=27  Score=22.67  Aligned_cols=29  Identities=28%  Similarity=0.549  Sum_probs=19.1

Q ss_pred             eeccccccccccCCCCCCCccCCcccccccccccCCCCCC
Q psy822           23 VKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQ   62 (190)
Q Consensus        23 f~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~   62 (190)
                      |+|..|+..|=..... .          +...+.||.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~-~----------~~~~~~CP~Cg~   34 (52)
T TIGR02605         6 YRCTACGHRFEVLQKM-S----------DDPLATCPECGG   34 (52)
T ss_pred             EEeCCCCCEeEEEEec-C----------CCCCCCCCCCCC
Confidence            6888888877554322 1          123467999997


No 42 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=33.90  E-value=19  Score=33.34  Aligned_cols=63  Identities=27%  Similarity=0.535  Sum_probs=44.1

Q ss_pred             CCCCCCCCCCCcCCCCCccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCcch
Q psy822            1 MEFPHLGKHCSIETCKKLDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELPDF   74 (190)
Q Consensus         1 MEf~diG~hC~~~~C~qlDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~pn~   74 (190)
                      |.|++|.-.|-  .|+-|---|.+=..|+..||.|-..-      ++-+.|   .+||-|++.=.+..+..||+
T Consensus       268 ~~~~~i~LkCp--lc~~Llrnp~kT~cC~~~fc~eci~~------al~dsD---f~CpnC~rkdvlld~l~pD~  330 (427)
T COG5222         268 MQPPNISLKCP--LCHCLLRNPMKTPCCGHTFCDECIGT------ALLDSD---FKCPNCSRKDVLLDGLTPDI  330 (427)
T ss_pred             cCCCCccccCc--chhhhhhCcccCccccchHHHHHHhh------hhhhcc---ccCCCcccccchhhccCccH
Confidence            78899999998  88888888888888999999886531      121222   35788887544455555554


No 43 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=32.28  E-value=23  Score=25.63  Aligned_cols=42  Identities=24%  Similarity=0.412  Sum_probs=30.0

Q ss_pred             ccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCc
Q psy822           18 LDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELP   72 (190)
Q Consensus        18 lDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~p   72 (190)
                      --||-.+|..|++.-+--             ..-..++.|+.|+..+..|.|.-.
T Consensus        15 s~Fl~VkCpdC~N~q~vF-------------shast~V~C~~CG~~l~~PTGGka   56 (67)
T COG2051          15 SRFLRVKCPDCGNEQVVF-------------SHASTVVTCLICGTTLAEPTGGKA   56 (67)
T ss_pred             ceEEEEECCCCCCEEEEe-------------ccCceEEEecccccEEEecCCCeE
Confidence            359999999998764321             112357889999999988876653


No 44 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=29.98  E-value=18  Score=24.06  Aligned_cols=10  Identities=50%  Similarity=1.504  Sum_probs=5.3

Q ss_pred             cCCCCCCCcc
Q psy822           56 VCPLCNQPVP   65 (190)
Q Consensus        56 ~CPlC~~~V~   65 (190)
                      .||+|++++.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            8999999774


No 45 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=28.52  E-value=40  Score=26.14  Aligned_cols=26  Identities=31%  Similarity=0.798  Sum_probs=19.3

Q ss_pred             CCCcCCCCCcC--cc--CcccCcccCcccccc
Q psy822           98 NKCSVKNCKGK--EL--IPVKCYQCAMNFCLK  125 (190)
Q Consensus        98 ~~Cs~~~Ck~~--~~--~~~~C~~C~~~FClk  125 (190)
                      ..|.-  |+++  .+  .|++|++||..|=+.
T Consensus        10 R~Cp~--CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPS--CGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCC--CcchhccCCCCCccCCCCCCccCcc
Confidence            46754  8876  33  589999999998555


No 46 
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=27.84  E-value=37  Score=28.33  Aligned_cols=39  Identities=23%  Similarity=0.453  Sum_probs=25.6

Q ss_pred             eccccccccc-------cCCCCCCCccCCcccccccccccCCCCCCCccC
Q psy822           24 KCDACLEMFC-------SDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPT   66 (190)
Q Consensus        24 ~C~~C~~~FC-------~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~   66 (190)
                      .|..|+..+.       .||    +|.|.......++-+.|+.||..+-.
T Consensus        22 ~CaiC~~~l~~~~~~~~vDH----DH~l~g~~TG~VRGLLC~~CN~~lG~   67 (157)
T PHA02565         22 ICPLCKRELDGDVSKNHLDH----DHELNGPNAGRVRGLLCNLCNALEGQ   67 (157)
T ss_pred             cCCCCCCccCCCccccccCC----CCCCCCcccccccccCchhhhhhhhh
Confidence            3556666554       444    56665444556789999999996653


No 47 
>smart00355 ZnF_C2H2 zinc finger.
Probab=27.39  E-value=25  Score=18.29  Aligned_cols=6  Identities=50%  Similarity=1.647  Sum_probs=2.8

Q ss_pred             CCCCCC
Q psy822           57 CPLCNQ   62 (190)
Q Consensus        57 CPlC~~   62 (190)
                      |+.|++
T Consensus         3 C~~C~~    8 (26)
T smart00355        3 CPECGK    8 (26)
T ss_pred             CCCCcc
Confidence            444444


No 48 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=27.32  E-value=16  Score=24.01  Aligned_cols=26  Identities=35%  Similarity=0.820  Sum_probs=17.1

Q ss_pred             cccCCC--CCCCccCCCCCCcchhhcccccCCCCC
Q psy822           54 VPVCPL--CNQPVPTKRGELPDFAVGLHIDNNCDS   86 (190)
Q Consensus        54 v~~CPl--C~~~V~~~~g~~pn~~v~~Hi~~~C~~   86 (190)
                      .+.||.  |++.|+..       .++.|+++.|..
T Consensus         9 ~v~C~~~cc~~~i~r~-------~l~~H~~~~C~~   36 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRK-------ELDDHLENECPK   36 (60)
T ss_dssp             EEE-TT--S-BEEECC-------CHHHHHHTTSTT
T ss_pred             EeeCCCCCcccceeHH-------HHHHHHHccCCC
Confidence            467988  77766532       478899888864


No 49 
>PF11290 DUF3090:  Protein of unknown function (DUF3090);  InterPro: IPR021441  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=26.25  E-value=33  Score=28.93  Aligned_cols=11  Identities=55%  Similarity=1.509  Sum_probs=9.6

Q ss_pred             cccCCCCCCCc
Q psy822           54 VPVCPLCNQPV   64 (190)
Q Consensus        54 v~~CPlC~~~V   64 (190)
                      -|.||+|+.||
T Consensus       154 RP~CPlCg~Pl  164 (171)
T PF11290_consen  154 RPPCPLCGEPL  164 (171)
T ss_pred             CCCCCCCCCCC
Confidence            47899999986


No 50 
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=26.17  E-value=50  Score=23.47  Aligned_cols=14  Identities=36%  Similarity=0.769  Sum_probs=11.5

Q ss_pred             ccccCCCCCCCccC
Q psy822           53 QVPVCPLCNQPVPT   66 (190)
Q Consensus        53 ~v~~CPlC~~~V~~   66 (190)
                      .++.||.|++++..
T Consensus         5 ~~v~CP~C~k~~~w   18 (62)
T PRK00418          5 ITVNCPTCGKPVEW   18 (62)
T ss_pred             ccccCCCCCCcccc
Confidence            46789999998864


No 51 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=25.92  E-value=51  Score=19.32  Aligned_cols=18  Identities=22%  Similarity=0.610  Sum_probs=12.2

Q ss_pred             CCcC-ccCcccCcccCccc
Q psy822          105 CKGK-ELIPVKCYQCAMNF  122 (190)
Q Consensus       105 Ck~~-~~~~~~C~~C~~~F  122 (190)
                      |.+. ......|+.||-.|
T Consensus         6 C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    6 CGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             CcCCchhhcCcCCCCCCCC
Confidence            6655 33456799998776


No 52 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.98  E-value=39  Score=20.39  Aligned_cols=19  Identities=26%  Similarity=0.730  Sum_probs=12.8

Q ss_pred             CCCCccccceecccccccccc
Q psy822           14 TCKKLDFLPVKCDACLEMFCS   34 (190)
Q Consensus        14 ~C~qlDFLPf~C~~C~~~FC~   34 (190)
                      .|+.  +=.|+|+.|+..+|+
T Consensus         7 vC~~--~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    7 VCGN--PAKYRCPRCGARYCS   25 (30)
T ss_dssp             SSSS--EESEE-TTT--EESS
T ss_pred             cCcC--CCEEECCCcCCceeC
Confidence            4777  778899999988885


No 53 
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=24.59  E-value=25  Score=29.84  Aligned_cols=23  Identities=17%  Similarity=0.592  Sum_probs=0.0

Q ss_pred             ccccCCCCCCCccCCCCCCcchhhcccccC
Q psy822           53 QVPVCPLCNQPVPTKRGELPDFAVGLHIDN   82 (190)
Q Consensus        53 ~v~~CPlC~~~V~~~~g~~pn~~v~~Hi~~   82 (190)
                      ...+||+|++.||..       -|++|++-
T Consensus       167 ~~~~cPitGe~IP~~-------e~~eHmRi  189 (229)
T PF12230_consen  167 KMIICPITGEMIPAD-------EMDEHMRI  189 (229)
T ss_dssp             ------------------------------
T ss_pred             ccccccccccccccc-------cccccccc
Confidence            457899999999855       45667653


No 54 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=24.06  E-value=36  Score=19.91  Aligned_cols=8  Identities=50%  Similarity=1.202  Sum_probs=4.6

Q ss_pred             CCCCCCCc
Q psy822           57 CPLCNQPV   64 (190)
Q Consensus        57 CPlC~~~V   64 (190)
                      |.+|++.+
T Consensus         6 C~~C~~~~   13 (35)
T smart00451        6 CKLCNVTF   13 (35)
T ss_pred             ccccCCcc
Confidence            56666644


No 55 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=24.05  E-value=34  Score=19.61  Aligned_cols=10  Identities=40%  Similarity=0.913  Sum_probs=8.5

Q ss_pred             ccCcccCccc
Q psy822          113 VKCYQCAMNF  122 (190)
Q Consensus       113 ~~C~~C~~~F  122 (190)
                      +.|+.|++.|
T Consensus         3 ~~C~~CgR~F   12 (25)
T PF13913_consen    3 VPCPICGRKF   12 (25)
T ss_pred             CcCCCCCCEE
Confidence            5799999988


No 56 
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.90  E-value=44  Score=24.03  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=13.0

Q ss_pred             ccccccCCCCCCCccCC
Q psy822           51 DIQVPVCPLCNQPVPTK   67 (190)
Q Consensus        51 d~~v~~CPlC~~~V~~~   67 (190)
                      ++....||.|+++|...
T Consensus         4 ~~~~v~CP~Cgkpv~w~   20 (65)
T COG3024           4 LRITVPCPTCGKPVVWG   20 (65)
T ss_pred             ccccccCCCCCCccccc
Confidence            34566799999998753


No 57 
>TIGR03847 conserved hypothetical protein. The conserved hypothetical protein described here occurs as part of the trio of uncharacterized proteins common in the Actinobacteria.
Probab=23.78  E-value=39  Score=28.66  Aligned_cols=11  Identities=55%  Similarity=1.543  Sum_probs=9.8

Q ss_pred             cccCCCCCCCc
Q psy822           54 VPVCPLCNQPV   64 (190)
Q Consensus        54 v~~CPlC~~~V   64 (190)
                      -|.||+|++||
T Consensus       156 RP~CPlCg~Pl  166 (177)
T TIGR03847       156 RPPCPLCGRPI  166 (177)
T ss_pred             CCCCCCCCCCC
Confidence            47899999988


No 58 
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=23.55  E-value=52  Score=28.98  Aligned_cols=38  Identities=24%  Similarity=0.586  Sum_probs=25.0

Q ss_pred             ccccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCC
Q psy822           18 LDFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQP   63 (190)
Q Consensus        18 lDFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~   63 (190)
                      ..+..++|..|++.|=.+...        ....+..+|.||.|+.+
T Consensus       118 Gsl~~~~C~~C~~~~~~~~~~--------~~~~~~~~p~C~~Cg~~  155 (250)
T COG0846         118 GSLKRVRCSKCGNQYYDEDVI--------KFIEDGLIPRCPKCGGP  155 (250)
T ss_pred             cceeeeEeCCCcCccchhhhh--------hhcccCCCCcCccCCCc
Confidence            356788899998776544311        11123468999999994


No 59 
>KOG2462|consensus
Probab=22.51  E-value=38  Score=30.64  Aligned_cols=25  Identities=32%  Similarity=0.716  Sum_probs=21.2

Q ss_pred             ceeccccccccc---------cCCCCCCCccCCc
Q psy822           22 PVKCDACLEMFC---------SDHMSYVGHQCKS   46 (190)
Q Consensus        22 Pf~C~~C~~~FC---------~eHr~~~~H~C~~   46 (190)
                      ||.|.+|++.|=         .-|-..+.|.|..
T Consensus       215 PF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~  248 (279)
T KOG2462|consen  215 PFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPR  248 (279)
T ss_pred             CccCCcccchhcchHHHHHHHHhhcCCccccCcc
Confidence            999999999994         4678888899874


No 60 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=22.43  E-value=52  Score=21.35  Aligned_cols=25  Identities=32%  Similarity=0.727  Sum_probs=16.5

Q ss_pred             CCCC-cccc--ceeccccccccccCCCC
Q psy822           14 TCKK-LDFL--PVKCDACLEMFCSDHMS   38 (190)
Q Consensus        14 ~C~q-lDFL--Pf~C~~C~~~FC~eHr~   38 (190)
                      .|++ +.++  ...|..|++.||.++..
T Consensus         7 ~C~~~F~~~~rk~~Cr~Cg~~~C~~C~~   34 (57)
T cd00065           7 GCGKPFTLTRRRHHCRNCGRIFCSKCSS   34 (57)
T ss_pred             ccCccccCCccccccCcCcCCcChHHcC
Confidence            5543 4444  46788888888886654


No 61 
>PLN00209 ribosomal protein S27; Provisional
Probab=22.38  E-value=52  Score=24.87  Aligned_cols=41  Identities=24%  Similarity=0.490  Sum_probs=28.8

Q ss_pred             cccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCc
Q psy822           19 DFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELP   72 (190)
Q Consensus        19 DFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~p   72 (190)
                      -||-++|..|.+.--             .......++.|..|+.++..|.|.-.
T Consensus        33 ~Fm~VkCp~C~n~q~-------------VFShA~t~V~C~~Cg~~L~~PTGGKa   73 (86)
T PLN00209         33 FFMDVKCQGCFNITT-------------VFSHSQTVVVCGSCQTVLCQPTGGKA   73 (86)
T ss_pred             EEEEEECCCCCCeeE-------------EEecCceEEEccccCCEeeccCCCCe
Confidence            588888988865411             11233467889999999998887764


No 62 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=21.81  E-value=46  Score=18.80  Aligned_cols=21  Identities=14%  Similarity=0.476  Sum_probs=12.6

Q ss_pred             cCCCCCCCccCCCCCCcchhhcccccC
Q psy822           56 VCPLCNQPVPTKRGELPDFAVGLHIDN   82 (190)
Q Consensus        56 ~CPlC~~~V~~~~g~~pn~~v~~Hi~~   82 (190)
                      .|++|++...      -..++++|+.+
T Consensus         3 ~C~~C~k~f~------~~~~~~~H~~s   23 (27)
T PF12171_consen    3 YCDACDKYFS------SENQLKQHMKS   23 (27)
T ss_dssp             BBTTTTBBBS------SHHHHHCCTTS
T ss_pred             CcccCCCCcC------CHHHHHHHHcc
Confidence            4777777553      23466777653


No 63 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=21.72  E-value=50  Score=22.41  Aligned_cols=33  Identities=21%  Similarity=0.512  Sum_probs=21.6

Q ss_pred             cceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCC
Q psy822           21 LPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTK   67 (190)
Q Consensus        21 LPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~   67 (190)
                      +-|+|..|++.|              ........+.||.|+--|-+.
T Consensus         5 ~~Y~C~~Cg~~~--------------~~~~~~~~irCp~Cg~rIl~K   37 (49)
T COG1996           5 MEYKCARCGREV--------------ELDQETRGIRCPYCGSRILVK   37 (49)
T ss_pred             EEEEhhhcCCee--------------ehhhccCceeCCCCCcEEEEe
Confidence            347888888887              011234567899998877544


No 64 
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=21.52  E-value=56  Score=24.68  Aligned_cols=41  Identities=22%  Similarity=0.442  Sum_probs=28.9

Q ss_pred             cccceeccccccccccCCCCCCCccCCcccccccccccCCCCCCCccCCCCCCc
Q psy822           19 DFLPVKCDACLEMFCSDHMSYVGHQCKSAARKDIQVPVCPLCNQPVPTKRGELP   72 (190)
Q Consensus        19 DFLPf~C~~C~~~FC~eHr~~~~H~C~~~~~~d~~v~~CPlC~~~V~~~~g~~p   72 (190)
                      -||-++|..|.+.--             ..++...++.|..|+.++..|.|...
T Consensus        32 ~Fm~VkCp~C~n~q~-------------VFShA~t~V~C~~Cg~~L~~PTGGKa   72 (85)
T PTZ00083         32 YFMDVKCPGCSQITT-------------VFSHAQTVVLCGGCSSQLCQPTGGKA   72 (85)
T ss_pred             eEEEEECCCCCCeeE-------------EEecCceEEEccccCCEeeccCCCCe
Confidence            488888888865411             11233467889999999998887764


No 65 
>TIGR02174 CXXU_selWTH selT/selW/selH selenoprotein domain. This model represents a domain found in both bacteria and animals, including animal proteins SelT, SelW, and SelH, all of which are selenoproteins. In a CXXC motif near the N-terminus of the domain, selenocysteine may replace the second Cys. Proteins with this domain may include an insert of about 70 amino acids. This model is broader than the current SelW model pfam05169 in Pfam.
Probab=21.51  E-value=84  Score=22.07  Aligned_cols=27  Identities=37%  Similarity=0.414  Sum_probs=16.0

Q ss_pred             hhhhhccccccccceeeEEEEEeeeeeeeCCCcEeeec
Q psy822          151 LWHELSNYQCKKHHLRLEIKVFYPTAVVCPNGTLVWDF  188 (190)
Q Consensus       151 ~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  188 (190)
                      +|.+..++  |-..=..||.|         ||.|||+-
T Consensus        29 ~~v~~~~~--~~~~G~Fev~~---------~g~~v~sk   55 (72)
T TIGR02174        29 LEIEGENT--PPTTGAFEVTV---------NGQLVWSK   55 (72)
T ss_pred             CeeEEeee--cCCCcEEEEEE---------CCEEEEEe
Confidence            34444443  33444556555         99999984


No 66 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.06  E-value=77  Score=25.13  Aligned_cols=48  Identities=19%  Similarity=0.288  Sum_probs=26.5

Q ss_pred             cceeccccccccccC--CCC------CCCccCCcccccccccccCCCCCCC-ccCCCCCC
Q psy822           21 LPVKCDACLEMFCSD--HMS------YVGHQCKSAARKDIQVPVCPLCNQP-VPTKRGEL   71 (190)
Q Consensus        21 LPf~C~~C~~~FC~e--Hr~------~~~H~C~~~~~~d~~v~~CPlC~~~-V~~~~g~~   71 (190)
                      .-++|..|+..|=.+  |+.      ..-|-=|...   .....||.|+.. +.+..|..
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~CP~Cgs~~~~i~~G~e  125 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVV---HAFLKCPKCGSRDFEIVKGRG  125 (135)
T ss_pred             eEEECCCCCCEEeccccccccccccccccccccccc---ccCcCCcCCCCCCcEEecCce
Confidence            458899999888665  221      1122222211   223569999875 55555554


No 67 
>PHA00732 hypothetical protein
Probab=20.91  E-value=41  Score=24.50  Aligned_cols=12  Identities=25%  Similarity=0.315  Sum_probs=9.2

Q ss_pred             ceeccccccccc
Q psy822           22 PVKCDACLEMFC   33 (190)
Q Consensus        22 Pf~C~~C~~~FC   33 (190)
                      ||+|+.|++.|=
T Consensus         1 py~C~~Cgk~F~   12 (79)
T PHA00732          1 MFKCPICGFTTV   12 (79)
T ss_pred             CccCCCCCCccC
Confidence            678888888873


No 68 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=20.89  E-value=69  Score=19.49  Aligned_cols=16  Identities=19%  Similarity=0.717  Sum_probs=13.6

Q ss_pred             CcccCcccCccccccC
Q psy822          111 IPVKCYQCAMNFCLKH  126 (190)
Q Consensus       111 ~~~~C~~C~~~FClkH  126 (190)
                      ..+.|+.|+...|.+|
T Consensus        15 T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVEP   30 (32)
T ss_pred             eEEEccCCCCcccCCC
Confidence            5678999999999887


No 69 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=20.85  E-value=89  Score=18.81  Aligned_cols=8  Identities=50%  Similarity=1.290  Sum_probs=5.9

Q ss_pred             ccCCCCCC
Q psy822           55 PVCPLCNQ   62 (190)
Q Consensus        55 ~~CPlC~~   62 (190)
                      -.||+|+.
T Consensus        18 ~~CP~Cg~   25 (33)
T cd00350          18 WVCPVCGA   25 (33)
T ss_pred             CcCcCCCC
Confidence            36888876


No 70 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.82  E-value=76  Score=30.36  Aligned_cols=22  Identities=36%  Similarity=0.783  Sum_probs=17.0

Q ss_pred             CCCcCCCCCcCccCcccCcccCcc
Q psy822           98 NKCSVKNCKGKELIPVKCYQCAMN  121 (190)
Q Consensus        98 ~~Cs~~~Ck~~~~~~~~C~~C~~~  121 (190)
                      -+|.+  |+.....+-.|+.|+..
T Consensus       241 l~Ch~--Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       241 LRCHY--CGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             EEcCC--CcCcCCCCCCCCCCCCC
Confidence            46777  88888788889988763


No 71 
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=20.13  E-value=20  Score=23.82  Aligned_cols=9  Identities=56%  Similarity=1.464  Sum_probs=3.0

Q ss_pred             ccCCCCCCC
Q psy822           55 PVCPLCNQP   63 (190)
Q Consensus        55 ~~CPlC~~~   63 (190)
                      -.||+|+++
T Consensus        42 W~CPiC~~~   50 (50)
T PF02891_consen   42 WKCPICNKP   50 (50)
T ss_dssp             -B-TTT---
T ss_pred             eECcCCcCc
Confidence            457777764


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.02  E-value=57  Score=25.70  Aligned_cols=15  Identities=33%  Similarity=0.897  Sum_probs=13.1

Q ss_pred             ceeccccccccccCC
Q psy822           22 PVKCDACLEMFCSDH   36 (190)
Q Consensus        22 Pf~C~~C~~~FC~eH   36 (190)
                      .|+|..|++.||.|=
T Consensus        81 ~y~C~~C~~~FC~dC   95 (112)
T TIGR00622        81 RYVCAVCKNVFCVDC   95 (112)
T ss_pred             ceeCCCCCCcccccc
Confidence            588999999999775


Done!