Diaphorina citri psyllid: psy8244


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MILEEDTPENSCYCCAKTLDEVPYYESLLRHTLIKRLKDSELETLVEAIESHGTNMSPCILLPSHLLPNAHFLCCQLWRWPDVSEPYELKKLPNCDSYECSDPSPSSSDLYICCNPYHWSRRCKSVSEEISIGIGYGREECGRRFCGLWKWDLGIVIMVPKQG
ccEECccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccEEEcccccccCECccccccccccccccccccccccEEEEEEEEEEEEEcccc
**********SCYCC*****EVPYYESLLRHTLIKRLKDSELETLVEAIESHGTNMSPCILLPSHLLPNAHFLCCQLWRWPDVSEPYELKKLPNCDSYECSDPSPSSSDLYICCNPYHWSRRCKSVSEEISIGIGYGREECGRRFCGLWKWDLGIVIMVPKQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILEEDTPENSCYCCAKTLDEVPYYESLLRHTLIKRLKDSELETLVEAIESHGTNMSPCILLPSHLLPNAHFLCCQLWRWPDVSEPYELKKLPNCDSYECSDPSPSSSDLYICCNPYHWSRRCKSVSEEISIGIGYGREECGRRFCGLWKWDLGIVIMVPKQG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0007183 [BP]SMAD protein complex assemblyprobableGO:0022607, GO:0070271, GO:0043933, GO:0007167, GO:0023052, GO:0007165, GO:0007166, GO:0034622, GO:0050789, GO:0044699, GO:0051716, GO:0071822, GO:0016043, GO:0065003, GO:0065007, GO:0071840, GO:0009987, GO:0006461, GO:0050794, GO:0044763, GO:0007154, GO:0043623, GO:0007178, GO:0044700, GO:0050896, GO:0044085, GO:0008150
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0071407 [BP]cellular response to organic cyclic compoundprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0044699, GO:0070887, GO:0042221, GO:0010033, GO:0014070
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000988 [MF]protein binding transcription factor activityprobableGO:0003674
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OZJ, chain A
Confidence level:very confident
Coverage over the Query: 11-124
View the alignment between query and template
View the model in PyMOL