Query         psy8255
Match_columns 117
No_of_seqs    118 out of 166
Neff          4.2 
Searched_HMMs 46136
Date          Fri Aug 16 22:39:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8255.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8255hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01642 U2AF_lg U2 snRNP aux  99.3   3E-12 6.6E-17  106.6   4.5   57   61-117   109-189 (509)
  2 KOG0120|consensus               99.2 6.3E-12 1.4E-16  109.9   3.1   57   61-117   114-189 (500)
  3 PF06495 Transformer:  Fruit fl  98.6 1.1E-08 2.4E-13   80.0   0.3   25   59-83    112-136 (182)
  4 TIGR01622 SF-CC1 splicing fact  97.6 4.3E-05 9.2E-10   63.3   2.8   19   99-117    85-103 (457)
  5 TIGR01622 SF-CC1 splicing fact  95.2   0.029 6.4E-07   46.5   4.4   15  103-117   186-200 (457)
  6 PLN03134 glycine-rich RNA-bind  89.6    0.19 4.1E-06   37.0   1.4   15  103-117    34-48  (144)
  7 COG0724 RNA-binding proteins (  87.5     0.3 6.5E-06   34.8   1.3   15  103-117   115-129 (306)
  8 TIGR01642 U2AF_lg U2 snRNP aux  85.4    0.59 1.3E-05   39.3   2.2   17  101-117   293-309 (509)
  9 KOG0126|consensus               84.2    0.53 1.1E-05   38.0   1.3   14  104-117    36-49  (219)
 10 TIGR01661 ELAV_HUD_SF ELAV/HuD  83.6    0.99 2.1E-05   36.0   2.6   16  102-117   268-283 (352)
 11 TIGR01648 hnRNP-R-Q heterogene  80.9     1.2 2.6E-05   40.3   2.4   16  102-117    57-72  (578)
 12 TIGR01645 half-pint poly-U bin  80.3    0.86 1.9E-05   41.6   1.3   20   98-117   102-121 (612)
 13 KOG0121|consensus               79.5     0.6 1.3E-05   36.0   0.0   18  100-117    33-50  (153)
 14 TIGR01659 sex-lethal sex-letha  73.6     1.8 3.9E-05   36.4   1.3   16  102-117   106-121 (346)
 15 KOG0132|consensus               71.8     3.8 8.2E-05   39.0   3.1   16  102-117   420-435 (894)
 16 KOG0147|consensus               64.9     2.3   5E-05   38.6   0.2   19   99-117   274-292 (549)
 17 KOG0125|consensus               64.7     5.4 0.00012   34.7   2.4   18   98-115    91-108 (376)
 18 TIGR01659 sex-lethal sex-letha  63.6     3.6 7.9E-05   34.6   1.2   16  102-117   192-207 (346)
 19 TIGR01661 ELAV_HUD_SF ELAV/HuD  60.5       4 8.7E-05   32.5   0.9   15  103-117    89-103 (352)
 20 TIGR01645 half-pint poly-U bin  56.6     5.5 0.00012   36.5   1.1   16  102-117   203-218 (612)
 21 KOG0117|consensus               55.1      10 0.00023   34.1   2.6   16  102-117    82-97  (506)
 22 PF13991 BssS:  BssS protein fa  52.7      11 0.00023   25.9   1.8   13   62-74      2-15  (73)
 23 TIGR01648 hnRNP-R-Q heterogene  50.3     9.9 0.00021   34.5   1.7   17  101-117   231-247 (578)
 24 KOG0148|consensus               48.4     7.9 0.00017   33.0   0.8   13  105-117   166-178 (321)
 25 TIGR01649 hnRNP-L_PTB hnRNP-L/  47.7      10 0.00022   32.7   1.3   15  103-117   394-408 (481)
 26 KOG0116|consensus               46.9     9.7 0.00021   33.4   1.1   12  106-117   291-302 (419)
 27 KOG1548|consensus               45.7      11 0.00023   33.0   1.2   15  102-116   133-147 (382)
 28 KOG0151|consensus               44.8     9.5 0.00021   36.2   0.8   16  102-117   173-188 (877)
 29 TIGR01628 PABP-1234 polyadenyl  44.6      11 0.00023   32.7   1.0   15  103-117   285-299 (562)
 30 KOG0796|consensus               43.7      11 0.00023   32.3   0.8   15   16-30    267-281 (319)
 31 TIGR01649 hnRNP-L_PTB hnRNP-L/  43.1      19 0.00042   31.0   2.3   17  101-117   273-290 (481)
 32 KOG0129|consensus               42.0      12 0.00025   34.0   0.8   18  100-117   256-273 (520)
 33 PF10929 DUF2811:  Protein of u  41.9     6.1 0.00013   26.0  -0.7   26   80-111    26-56  (57)
 34 KOG0533|consensus               40.6      14 0.00031   30.1   1.1   15  103-117    83-97  (243)
 35 TIGR01628 PABP-1234 polyadenyl  39.3      14 0.00029   32.0   0.8   14  104-117    89-102 (562)
 36 PF15407 Spo7_2_N:  Sporulation  37.1      19 0.00042   24.0   1.1   15  100-114    24-38  (67)
 37 KOG4212|consensus               36.8      24 0.00051   32.2   1.9   22   95-116   528-549 (608)
 38 KOG0117|consensus               34.3      18 0.00039   32.6   0.8   19   98-116   159-177 (506)
 39 COG0030 KsgA Dimethyladenosine  32.5      25 0.00055   28.9   1.3   13  104-116    96-108 (259)
 40 PF00054 Laminin_G_1:  Laminin   26.7      32 0.00069   24.1   0.9    9  104-112    93-101 (131)
 41 KOG0127|consensus               25.5      36 0.00078   31.7   1.2   14  104-117   293-306 (678)
 42 KOG4030|consensus               25.5      24 0.00052   28.1   0.1   17   64-80    178-194 (197)
 43 KOG0153|consensus               23.9      71  0.0015   28.0   2.6   27   91-117   216-242 (377)
 44 PF06200 tify:  tify domain;  I  23.2      67  0.0015   19.1   1.7   15   73-87     19-34  (36)
 45 PRK00274 ksgA 16S ribosomal RN  21.8      45 0.00098   26.5   1.0   12  105-116   107-118 (272)
 46 PF06212 GRIM-19:  GRIM-19 prot  21.8      50  0.0011   24.6   1.2   10   67-76      8-18  (130)

No 1  
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=99.28  E-value=3e-12  Score=106.62  Aligned_cols=57  Identities=46%  Similarity=0.675  Sum_probs=44.2

Q ss_pred             cCCCCCCCCCCCCCCCChhHHHHHHH---hhh---------------------ccCCCCCCccccccceeEeecCCCCCC
Q psy8255          61 KASLYWDVPPPGFEHVSPSQYKAMQA---AAA---------------------AAVPVVGSTITRQARRLYVGNIPFGVT  116 (117)
Q Consensus        61 k~~s~WDv~PpG~E~vta~QaK~mq~---ag~---------------------~~~p~~~~~~SRQaRRLYVGNLP~~vt  116 (117)
                      +....||.+|++|+.+++.|++++++   ++.                     .+++++.+++++++++|||||||+++|
T Consensus       109 ~~~~~~d~~p~~~~~~~~~~~~~~~~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~lyVgnLp~~~t  188 (509)
T TIGR01642       109 KKRSLWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQATRQARRLYVGGIPPEFV  188 (509)
T ss_pred             ccccccccCCCcccccchHHHhhccccCCCCCCCCCCCCCcccccccccccCCccccccCccCCccccEEEEeCCCCCCC
Confidence            34578999999999999999997642   220                     011235678899999999999999998


Q ss_pred             C
Q psy8255         117 E  117 (117)
Q Consensus       117 E  117 (117)
                      |
T Consensus       189 ~  189 (509)
T TIGR01642       189 E  189 (509)
T ss_pred             H
Confidence            6


No 2  
>KOG0120|consensus
Probab=99.21  E-value=6.3e-12  Score=109.89  Aligned_cols=57  Identities=51%  Similarity=0.916  Sum_probs=48.2

Q ss_pred             cCCCCCCCCCCCCCCCCh---hHHHHHHHhhh----------------ccCCCCCCccccccceeEeecCCCCCCC
Q psy8255          61 KASLYWDVPPPGFEHVSP---SQYKAMQAAAA----------------AAVPVVGSTITRQARRLYVGNIPFGVTE  117 (117)
Q Consensus        61 k~~s~WDv~PpG~E~vta---~QaK~mq~ag~----------------~~~p~~~~~~SRQaRRLYVGNLP~~vtE  117 (117)
                      +....||++|+|||.+|+   +++++|++.|+                ++.+++++++|+|+++|||||||++++|
T Consensus       114 r~~~~~~~~~~~fe~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~q~~r~~v~~~~~~~~e  189 (500)
T KOG0120|consen  114 RKRSLWDVPPEGFETITPDGAKLYKNFNATGQVPGDLSNPKKSLKLPQLPTPPMDSQATRQARRLYVGNIPFTSNE  189 (500)
T ss_pred             cchhhhcCCCCCCcccCchhhhhhhhccccCCCCCCccccccccccccCCCCccCcchhhhhhhhcccccCCccCc
Confidence            556789999999999999   77777777653                2345788999999999999999999987


No 3  
>PF06495 Transformer:  Fruit fly transformer protein;  InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly). The transformer locus (tra) produces an RNA processing protein that alternatively splices the doublesex pre-mRNA in the sex determination hierarchy of Drosophila melanogaster [].; GO: 0006397 mRNA processing, 0046660 female sex differentiation, 0005634 nucleus
Probab=98.58  E-value=1.1e-08  Score=79.96  Aligned_cols=25  Identities=40%  Similarity=0.550  Sum_probs=19.5

Q ss_pred             hccCCCCCCCCCCCCCCCChhHHHH
Q psy8255          59 RRKASLYWDVPPPGFEHVSPSQYKA   83 (117)
Q Consensus        59 ~rk~~s~WDv~PpG~E~vta~QaK~   83 (117)
                      +++.+.+|||||+|||++++.+.+.
T Consensus       112 PkiI~~yv~VPp~gf~~~y~~~~~~  136 (182)
T PF06495_consen  112 PKIITKYVDVPPPGFEYAYGWPPPA  136 (182)
T ss_pred             CCeeeeeccCCCcccccccCCCCcc
Confidence            4445789999999999999955443


No 4  
>TIGR01622 SF-CC1 splicing factor, CC1-like family. A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
Probab=97.59  E-value=4.3e-05  Score=63.32  Aligned_cols=19  Identities=21%  Similarity=0.405  Sum_probs=16.7

Q ss_pred             cccccceeEeecCCCCCCC
Q psy8255          99 ITRQARRLYVGNIPFGVTE  117 (117)
Q Consensus        99 ~SRQaRRLYVGNLP~~vtE  117 (117)
                      ..+..+.|||||||+.++|
T Consensus        85 ~~~~~~~l~V~nlp~~~~~  103 (457)
T TIGR01622        85 AERDDRTVFVLQLALKARE  103 (457)
T ss_pred             cccCCcEEEEeCCCCCCCH
Confidence            4778899999999999985


No 5  
>TIGR01622 SF-CC1 splicing factor, CC1-like family. A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
Probab=95.18  E-value=0.029  Score=46.55  Aligned_cols=15  Identities=53%  Similarity=0.935  Sum_probs=13.5

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||||||+++||
T Consensus       186 ~~~l~v~nl~~~~te  200 (457)
T TIGR01622       186 FLKLYVGNLHFNITE  200 (457)
T ss_pred             CCEEEEcCCCCCCCH
Confidence            478999999999986


No 6  
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=89.58  E-value=0.19  Score=37.04  Aligned_cols=15  Identities=20%  Similarity=0.864  Sum_probs=13.1

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||+|||++++|
T Consensus        34 ~~~lfVgnL~~~~te   48 (144)
T PLN03134         34 STKLFIGGLSWGTDD   48 (144)
T ss_pred             CCEEEEeCCCCCCCH
Confidence            448999999999986


No 7  
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]
Probab=87.54  E-value=0.3  Score=34.75  Aligned_cols=15  Identities=53%  Similarity=1.061  Sum_probs=13.6

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||||||+.+||
T Consensus       115 ~~~l~v~nL~~~~~~  129 (306)
T COG0724         115 NNTLFVGNLPYDVTE  129 (306)
T ss_pred             CceEEEeCCCCCCCH
Confidence            589999999999986


No 8  
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=85.41  E-value=0.59  Score=39.30  Aligned_cols=17  Identities=35%  Similarity=0.798  Sum_probs=14.4

Q ss_pred             cccceeEeecCCCCCCC
Q psy8255         101 RQARRLYVGNIPFGVTE  117 (117)
Q Consensus       101 RQaRRLYVGNLP~~vtE  117 (117)
                      -..+.|||||||+.+||
T Consensus       293 ~~~~~l~v~nlp~~~~~  309 (509)
T TIGR01642       293 DSKDRIYIGNLPLYLGE  309 (509)
T ss_pred             CCCCEEEEeCCCCCCCH
Confidence            34589999999999985


No 9  
>KOG0126|consensus
Probab=84.24  E-value=0.53  Score=38.04  Aligned_cols=14  Identities=36%  Similarity=0.973  Sum_probs=12.7

Q ss_pred             ceeEeecCCCCCCC
Q psy8255         104 RRLYVGNIPFGVTE  117 (117)
Q Consensus       104 RRLYVGNLP~~vtE  117 (117)
                      ==||||||||.+||
T Consensus        36 A~Iyiggl~~~LtE   49 (219)
T KOG0126|consen   36 AYIYIGGLPYELTE   49 (219)
T ss_pred             eEEEECCCcccccC
Confidence            37999999999998


No 10 
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor. These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).
Probab=83.58  E-value=0.99  Score=35.95  Aligned_cols=16  Identities=19%  Similarity=0.220  Sum_probs=13.0

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      ....|||+|||+.++|
T Consensus       268 ~~~~lfV~NL~~~~~e  283 (352)
T TIGR01661       268 AGYCIFVYNLSPDTDE  283 (352)
T ss_pred             CCcEEEEeCCCCCCCH
Confidence            3346999999999875


No 11 
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family. Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R, Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain.
Probab=80.90  E-value=1.2  Score=40.27  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=13.8

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      +.-.|||||||++++|
T Consensus        57 ~~~~lFVgnLp~~~tE   72 (578)
T TIGR01648        57 RGCEVFVGKIPRDLYE   72 (578)
T ss_pred             CCCEEEeCCCCCCCCH
Confidence            4468999999999986


No 12 
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.
Probab=80.29  E-value=0.86  Score=41.57  Aligned_cols=20  Identities=35%  Similarity=0.559  Sum_probs=16.1

Q ss_pred             ccccccceeEeecCCCCCCC
Q psy8255          98 TITRQARRLYVGNIPFGVTE  117 (117)
Q Consensus        98 ~~SRQaRRLYVGNLP~~vtE  117 (117)
                      ++.....+|||||||+.++|
T Consensus       102 ~a~~~~~rLfVGnLp~~~tE  121 (612)
T TIGR01645       102 QALAIMCRVYVGSISFELRE  121 (612)
T ss_pred             hhhcCCCEEEEcCCCCCCCH
Confidence            44456679999999999986


No 13 
>KOG0121|consensus
Probab=79.52  E-value=0.6  Score=35.96  Aligned_cols=18  Identities=44%  Similarity=0.728  Sum_probs=15.4

Q ss_pred             ccccceeEeecCCCCCCC
Q psy8255         100 TRQARRLYVGNIPFGVTE  117 (117)
Q Consensus       100 SRQaRRLYVGNLP~~vtE  117 (117)
                      .+++--||||||.|-++|
T Consensus        33 ~r~S~tvyVgNlSfyttE   50 (153)
T KOG0121|consen   33 LRKSCTVYVGNLSFYTTE   50 (153)
T ss_pred             HhhcceEEEeeeeeeecH
Confidence            567778999999998886


No 14 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=73.61  E-value=1.8  Score=36.39  Aligned_cols=16  Identities=25%  Similarity=0.443  Sum_probs=13.9

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      ....|||+|||+++||
T Consensus       106 ~~~~LfVgnLp~~~te  121 (346)
T TIGR01659       106 SGTNLIVNYLPQDMTD  121 (346)
T ss_pred             CCcEEEEeCCCCCCCH
Confidence            4568999999999986


No 15 
>KOG0132|consensus
Probab=71.83  E-value=3.8  Score=39.01  Aligned_cols=16  Identities=56%  Similarity=0.831  Sum_probs=13.7

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      -++.||||.||-.|+|
T Consensus       420 ~SrTLwvG~i~k~v~e  435 (894)
T KOG0132|consen  420 CSRTLWVGGIPKNVTE  435 (894)
T ss_pred             eeeeeeeccccchhhH
Confidence            5678999999998886


No 16 
>KOG0147|consensus
Probab=64.93  E-value=2.3  Score=38.62  Aligned_cols=19  Identities=58%  Similarity=0.962  Sum_probs=15.1

Q ss_pred             cccccceeEeecCCCCCCC
Q psy8255          99 ITRQARRLYVGNIPFGVTE  117 (117)
Q Consensus        99 ~SRQaRRLYVGNLP~~vtE  117 (117)
                      ++.--.+||||||.|+++|
T Consensus       274 ~~~p~~rl~vgnLHfNite  292 (549)
T KOG0147|consen  274 FTGPMRRLYVGNLHFNITE  292 (549)
T ss_pred             cccchhhhhhcccccCchH
Confidence            3555566999999999986


No 17 
>KOG0125|consensus
Probab=64.72  E-value=5.4  Score=34.68  Aligned_cols=18  Identities=39%  Similarity=0.636  Sum_probs=14.9

Q ss_pred             ccccccceeEeecCCCCC
Q psy8255          98 TITRQARRLYVGNIPFGV  115 (117)
Q Consensus        98 ~~SRQaRRLYVGNLP~~v  115 (117)
                      .++=..+||||.||||.-
T Consensus        91 ~s~~~pkRLhVSNIPFrF  108 (376)
T KOG0125|consen   91 SSKDTPKRLHVSNIPFRF  108 (376)
T ss_pred             CCCCCCceeEeecCCccc
Confidence            456788999999999953


No 18 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=63.64  E-value=3.6  Score=34.56  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=13.7

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      ....|||+|||+.+||
T Consensus       192 ~~~~lfV~nLp~~vte  207 (346)
T TIGR01659       192 KDTNLYVTNLPRTITD  207 (346)
T ss_pred             ccceeEEeCCCCcccH
Confidence            4567999999999986


No 19 
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor. These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).
Probab=60.54  E-value=4  Score=32.46  Aligned_cols=15  Identities=33%  Similarity=0.623  Sum_probs=12.9

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||+|||+.++|
T Consensus        89 ~~~l~v~~l~~~~~~  103 (352)
T TIGR01661        89 GANLYVSGLPKTMTQ  103 (352)
T ss_pred             cceEEECCccccCCH
Confidence            457999999999885


No 20 
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.
Probab=56.57  E-value=5.5  Score=36.48  Aligned_cols=16  Identities=25%  Similarity=0.517  Sum_probs=13.6

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      ...+|||||||+.++|
T Consensus       203 ~~~rLfVgnLp~~vte  218 (612)
T TIGR01645       203 KFNRIYVASVHPDLSE  218 (612)
T ss_pred             ccceEEeecCCCCCCH
Confidence            4579999999999875


No 21 
>KOG0117|consensus
Probab=55.12  E-value=10  Score=34.12  Aligned_cols=16  Identities=38%  Similarity=0.650  Sum_probs=13.4

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      +-=.||||.||-++.|
T Consensus        82 ~G~EVfvGkIPrD~~E   97 (506)
T KOG0117|consen   82 RGCEVFVGKIPRDVFE   97 (506)
T ss_pred             CCceEEecCCCccccc
Confidence            3449999999999887


No 22 
>PF13991 BssS:  BssS protein family
Probab=52.73  E-value=11  Score=25.92  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=8.8

Q ss_pred             CCCCCCCCC-CCCC
Q psy8255          62 ASLYWDVPP-PGFE   74 (117)
Q Consensus        62 ~~s~WDv~P-pG~E   74 (117)
                      |-++|||-| ++|.
T Consensus         2 Pv~GW~i~pv~~~d   15 (73)
T PF13991_consen    2 PVTGWDIGPVDSYD   15 (73)
T ss_pred             Ccccceeccccccc
Confidence            457898866 5664


No 23 
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family. Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R, Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain.
Probab=50.33  E-value=9.9  Score=34.54  Aligned_cols=17  Identities=35%  Similarity=0.442  Sum_probs=14.3

Q ss_pred             cccceeEeecCCCCCCC
Q psy8255         101 RQARRLYVGNIPFGVTE  117 (117)
Q Consensus       101 RQaRRLYVGNLP~~vtE  117 (117)
                      ...+.|||+|||+.++|
T Consensus       231 ~~~k~LfVgNL~~~~te  247 (578)
T TIGR01648       231 AKVKILYVRNLMTTTTE  247 (578)
T ss_pred             ccccEEEEeCCCCCCCH
Confidence            34578999999999986


No 24 
>KOG0148|consensus
Probab=48.37  E-value=7.9  Score=33.01  Aligned_cols=13  Identities=62%  Similarity=1.004  Sum_probs=11.8

Q ss_pred             eeEeecCCCCCCC
Q psy8255         105 RLYVGNIPFGVTE  117 (117)
Q Consensus       105 RLYVGNLP~~vtE  117 (117)
                      -||||||+.++||
T Consensus       166 sVY~G~I~~~lte  178 (321)
T KOG0148|consen  166 SVYVGNIASGLTE  178 (321)
T ss_pred             eEEeCCcCccccH
Confidence            8999999998876


No 25 
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family. Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).
Probab=47.75  E-value=10  Score=32.69  Aligned_cols=15  Identities=40%  Similarity=0.680  Sum_probs=12.9

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||+|||+.++|
T Consensus       394 s~~L~v~NLp~~~te  408 (481)
T TIGR01649       394 SATLHLSNIPLSVSE  408 (481)
T ss_pred             CcEEEEecCCCCCCH
Confidence            357999999999885


No 26 
>KOG0116|consensus
Probab=46.93  E-value=9.7  Score=33.40  Aligned_cols=12  Identities=33%  Similarity=0.634  Sum_probs=11.0

Q ss_pred             eEeecCCCCCCC
Q psy8255         106 LYVGNIPFGVTE  117 (117)
Q Consensus       106 LYVGNLP~~vtE  117 (117)
                      |||+|||+++++
T Consensus       291 i~V~nlP~da~~  302 (419)
T KOG0116|consen  291 IFVKNLPPDATP  302 (419)
T ss_pred             eEeecCCCCCCH
Confidence            999999999874


No 27 
>KOG1548|consensus
Probab=45.73  E-value=11  Score=33.00  Aligned_cols=15  Identities=27%  Similarity=0.660  Sum_probs=12.4

Q ss_pred             ccceeEeecCCCCCC
Q psy8255         102 QARRLYVGNIPFGVT  116 (117)
Q Consensus       102 QaRRLYVGNLP~~vt  116 (117)
                      +.--|||.|||.+||
T Consensus       133 ~Nt~VYVsgLP~DiT  147 (382)
T KOG1548|consen  133 VNTSVYVSGLPLDIT  147 (382)
T ss_pred             cCceEEecCCCCccc
Confidence            334799999999987


No 28 
>KOG0151|consensus
Probab=44.77  E-value=9.5  Score=36.25  Aligned_cols=16  Identities=50%  Similarity=0.719  Sum_probs=13.5

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      |---||||||++.|+|
T Consensus       173 ~TTNlyv~Nlnpsv~E  188 (877)
T KOG0151|consen  173 QTTNLYVGNLNPSVDE  188 (877)
T ss_pred             cccceeeecCCccccH
Confidence            4448999999999986


No 29 
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.
Probab=44.58  E-value=11  Score=32.67  Aligned_cols=15  Identities=40%  Similarity=0.485  Sum_probs=12.6

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      ...|||+|||+.++|
T Consensus       285 ~~~l~V~nl~~~~~~  299 (562)
T TIGR01628       285 GVNLYVKNLDDTVTD  299 (562)
T ss_pred             CCEEEEeCCCCccCH
Confidence            346999999999885


No 30 
>KOG0796|consensus
Probab=43.68  E-value=11  Score=32.35  Aligned_cols=15  Identities=60%  Similarity=0.986  Sum_probs=6.3

Q ss_pred             ccccccccccccccc
Q psy8255          16 RSRSRDHKKRSRSRD   30 (117)
Q Consensus        16 ~~~~r~~~~Rsr~R~   30 (117)
                      +++.+++++|++++.
T Consensus       267 r~rd~~rr~rd~~r~  281 (319)
T KOG0796|consen  267 RSRDRDRRSRDRSRE  281 (319)
T ss_pred             ccccccccCCccccc
Confidence            444444433433333


No 31 
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family. Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).
Probab=43.06  E-value=19  Score=30.97  Aligned_cols=17  Identities=18%  Similarity=0.081  Sum_probs=13.6

Q ss_pred             cccceeEeecCCC-CCCC
Q psy8255         101 RQARRLYVGNIPF-GVTE  117 (117)
Q Consensus       101 RQaRRLYVGNLP~-~vtE  117 (117)
                      -...-|||+|||+ .+||
T Consensus       273 ~~~~~l~v~nL~~~~vt~  290 (481)
T TIGR01649       273 GPGSVLMVSGLHQEKVNC  290 (481)
T ss_pred             CCCCEEEEeCCCCCCCCH
Confidence            3557999999998 5775


No 32 
>KOG0129|consensus
Probab=42.04  E-value=12  Score=34.05  Aligned_cols=18  Identities=39%  Similarity=0.966  Sum_probs=15.8

Q ss_pred             ccccceeEeecCCCCCCC
Q psy8255         100 TRQARRLYVGNIPFGVTE  117 (117)
Q Consensus       100 SRQaRRLYVGNLP~~vtE  117 (117)
                      -+-++.||||+||++++|
T Consensus       256 ~~~S~KVFvGGlp~dise  273 (520)
T KOG0129|consen  256 PRYSRKVFVGGLPWDITE  273 (520)
T ss_pred             cccccceeecCCCccccH
Confidence            366889999999999987


No 33 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=41.90  E-value=6.1  Score=26.01  Aligned_cols=26  Identities=35%  Similarity=0.562  Sum_probs=16.9

Q ss_pred             HHHHHHHhh-----hccCCCCCCccccccceeEeecC
Q psy8255          80 QYKAMQAAA-----AAAVPVVGSTITRQARRLYVGNI  111 (117)
Q Consensus        80 QaK~mq~ag-----~~~~p~~~~~~SRQaRRLYVGNL  111 (117)
                      |++++|+|=     |++      ..+|+.-|+|+++|
T Consensus        26 Q~Rl~~aALa~FL~QnG------~~~r~~~r~Yl~~l   56 (57)
T PF10929_consen   26 QYRLFQAALAGFLLQNG------CQDRAVTRVYLENL   56 (57)
T ss_pred             HHHHHHHHHHHHHHHcC------chhHHHHHHHHHhc
Confidence            777777542     221      23677779999886


No 34 
>KOG0533|consensus
Probab=40.61  E-value=14  Score=30.14  Aligned_cols=15  Identities=33%  Similarity=0.871  Sum_probs=12.5

Q ss_pred             cceeEeecCCCCCCC
Q psy8255         103 ARRLYVGNIPFGVTE  117 (117)
Q Consensus       103 aRRLYVGNLP~~vtE  117 (117)
                      .=.|||.|||++|++
T Consensus        83 ~~~v~v~NL~~~V~~   97 (243)
T KOG0533|consen   83 STKVNVSNLPYGVID   97 (243)
T ss_pred             cceeeeecCCcCcch
Confidence            337999999999974


No 35 
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.
Probab=39.32  E-value=14  Score=32.03  Aligned_cols=14  Identities=21%  Similarity=0.401  Sum_probs=12.2

Q ss_pred             ceeEeecCCCCCCC
Q psy8255         104 RRLYVGNIPFGVTE  117 (117)
Q Consensus       104 RRLYVGNLP~~vtE  117 (117)
                      ..|||+|||++++|
T Consensus        89 ~~vfV~nLp~~~~~  102 (562)
T TIGR01628        89 GNIFVKNLDKSVDN  102 (562)
T ss_pred             CceEEcCCCccCCH
Confidence            46999999999875


No 36 
>PF15407 Spo7_2_N:  Sporulation protein family 7
Probab=37.11  E-value=19  Score=23.98  Aligned_cols=15  Identities=33%  Similarity=0.609  Sum_probs=12.7

Q ss_pred             ccccceeEeecCCCC
Q psy8255         100 TRQARRLYVGNIPFG  114 (117)
Q Consensus       100 SRQaRRLYVGNLP~~  114 (117)
                      +--+|+|+||.||..
T Consensus        24 s~tSr~vflG~IP~~   38 (67)
T PF15407_consen   24 SLTSRRVFLGPIPEI   38 (67)
T ss_pred             HHcCceEEECCCChH
Confidence            567899999999963


No 37 
>KOG4212|consensus
Probab=36.79  E-value=24  Score=32.22  Aligned_cols=22  Identities=27%  Similarity=0.486  Sum_probs=19.0

Q ss_pred             CCCccccccceeEeecCCCCCC
Q psy8255          95 VGSTITRQARRLYVGNIPFGVT  116 (117)
Q Consensus        95 ~~~~~SRQaRRLYVGNLP~~vt  116 (117)
                      +.+-++|+|-.|||-||||++|
T Consensus       528 ~a~gaarKa~qIiirNlP~dfT  549 (608)
T KOG4212|consen  528 NAVGAARKACQIIIRNLPFDFT  549 (608)
T ss_pred             ccccccccccEEEEecCCcccc
Confidence            4456789999999999999986


No 38 
>KOG0117|consensus
Probab=34.25  E-value=18  Score=32.64  Aligned_cols=19  Identities=32%  Similarity=0.567  Sum_probs=14.2

Q ss_pred             ccccccceeEeecCCCCCC
Q psy8255          98 TITRQARRLYVGNIPFGVT  116 (117)
Q Consensus        98 ~~SRQaRRLYVGNLP~~vt  116 (117)
                      ..|--.-||||||||-+-+
T Consensus       159 c~Svan~RLFiG~IPK~k~  177 (506)
T KOG0117|consen  159 CVSVANCRLFIGNIPKTKK  177 (506)
T ss_pred             EEeeecceeEeccCCcccc
Confidence            3455566999999998754


No 39 
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]
Probab=32.47  E-value=25  Score=28.89  Aligned_cols=13  Identities=23%  Similarity=0.572  Sum_probs=10.7

Q ss_pred             ceeEeecCCCCCC
Q psy8255         104 RRLYVGNIPFGVT  116 (117)
Q Consensus       104 RRLYVGNLP~~vt  116 (117)
                      -=..||||||+++
T Consensus        96 ~~~vVaNlPY~Is  108 (259)
T COG0030          96 PYKVVANLPYNIS  108 (259)
T ss_pred             CCEEEEcCCCccc
Confidence            3568999999886


No 40 
>PF00054 Laminin_G_1:  Laminin G domain;  InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function []. The laminin globular (G) domain can be found in one to several copies in various laminin family members, which includes a large number of extracellular proteins. The C terminus of laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin [].  Laminin G domains can vary in their function, and a variety of binding functions has been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each has five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012680 from INTERPRO).; PDB: 1OKQ_A 1DYK_A 2C5D_A 1H30_A 1LHW_A 1KDK_A 1LHU_A 1KDM_A 1LHO_A 1D2S_A ....
Probab=26.72  E-value=32  Score=24.07  Aligned_cols=9  Identities=56%  Similarity=1.136  Sum_probs=7.9

Q ss_pred             ceeEeecCC
Q psy8255         104 RRLYVGNIP  112 (117)
Q Consensus       104 RRLYVGNLP  112 (117)
                      ..||||+||
T Consensus        93 ~~lyvGG~p  101 (131)
T PF00054_consen   93 GPLYVGGLP  101 (131)
T ss_dssp             SEEEESSSS
T ss_pred             cCEEEccCC
Confidence            459999999


No 41 
>KOG0127|consensus
Probab=25.49  E-value=36  Score=31.72  Aligned_cols=14  Identities=43%  Similarity=0.933  Sum_probs=13.2

Q ss_pred             ceeEeecCCCCCCC
Q psy8255         104 RRLYVGNIPFGVTE  117 (117)
Q Consensus       104 RRLYVGNLP~~vtE  117 (117)
                      +-|||-||||++||
T Consensus       293 ~tVFvRNL~fD~tE  306 (678)
T KOG0127|consen  293 KTVFVRNLPFDTTE  306 (678)
T ss_pred             ceEEEecCCccccH
Confidence            78999999999987


No 42 
>KOG4030|consensus
Probab=25.48  E-value=24  Score=28.08  Aligned_cols=17  Identities=41%  Similarity=0.815  Sum_probs=13.6

Q ss_pred             CCCCCCCCCCCCCChhH
Q psy8255          64 LYWDVPPPGFEHVSPSQ   80 (117)
Q Consensus        64 s~WDv~PpG~E~vta~Q   80 (117)
                      .+.-.||||||.|.-+|
T Consensus       178 nF~h~PPpGFe~IL~EQ  194 (197)
T KOG4030|consen  178 NFTHAPPPGFEEILVEQ  194 (197)
T ss_pred             ccccCCCCChhheeeee
Confidence            46678999999987665


No 43 
>KOG0153|consensus
Probab=23.90  E-value=71  Score=28.02  Aligned_cols=27  Identities=19%  Similarity=0.301  Sum_probs=21.9

Q ss_pred             cCCCCCCccccccceeEeecCCCCCCC
Q psy8255          91 AVPVVGSTITRQARRLYVGNIPFGVTE  117 (117)
Q Consensus        91 ~~p~~~~~~SRQaRRLYVGNLP~~vtE  117 (117)
                      .++.+.|.....-.-||||||-+.++|
T Consensus       216 ~~~~lepPeD~~I~tLyIg~l~d~v~e  242 (377)
T KOG0153|consen  216 SAGTLEPPEDTSIKTLYIGGLNDEVLE  242 (377)
T ss_pred             cccccCCCcccceeEEEecccccchhH
Confidence            345588888888899999999888775


No 44 
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=23.21  E-value=67  Score=19.06  Aligned_cols=15  Identities=33%  Similarity=0.594  Sum_probs=10.9

Q ss_pred             CCCCChhHHHH-HHHh
Q psy8255          73 FEHVSPSQYKA-MQAA   87 (117)
Q Consensus        73 ~E~vta~QaK~-mq~a   87 (117)
                      |++|++++++. |..+
T Consensus        19 fd~v~~~Ka~~im~lA   34 (36)
T PF06200_consen   19 FDDVPPDKAQEIMLLA   34 (36)
T ss_pred             eCCCCHHHHHHHHHHh
Confidence            78899999874 4443


No 45 
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed
Probab=21.80  E-value=45  Score=26.48  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=10.0

Q ss_pred             eeEeecCCCCCC
Q psy8255         105 RLYVGNIPFGVT  116 (117)
Q Consensus       105 RLYVGNLP~~vt  116 (117)
                      -+.||||||.++
T Consensus       107 ~~vv~NlPY~is  118 (272)
T PRK00274        107 LKVVANLPYNIT  118 (272)
T ss_pred             ceEEEeCCccch
Confidence            578999999874


No 46 
>PF06212 GRIM-19:  GRIM-19 protein;  InterPro: IPR009346 This family consists of several eukaryotic gene associated with retinoic-interferon-induced mortality 19 (GRIM-19) proteins. GRIM-19, was reported to encode a small protein primarily distributed in the nucleus and was able to promote cell death induced by IFN-beta and RA. A bovine homologue of GRIM-19 was co-purified with mitochondrial NADH:ubiquinone oxidoreductase (complex I) in bovine heart. Therefore, its exact cellular localisation and function are unclear. It has now been discovered that GRIM-19 is a specific interacting protein which negatively regulates Stat3 activity [].
Probab=21.78  E-value=50  Score=24.57  Aligned_cols=10  Identities=60%  Similarity=1.418  Sum_probs=7.6

Q ss_pred             CCCCC-CCCCC
Q psy8255          67 DVPPP-GFEHV   76 (117)
Q Consensus        67 Dv~Pp-G~E~v   76 (117)
                      |+||| ||..|
T Consensus         8 DmPP~GGY~pv   18 (130)
T PF06212_consen    8 DMPPPGGYPPV   18 (130)
T ss_pred             CCCCCCCCCCC
Confidence            99999 67644


Done!