Query psy8255
Match_columns 117
No_of_seqs 118 out of 166
Neff 4.2
Searched_HMMs 46136
Date Fri Aug 16 22:39:40 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy8255.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8255hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 TIGR01642 U2AF_lg U2 snRNP aux 99.3 3E-12 6.6E-17 106.6 4.5 57 61-117 109-189 (509)
2 KOG0120|consensus 99.2 6.3E-12 1.4E-16 109.9 3.1 57 61-117 114-189 (500)
3 PF06495 Transformer: Fruit fl 98.6 1.1E-08 2.4E-13 80.0 0.3 25 59-83 112-136 (182)
4 TIGR01622 SF-CC1 splicing fact 97.6 4.3E-05 9.2E-10 63.3 2.8 19 99-117 85-103 (457)
5 TIGR01622 SF-CC1 splicing fact 95.2 0.029 6.4E-07 46.5 4.4 15 103-117 186-200 (457)
6 PLN03134 glycine-rich RNA-bind 89.6 0.19 4.1E-06 37.0 1.4 15 103-117 34-48 (144)
7 COG0724 RNA-binding proteins ( 87.5 0.3 6.5E-06 34.8 1.3 15 103-117 115-129 (306)
8 TIGR01642 U2AF_lg U2 snRNP aux 85.4 0.59 1.3E-05 39.3 2.2 17 101-117 293-309 (509)
9 KOG0126|consensus 84.2 0.53 1.1E-05 38.0 1.3 14 104-117 36-49 (219)
10 TIGR01661 ELAV_HUD_SF ELAV/HuD 83.6 0.99 2.1E-05 36.0 2.6 16 102-117 268-283 (352)
11 TIGR01648 hnRNP-R-Q heterogene 80.9 1.2 2.6E-05 40.3 2.4 16 102-117 57-72 (578)
12 TIGR01645 half-pint poly-U bin 80.3 0.86 1.9E-05 41.6 1.3 20 98-117 102-121 (612)
13 KOG0121|consensus 79.5 0.6 1.3E-05 36.0 0.0 18 100-117 33-50 (153)
14 TIGR01659 sex-lethal sex-letha 73.6 1.8 3.9E-05 36.4 1.3 16 102-117 106-121 (346)
15 KOG0132|consensus 71.8 3.8 8.2E-05 39.0 3.1 16 102-117 420-435 (894)
16 KOG0147|consensus 64.9 2.3 5E-05 38.6 0.2 19 99-117 274-292 (549)
17 KOG0125|consensus 64.7 5.4 0.00012 34.7 2.4 18 98-115 91-108 (376)
18 TIGR01659 sex-lethal sex-letha 63.6 3.6 7.9E-05 34.6 1.2 16 102-117 192-207 (346)
19 TIGR01661 ELAV_HUD_SF ELAV/HuD 60.5 4 8.7E-05 32.5 0.9 15 103-117 89-103 (352)
20 TIGR01645 half-pint poly-U bin 56.6 5.5 0.00012 36.5 1.1 16 102-117 203-218 (612)
21 KOG0117|consensus 55.1 10 0.00023 34.1 2.6 16 102-117 82-97 (506)
22 PF13991 BssS: BssS protein fa 52.7 11 0.00023 25.9 1.8 13 62-74 2-15 (73)
23 TIGR01648 hnRNP-R-Q heterogene 50.3 9.9 0.00021 34.5 1.7 17 101-117 231-247 (578)
24 KOG0148|consensus 48.4 7.9 0.00017 33.0 0.8 13 105-117 166-178 (321)
25 TIGR01649 hnRNP-L_PTB hnRNP-L/ 47.7 10 0.00022 32.7 1.3 15 103-117 394-408 (481)
26 KOG0116|consensus 46.9 9.7 0.00021 33.4 1.1 12 106-117 291-302 (419)
27 KOG1548|consensus 45.7 11 0.00023 33.0 1.2 15 102-116 133-147 (382)
28 KOG0151|consensus 44.8 9.5 0.00021 36.2 0.8 16 102-117 173-188 (877)
29 TIGR01628 PABP-1234 polyadenyl 44.6 11 0.00023 32.7 1.0 15 103-117 285-299 (562)
30 KOG0796|consensus 43.7 11 0.00023 32.3 0.8 15 16-30 267-281 (319)
31 TIGR01649 hnRNP-L_PTB hnRNP-L/ 43.1 19 0.00042 31.0 2.3 17 101-117 273-290 (481)
32 KOG0129|consensus 42.0 12 0.00025 34.0 0.8 18 100-117 256-273 (520)
33 PF10929 DUF2811: Protein of u 41.9 6.1 0.00013 26.0 -0.7 26 80-111 26-56 (57)
34 KOG0533|consensus 40.6 14 0.00031 30.1 1.1 15 103-117 83-97 (243)
35 TIGR01628 PABP-1234 polyadenyl 39.3 14 0.00029 32.0 0.8 14 104-117 89-102 (562)
36 PF15407 Spo7_2_N: Sporulation 37.1 19 0.00042 24.0 1.1 15 100-114 24-38 (67)
37 KOG4212|consensus 36.8 24 0.00051 32.2 1.9 22 95-116 528-549 (608)
38 KOG0117|consensus 34.3 18 0.00039 32.6 0.8 19 98-116 159-177 (506)
39 COG0030 KsgA Dimethyladenosine 32.5 25 0.00055 28.9 1.3 13 104-116 96-108 (259)
40 PF00054 Laminin_G_1: Laminin 26.7 32 0.00069 24.1 0.9 9 104-112 93-101 (131)
41 KOG0127|consensus 25.5 36 0.00078 31.7 1.2 14 104-117 293-306 (678)
42 KOG4030|consensus 25.5 24 0.00052 28.1 0.1 17 64-80 178-194 (197)
43 KOG0153|consensus 23.9 71 0.0015 28.0 2.6 27 91-117 216-242 (377)
44 PF06200 tify: tify domain; I 23.2 67 0.0015 19.1 1.7 15 73-87 19-34 (36)
45 PRK00274 ksgA 16S ribosomal RN 21.8 45 0.00098 26.5 1.0 12 105-116 107-118 (272)
46 PF06212 GRIM-19: GRIM-19 prot 21.8 50 0.0011 24.6 1.2 10 67-76 8-18 (130)
No 1
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=99.28 E-value=3e-12 Score=106.62 Aligned_cols=57 Identities=46% Similarity=0.675 Sum_probs=44.2
Q ss_pred cCCCCCCCCCCCCCCCChhHHHHHHH---hhh---------------------ccCCCCCCccccccceeEeecCCCCCC
Q psy8255 61 KASLYWDVPPPGFEHVSPSQYKAMQA---AAA---------------------AAVPVVGSTITRQARRLYVGNIPFGVT 116 (117)
Q Consensus 61 k~~s~WDv~PpG~E~vta~QaK~mq~---ag~---------------------~~~p~~~~~~SRQaRRLYVGNLP~~vt 116 (117)
+....||.+|++|+.+++.|++++++ ++. .+++++.+++++++++|||||||+++|
T Consensus 109 ~~~~~~d~~p~~~~~~~~~~~~~~~~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~lyVgnLp~~~t 188 (509)
T TIGR01642 109 KKRSLWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQATRQARRLYVGGIPPEFV 188 (509)
T ss_pred ccccccccCCCcccccchHHHhhccccCCCCCCCCCCCCCcccccccccccCCccccccCccCCccccEEEEeCCCCCCC
Confidence 34578999999999999999997642 220 011235678899999999999999998
Q ss_pred C
Q psy8255 117 E 117 (117)
Q Consensus 117 E 117 (117)
|
T Consensus 189 ~ 189 (509)
T TIGR01642 189 E 189 (509)
T ss_pred H
Confidence 6
No 2
>KOG0120|consensus
Probab=99.21 E-value=6.3e-12 Score=109.89 Aligned_cols=57 Identities=51% Similarity=0.916 Sum_probs=48.2
Q ss_pred cCCCCCCCCCCCCCCCCh---hHHHHHHHhhh----------------ccCCCCCCccccccceeEeecCCCCCCC
Q psy8255 61 KASLYWDVPPPGFEHVSP---SQYKAMQAAAA----------------AAVPVVGSTITRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 61 k~~s~WDv~PpG~E~vta---~QaK~mq~ag~----------------~~~p~~~~~~SRQaRRLYVGNLP~~vtE 117 (117)
+....||++|+|||.+|+ +++++|++.|+ ++.+++++++|+|+++|||||||++++|
T Consensus 114 r~~~~~~~~~~~fe~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~q~~r~~v~~~~~~~~e 189 (500)
T KOG0120|consen 114 RKRSLWDVPPEGFETITPDGAKLYKNFNATGQVPGDLSNPKKSLKLPQLPTPPMDSQATRQARRLYVGNIPFTSNE 189 (500)
T ss_pred cchhhhcCCCCCCcccCchhhhhhhhccccCCCCCCccccccccccccCCCCccCcchhhhhhhhcccccCCccCc
Confidence 556789999999999999 77777777653 2345788999999999999999999987
No 3
>PF06495 Transformer: Fruit fly transformer protein; InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly). The transformer locus (tra) produces an RNA processing protein that alternatively splices the doublesex pre-mRNA in the sex determination hierarchy of Drosophila melanogaster [].; GO: 0006397 mRNA processing, 0046660 female sex differentiation, 0005634 nucleus
Probab=98.58 E-value=1.1e-08 Score=79.96 Aligned_cols=25 Identities=40% Similarity=0.550 Sum_probs=19.5
Q ss_pred hccCCCCCCCCCCCCCCCChhHHHH
Q psy8255 59 RRKASLYWDVPPPGFEHVSPSQYKA 83 (117)
Q Consensus 59 ~rk~~s~WDv~PpG~E~vta~QaK~ 83 (117)
+++.+.+|||||+|||++++.+.+.
T Consensus 112 PkiI~~yv~VPp~gf~~~y~~~~~~ 136 (182)
T PF06495_consen 112 PKIITKYVDVPPPGFEYAYGWPPPA 136 (182)
T ss_pred CCeeeeeccCCCcccccccCCCCcc
Confidence 4445789999999999999955443
No 4
>TIGR01622 SF-CC1 splicing factor, CC1-like family. A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
Probab=97.59 E-value=4.3e-05 Score=63.32 Aligned_cols=19 Identities=21% Similarity=0.405 Sum_probs=16.7
Q ss_pred cccccceeEeecCCCCCCC
Q psy8255 99 ITRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 99 ~SRQaRRLYVGNLP~~vtE 117 (117)
..+..+.|||||||+.++|
T Consensus 85 ~~~~~~~l~V~nlp~~~~~ 103 (457)
T TIGR01622 85 AERDDRTVFVLQLALKARE 103 (457)
T ss_pred cccCCcEEEEeCCCCCCCH
Confidence 4778899999999999985
No 5
>TIGR01622 SF-CC1 splicing factor, CC1-like family. A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
Probab=95.18 E-value=0.029 Score=46.55 Aligned_cols=15 Identities=53% Similarity=0.935 Sum_probs=13.5
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||||||+++||
T Consensus 186 ~~~l~v~nl~~~~te 200 (457)
T TIGR01622 186 FLKLYVGNLHFNITE 200 (457)
T ss_pred CCEEEEcCCCCCCCH
Confidence 478999999999986
No 6
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=89.58 E-value=0.19 Score=37.04 Aligned_cols=15 Identities=20% Similarity=0.864 Sum_probs=13.1
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||+|||++++|
T Consensus 34 ~~~lfVgnL~~~~te 48 (144)
T PLN03134 34 STKLFIGGLSWGTDD 48 (144)
T ss_pred CCEEEEeCCCCCCCH
Confidence 448999999999986
No 7
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]
Probab=87.54 E-value=0.3 Score=34.75 Aligned_cols=15 Identities=53% Similarity=1.061 Sum_probs=13.6
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||||||+.+||
T Consensus 115 ~~~l~v~nL~~~~~~ 129 (306)
T COG0724 115 NNTLFVGNLPYDVTE 129 (306)
T ss_pred CceEEEeCCCCCCCH
Confidence 589999999999986
No 8
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=85.41 E-value=0.59 Score=39.30 Aligned_cols=17 Identities=35% Similarity=0.798 Sum_probs=14.4
Q ss_pred cccceeEeecCCCCCCC
Q psy8255 101 RQARRLYVGNIPFGVTE 117 (117)
Q Consensus 101 RQaRRLYVGNLP~~vtE 117 (117)
-..+.|||||||+.+||
T Consensus 293 ~~~~~l~v~nlp~~~~~ 309 (509)
T TIGR01642 293 DSKDRIYIGNLPLYLGE 309 (509)
T ss_pred CCCCEEEEeCCCCCCCH
Confidence 34589999999999985
No 9
>KOG0126|consensus
Probab=84.24 E-value=0.53 Score=38.04 Aligned_cols=14 Identities=36% Similarity=0.973 Sum_probs=12.7
Q ss_pred ceeEeecCCCCCCC
Q psy8255 104 RRLYVGNIPFGVTE 117 (117)
Q Consensus 104 RRLYVGNLP~~vtE 117 (117)
==||||||||.+||
T Consensus 36 A~Iyiggl~~~LtE 49 (219)
T KOG0126|consen 36 AYIYIGGLPYELTE 49 (219)
T ss_pred eEEEECCCcccccC
Confidence 37999999999998
No 10
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor. These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).
Probab=83.58 E-value=0.99 Score=35.95 Aligned_cols=16 Identities=19% Similarity=0.220 Sum_probs=13.0
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
....|||+|||+.++|
T Consensus 268 ~~~~lfV~NL~~~~~e 283 (352)
T TIGR01661 268 AGYCIFVYNLSPDTDE 283 (352)
T ss_pred CCcEEEEeCCCCCCCH
Confidence 3346999999999875
No 11
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family. Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R, Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain.
Probab=80.90 E-value=1.2 Score=40.27 Aligned_cols=16 Identities=31% Similarity=0.623 Sum_probs=13.8
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
+.-.|||||||++++|
T Consensus 57 ~~~~lFVgnLp~~~tE 72 (578)
T TIGR01648 57 RGCEVFVGKIPRDLYE 72 (578)
T ss_pred CCCEEEeCCCCCCCCH
Confidence 4468999999999986
No 12
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.
Probab=80.29 E-value=0.86 Score=41.57 Aligned_cols=20 Identities=35% Similarity=0.559 Sum_probs=16.1
Q ss_pred ccccccceeEeecCCCCCCC
Q psy8255 98 TITRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 98 ~~SRQaRRLYVGNLP~~vtE 117 (117)
++.....+|||||||+.++|
T Consensus 102 ~a~~~~~rLfVGnLp~~~tE 121 (612)
T TIGR01645 102 QALAIMCRVYVGSISFELRE 121 (612)
T ss_pred hhhcCCCEEEEcCCCCCCCH
Confidence 44456679999999999986
No 13
>KOG0121|consensus
Probab=79.52 E-value=0.6 Score=35.96 Aligned_cols=18 Identities=44% Similarity=0.728 Sum_probs=15.4
Q ss_pred ccccceeEeecCCCCCCC
Q psy8255 100 TRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 100 SRQaRRLYVGNLP~~vtE 117 (117)
.+++--||||||.|-++|
T Consensus 33 ~r~S~tvyVgNlSfyttE 50 (153)
T KOG0121|consen 33 LRKSCTVYVGNLSFYTTE 50 (153)
T ss_pred HhhcceEEEeeeeeeecH
Confidence 567778999999998886
No 14
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=73.61 E-value=1.8 Score=36.39 Aligned_cols=16 Identities=25% Similarity=0.443 Sum_probs=13.9
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
....|||+|||+++||
T Consensus 106 ~~~~LfVgnLp~~~te 121 (346)
T TIGR01659 106 SGTNLIVNYLPQDMTD 121 (346)
T ss_pred CCcEEEEeCCCCCCCH
Confidence 4568999999999986
No 15
>KOG0132|consensus
Probab=71.83 E-value=3.8 Score=39.01 Aligned_cols=16 Identities=56% Similarity=0.831 Sum_probs=13.7
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
-++.||||.||-.|+|
T Consensus 420 ~SrTLwvG~i~k~v~e 435 (894)
T KOG0132|consen 420 CSRTLWVGGIPKNVTE 435 (894)
T ss_pred eeeeeeeccccchhhH
Confidence 5678999999998886
No 16
>KOG0147|consensus
Probab=64.93 E-value=2.3 Score=38.62 Aligned_cols=19 Identities=58% Similarity=0.962 Sum_probs=15.1
Q ss_pred cccccceeEeecCCCCCCC
Q psy8255 99 ITRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 99 ~SRQaRRLYVGNLP~~vtE 117 (117)
++.--.+||||||.|+++|
T Consensus 274 ~~~p~~rl~vgnLHfNite 292 (549)
T KOG0147|consen 274 FTGPMRRLYVGNLHFNITE 292 (549)
T ss_pred cccchhhhhhcccccCchH
Confidence 3555566999999999986
No 17
>KOG0125|consensus
Probab=64.72 E-value=5.4 Score=34.68 Aligned_cols=18 Identities=39% Similarity=0.636 Sum_probs=14.9
Q ss_pred ccccccceeEeecCCCCC
Q psy8255 98 TITRQARRLYVGNIPFGV 115 (117)
Q Consensus 98 ~~SRQaRRLYVGNLP~~v 115 (117)
.++=..+||||.||||.-
T Consensus 91 ~s~~~pkRLhVSNIPFrF 108 (376)
T KOG0125|consen 91 SSKDTPKRLHVSNIPFRF 108 (376)
T ss_pred CCCCCCceeEeecCCccc
Confidence 456788999999999953
No 18
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=63.64 E-value=3.6 Score=34.56 Aligned_cols=16 Identities=38% Similarity=0.700 Sum_probs=13.7
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
....|||+|||+.+||
T Consensus 192 ~~~~lfV~nLp~~vte 207 (346)
T TIGR01659 192 KDTNLYVTNLPRTITD 207 (346)
T ss_pred ccceeEEeCCCCcccH
Confidence 4567999999999986
No 19
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor. These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).
Probab=60.54 E-value=4 Score=32.46 Aligned_cols=15 Identities=33% Similarity=0.623 Sum_probs=12.9
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||+|||+.++|
T Consensus 89 ~~~l~v~~l~~~~~~ 103 (352)
T TIGR01661 89 GANLYVSGLPKTMTQ 103 (352)
T ss_pred cceEEECCccccCCH
Confidence 457999999999885
No 20
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.
Probab=56.57 E-value=5.5 Score=36.48 Aligned_cols=16 Identities=25% Similarity=0.517 Sum_probs=13.6
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
...+|||||||+.++|
T Consensus 203 ~~~rLfVgnLp~~vte 218 (612)
T TIGR01645 203 KFNRIYVASVHPDLSE 218 (612)
T ss_pred ccceEEeecCCCCCCH
Confidence 4579999999999875
No 21
>KOG0117|consensus
Probab=55.12 E-value=10 Score=34.12 Aligned_cols=16 Identities=38% Similarity=0.650 Sum_probs=13.4
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
+-=.||||.||-++.|
T Consensus 82 ~G~EVfvGkIPrD~~E 97 (506)
T KOG0117|consen 82 RGCEVFVGKIPRDVFE 97 (506)
T ss_pred CCceEEecCCCccccc
Confidence 3449999999999887
No 22
>PF13991 BssS: BssS protein family
Probab=52.73 E-value=11 Score=25.92 Aligned_cols=13 Identities=23% Similarity=0.756 Sum_probs=8.8
Q ss_pred CCCCCCCCC-CCCC
Q psy8255 62 ASLYWDVPP-PGFE 74 (117)
Q Consensus 62 ~~s~WDv~P-pG~E 74 (117)
|-++|||-| ++|.
T Consensus 2 Pv~GW~i~pv~~~d 15 (73)
T PF13991_consen 2 PVTGWDIGPVDSYD 15 (73)
T ss_pred Ccccceeccccccc
Confidence 457898866 5664
No 23
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family. Sequences in this subfamily include the human heterogeneous nuclear ribonucleoproteins (hnRNP) R, Q and APOBEC-1 complementation factor (aka APOBEC-1 stimulating protein). These proteins contain three RNA recognition domains (rrm: pfam00076) and a somewhat variable C-terminal domain.
Probab=50.33 E-value=9.9 Score=34.54 Aligned_cols=17 Identities=35% Similarity=0.442 Sum_probs=14.3
Q ss_pred cccceeEeecCCCCCCC
Q psy8255 101 RQARRLYVGNIPFGVTE 117 (117)
Q Consensus 101 RQaRRLYVGNLP~~vtE 117 (117)
...+.|||+|||+.++|
T Consensus 231 ~~~k~LfVgNL~~~~te 247 (578)
T TIGR01648 231 AKVKILYVRNLMTTTTE 247 (578)
T ss_pred ccccEEEEeCCCCCCCH
Confidence 34578999999999986
No 24
>KOG0148|consensus
Probab=48.37 E-value=7.9 Score=33.01 Aligned_cols=13 Identities=62% Similarity=1.004 Sum_probs=11.8
Q ss_pred eeEeecCCCCCCC
Q psy8255 105 RLYVGNIPFGVTE 117 (117)
Q Consensus 105 RLYVGNLP~~vtE 117 (117)
-||||||+.++||
T Consensus 166 sVY~G~I~~~lte 178 (321)
T KOG0148|consen 166 SVYVGNIASGLTE 178 (321)
T ss_pred eEEeCCcCccccH
Confidence 8999999998876
No 25
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family. Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).
Probab=47.75 E-value=10 Score=32.69 Aligned_cols=15 Identities=40% Similarity=0.680 Sum_probs=12.9
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||+|||+.++|
T Consensus 394 s~~L~v~NLp~~~te 408 (481)
T TIGR01649 394 SATLHLSNIPLSVSE 408 (481)
T ss_pred CcEEEEecCCCCCCH
Confidence 357999999999885
No 26
>KOG0116|consensus
Probab=46.93 E-value=9.7 Score=33.40 Aligned_cols=12 Identities=33% Similarity=0.634 Sum_probs=11.0
Q ss_pred eEeecCCCCCCC
Q psy8255 106 LYVGNIPFGVTE 117 (117)
Q Consensus 106 LYVGNLP~~vtE 117 (117)
|||+|||+++++
T Consensus 291 i~V~nlP~da~~ 302 (419)
T KOG0116|consen 291 IFVKNLPPDATP 302 (419)
T ss_pred eEeecCCCCCCH
Confidence 999999999874
No 27
>KOG1548|consensus
Probab=45.73 E-value=11 Score=33.00 Aligned_cols=15 Identities=27% Similarity=0.660 Sum_probs=12.4
Q ss_pred ccceeEeecCCCCCC
Q psy8255 102 QARRLYVGNIPFGVT 116 (117)
Q Consensus 102 QaRRLYVGNLP~~vt 116 (117)
+.--|||.|||.+||
T Consensus 133 ~Nt~VYVsgLP~DiT 147 (382)
T KOG1548|consen 133 VNTSVYVSGLPLDIT 147 (382)
T ss_pred cCceEEecCCCCccc
Confidence 334799999999987
No 28
>KOG0151|consensus
Probab=44.77 E-value=9.5 Score=36.25 Aligned_cols=16 Identities=50% Similarity=0.719 Sum_probs=13.5
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
|---||||||++.|+|
T Consensus 173 ~TTNlyv~Nlnpsv~E 188 (877)
T KOG0151|consen 173 QTTNLYVGNLNPSVDE 188 (877)
T ss_pred cccceeeecCCccccH
Confidence 4448999999999986
No 29
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.
Probab=44.58 E-value=11 Score=32.67 Aligned_cols=15 Identities=40% Similarity=0.485 Sum_probs=12.6
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
...|||+|||+.++|
T Consensus 285 ~~~l~V~nl~~~~~~ 299 (562)
T TIGR01628 285 GVNLYVKNLDDTVTD 299 (562)
T ss_pred CCEEEEeCCCCccCH
Confidence 346999999999885
No 30
>KOG0796|consensus
Probab=43.68 E-value=11 Score=32.35 Aligned_cols=15 Identities=60% Similarity=0.986 Sum_probs=6.3
Q ss_pred ccccccccccccccc
Q psy8255 16 RSRSRDHKKRSRSRD 30 (117)
Q Consensus 16 ~~~~r~~~~Rsr~R~ 30 (117)
+++.+++++|++++.
T Consensus 267 r~rd~~rr~rd~~r~ 281 (319)
T KOG0796|consen 267 RSRDRDRRSRDRSRE 281 (319)
T ss_pred ccccccccCCccccc
Confidence 444444433433333
No 31
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family. Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).
Probab=43.06 E-value=19 Score=30.97 Aligned_cols=17 Identities=18% Similarity=0.081 Sum_probs=13.6
Q ss_pred cccceeEeecCCC-CCCC
Q psy8255 101 RQARRLYVGNIPF-GVTE 117 (117)
Q Consensus 101 RQaRRLYVGNLP~-~vtE 117 (117)
-...-|||+|||+ .+||
T Consensus 273 ~~~~~l~v~nL~~~~vt~ 290 (481)
T TIGR01649 273 GPGSVLMVSGLHQEKVNC 290 (481)
T ss_pred CCCCEEEEeCCCCCCCCH
Confidence 3557999999998 5775
No 32
>KOG0129|consensus
Probab=42.04 E-value=12 Score=34.05 Aligned_cols=18 Identities=39% Similarity=0.966 Sum_probs=15.8
Q ss_pred ccccceeEeecCCCCCCC
Q psy8255 100 TRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 100 SRQaRRLYVGNLP~~vtE 117 (117)
-+-++.||||+||++++|
T Consensus 256 ~~~S~KVFvGGlp~dise 273 (520)
T KOG0129|consen 256 PRYSRKVFVGGLPWDITE 273 (520)
T ss_pred cccccceeecCCCccccH
Confidence 366889999999999987
No 33
>PF10929 DUF2811: Protein of unknown function (DUF2811); InterPro: IPR021231 This is a bacterial family of uncharacterised proteins.
Probab=41.90 E-value=6.1 Score=26.01 Aligned_cols=26 Identities=35% Similarity=0.562 Sum_probs=16.9
Q ss_pred HHHHHHHhh-----hccCCCCCCccccccceeEeecC
Q psy8255 80 QYKAMQAAA-----AAAVPVVGSTITRQARRLYVGNI 111 (117)
Q Consensus 80 QaK~mq~ag-----~~~~p~~~~~~SRQaRRLYVGNL 111 (117)
|++++|+|= |++ ..+|+.-|+|+++|
T Consensus 26 Q~Rl~~aALa~FL~QnG------~~~r~~~r~Yl~~l 56 (57)
T PF10929_consen 26 QYRLFQAALAGFLLQNG------CQDRAVTRVYLENL 56 (57)
T ss_pred HHHHHHHHHHHHHHHcC------chhHHHHHHHHHhc
Confidence 777777542 221 23677779999886
No 34
>KOG0533|consensus
Probab=40.61 E-value=14 Score=30.14 Aligned_cols=15 Identities=33% Similarity=0.871 Sum_probs=12.5
Q ss_pred cceeEeecCCCCCCC
Q psy8255 103 ARRLYVGNIPFGVTE 117 (117)
Q Consensus 103 aRRLYVGNLP~~vtE 117 (117)
.=.|||.|||++|++
T Consensus 83 ~~~v~v~NL~~~V~~ 97 (243)
T KOG0533|consen 83 STKVNVSNLPYGVID 97 (243)
T ss_pred cceeeeecCCcCcch
Confidence 337999999999974
No 35
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family. There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.
Probab=39.32 E-value=14 Score=32.03 Aligned_cols=14 Identities=21% Similarity=0.401 Sum_probs=12.2
Q ss_pred ceeEeecCCCCCCC
Q psy8255 104 RRLYVGNIPFGVTE 117 (117)
Q Consensus 104 RRLYVGNLP~~vtE 117 (117)
..|||+|||++++|
T Consensus 89 ~~vfV~nLp~~~~~ 102 (562)
T TIGR01628 89 GNIFVKNLDKSVDN 102 (562)
T ss_pred CceEEcCCCccCCH
Confidence 46999999999875
No 36
>PF15407 Spo7_2_N: Sporulation protein family 7
Probab=37.11 E-value=19 Score=23.98 Aligned_cols=15 Identities=33% Similarity=0.609 Sum_probs=12.7
Q ss_pred ccccceeEeecCCCC
Q psy8255 100 TRQARRLYVGNIPFG 114 (117)
Q Consensus 100 SRQaRRLYVGNLP~~ 114 (117)
+--+|+|+||.||..
T Consensus 24 s~tSr~vflG~IP~~ 38 (67)
T PF15407_consen 24 SLTSRRVFLGPIPEI 38 (67)
T ss_pred HHcCceEEECCCChH
Confidence 567899999999963
No 37
>KOG4212|consensus
Probab=36.79 E-value=24 Score=32.22 Aligned_cols=22 Identities=27% Similarity=0.486 Sum_probs=19.0
Q ss_pred CCCccccccceeEeecCCCCCC
Q psy8255 95 VGSTITRQARRLYVGNIPFGVT 116 (117)
Q Consensus 95 ~~~~~SRQaRRLYVGNLP~~vt 116 (117)
+.+-++|+|-.|||-||||++|
T Consensus 528 ~a~gaarKa~qIiirNlP~dfT 549 (608)
T KOG4212|consen 528 NAVGAARKACQIIIRNLPFDFT 549 (608)
T ss_pred ccccccccccEEEEecCCcccc
Confidence 4456789999999999999986
No 38
>KOG0117|consensus
Probab=34.25 E-value=18 Score=32.64 Aligned_cols=19 Identities=32% Similarity=0.567 Sum_probs=14.2
Q ss_pred ccccccceeEeecCCCCCC
Q psy8255 98 TITRQARRLYVGNIPFGVT 116 (117)
Q Consensus 98 ~~SRQaRRLYVGNLP~~vt 116 (117)
..|--.-||||||||-+-+
T Consensus 159 c~Svan~RLFiG~IPK~k~ 177 (506)
T KOG0117|consen 159 CVSVANCRLFIGNIPKTKK 177 (506)
T ss_pred EEeeecceeEeccCCcccc
Confidence 3455566999999998754
No 39
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]
Probab=32.47 E-value=25 Score=28.89 Aligned_cols=13 Identities=23% Similarity=0.572 Sum_probs=10.7
Q ss_pred ceeEeecCCCCCC
Q psy8255 104 RRLYVGNIPFGVT 116 (117)
Q Consensus 104 RRLYVGNLP~~vt 116 (117)
-=..||||||+++
T Consensus 96 ~~~vVaNlPY~Is 108 (259)
T COG0030 96 PYKVVANLPYNIS 108 (259)
T ss_pred CCEEEEcCCCccc
Confidence 3568999999886
No 40
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function []. The laminin globular (G) domain can be found in one to several copies in various laminin family members, which includes a large number of extracellular proteins. The C terminus of laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin []. Laminin G domains can vary in their function, and a variety of binding functions has been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each has five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012680 from INTERPRO).; PDB: 1OKQ_A 1DYK_A 2C5D_A 1H30_A 1LHW_A 1KDK_A 1LHU_A 1KDM_A 1LHO_A 1D2S_A ....
Probab=26.72 E-value=32 Score=24.07 Aligned_cols=9 Identities=56% Similarity=1.136 Sum_probs=7.9
Q ss_pred ceeEeecCC
Q psy8255 104 RRLYVGNIP 112 (117)
Q Consensus 104 RRLYVGNLP 112 (117)
..||||+||
T Consensus 93 ~~lyvGG~p 101 (131)
T PF00054_consen 93 GPLYVGGLP 101 (131)
T ss_dssp SEEEESSSS
T ss_pred cCEEEccCC
Confidence 459999999
No 41
>KOG0127|consensus
Probab=25.49 E-value=36 Score=31.72 Aligned_cols=14 Identities=43% Similarity=0.933 Sum_probs=13.2
Q ss_pred ceeEeecCCCCCCC
Q psy8255 104 RRLYVGNIPFGVTE 117 (117)
Q Consensus 104 RRLYVGNLP~~vtE 117 (117)
+-|||-||||++||
T Consensus 293 ~tVFvRNL~fD~tE 306 (678)
T KOG0127|consen 293 KTVFVRNLPFDTTE 306 (678)
T ss_pred ceEEEecCCccccH
Confidence 78999999999987
No 42
>KOG4030|consensus
Probab=25.48 E-value=24 Score=28.08 Aligned_cols=17 Identities=41% Similarity=0.815 Sum_probs=13.6
Q ss_pred CCCCCCCCCCCCCChhH
Q psy8255 64 LYWDVPPPGFEHVSPSQ 80 (117)
Q Consensus 64 s~WDv~PpG~E~vta~Q 80 (117)
.+.-.||||||.|.-+|
T Consensus 178 nF~h~PPpGFe~IL~EQ 194 (197)
T KOG4030|consen 178 NFTHAPPPGFEEILVEQ 194 (197)
T ss_pred ccccCCCCChhheeeee
Confidence 46678999999987665
No 43
>KOG0153|consensus
Probab=23.90 E-value=71 Score=28.02 Aligned_cols=27 Identities=19% Similarity=0.301 Sum_probs=21.9
Q ss_pred cCCCCCCccccccceeEeecCCCCCCC
Q psy8255 91 AVPVVGSTITRQARRLYVGNIPFGVTE 117 (117)
Q Consensus 91 ~~p~~~~~~SRQaRRLYVGNLP~~vtE 117 (117)
.++.+.|.....-.-||||||-+.++|
T Consensus 216 ~~~~lepPeD~~I~tLyIg~l~d~v~e 242 (377)
T KOG0153|consen 216 SAGTLEPPEDTSIKTLYIGGLNDEVLE 242 (377)
T ss_pred cccccCCCcccceeEEEecccccchhH
Confidence 345588888888899999999888775
No 44
>PF06200 tify: tify domain; InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability. Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include: Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ]. A. thaliana ZIM-like proteins (ZML) []. A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].
Probab=23.21 E-value=67 Score=19.06 Aligned_cols=15 Identities=33% Similarity=0.594 Sum_probs=10.9
Q ss_pred CCCCChhHHHH-HHHh
Q psy8255 73 FEHVSPSQYKA-MQAA 87 (117)
Q Consensus 73 ~E~vta~QaK~-mq~a 87 (117)
|++|++++++. |..+
T Consensus 19 fd~v~~~Ka~~im~lA 34 (36)
T PF06200_consen 19 FDDVPPDKAQEIMLLA 34 (36)
T ss_pred eCCCCHHHHHHHHHHh
Confidence 78899999874 4443
No 45
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed
Probab=21.80 E-value=45 Score=26.48 Aligned_cols=12 Identities=33% Similarity=0.661 Sum_probs=10.0
Q ss_pred eeEeecCCCCCC
Q psy8255 105 RLYVGNIPFGVT 116 (117)
Q Consensus 105 RLYVGNLP~~vt 116 (117)
-+.||||||.++
T Consensus 107 ~~vv~NlPY~is 118 (272)
T PRK00274 107 LKVVANLPYNIT 118 (272)
T ss_pred ceEEEeCCccch
Confidence 578999999874
No 46
>PF06212 GRIM-19: GRIM-19 protein; InterPro: IPR009346 This family consists of several eukaryotic gene associated with retinoic-interferon-induced mortality 19 (GRIM-19) proteins. GRIM-19, was reported to encode a small protein primarily distributed in the nucleus and was able to promote cell death induced by IFN-beta and RA. A bovine homologue of GRIM-19 was co-purified with mitochondrial NADH:ubiquinone oxidoreductase (complex I) in bovine heart. Therefore, its exact cellular localisation and function are unclear. It has now been discovered that GRIM-19 is a specific interacting protein which negatively regulates Stat3 activity [].
Probab=21.78 E-value=50 Score=24.57 Aligned_cols=10 Identities=60% Similarity=1.418 Sum_probs=7.6
Q ss_pred CCCCC-CCCCC
Q psy8255 67 DVPPP-GFEHV 76 (117)
Q Consensus 67 Dv~Pp-G~E~v 76 (117)
|+||| ||..|
T Consensus 8 DmPP~GGY~pv 18 (130)
T PF06212_consen 8 DMPPPGGYPPV 18 (130)
T ss_pred CCCCCCCCCCC
Confidence 99999 67644
Done!