Diaphorina citri psyllid: psy8260


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------
MSVSPPLVFGLELLETGRLLSRTLTDGTLSRSIVRLWTVYPASKLPSRRLHDHFNQPYSEICRGVIDIGPTLSKESFDLIFSSALDSVSGVKVAIKKIARPFQSAVHAKRTYRELRMLKHMNHENVIGLLDVFHSNTCLADFKNVYMVTHLMGADLNNILRTQKLSDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTGVPFYFQDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTDIHQLNLIMEMLGTPPAEFMAKISSDSARKYINSLPLLTKKDFRQVFKGANPQAIDLLSLMLELDSEKRITAEQALAHPYLSQYSDPNDEPTSPPYDQSFEDMDLPVDQWKGTYSLESLV
ccccccccccHHHHHHHcccccccccccccHHHHHHHHcccccccccccEEEEEcccEEEEcccCECccccccccccEEEEEEEEccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccCEEEEEcccccHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHcccccHHHHHHcccHHHHHHHHcccccccccHHHHcccccHHHHHHHHHHccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccc
****PPLVFGLELLE******************************PSRRLHDHFNQPYSEICRGVIDIGPTLSKESFDLIFSSALDSVSGVKVAIKKIARPFQSAVHAKRTYRELRMLKHMNHENVIGLLDVFHSNTCLADFKNVYMVTHLMGADLNNILRTQKLSDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTGVPFYFQDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTDIHQLNLIMEMLGTPPAEFMAKISSDSARKYINSLPLLTKKDFRQVFKGANPQAIDLLSLMLELDSEKRITAEQALAHPYLSQYSDPNDEPTSPPYDQSFEDMDLPVDQWKGTYSLESLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSPPLVFGLELLETGRLLSRTLTDGTLSRSIVRLWTVYPASKLPSRRLHDHFNQPYSEICRGVIDIGPTLSKESFDLIFSSALDSVSGVKVAIKKIARPFQSAVHAKRTYRELRMLKHMNHENVIGLLDVFHSNTCLADFKNVYMVTHLMGADLNNILRTQKLSDDHVQFLVYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTGVPFYFQDLKPSNIAVNEDCELKILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYNQTDIHQLNLIMEMLGTPPAEFMAKISSDSARKYINSLPLLTKKDFRQVFKGANPQAIDLLSLMLELDSEKRITAEQALAHPYLSQYSDPNDEPTSPPYDQSFEDMDLPVDQWKGTYSLESLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase 14 Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additionnal targets. RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1. RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2. MAPK14 interacts also with casein kinase II, leading to its activation through autophosphorylation and further phosphorylation of TP53/p53. In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. In a similar way, MAPK14 phosphorylates the ubiquitin ligase SIAH2, regulating its activity towards EGLN3. MAPK14 may also inhibit the lysosomal degradation pathway of autophagy by interfering with the intracellular trafficking of the transmembrane protein ATG9. Another function of MAPK14 is to regulate the endocytosis of membrane receptors by different mechanisms that impinge on the small GTPase RAB5A. In addition, clathrin-mediated EGFR internalization induced by inflammatory cytokines and UV irradiation depends on MAPK14-mediated phosphorylation of EGFR itself as well as of RAB5A effectors. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Another p38 MAPK substrate is FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates CDC25B and CDC25C which is required for binding to 14-3-3 proteins and leads to initiation of a G2 delay after ultraviolet radiation. Phosphorylates TIAR following DNA damage, releasing TIAR from GADD45A mRNA and preventing mRNA degradation. The p38 MAPKs may also have kinase-independent roles, which are thought to be due to the binding to targets in the absence of phosphorylation. Protein O-Glc-N-acylation catalyzed by the OGT is regulated by MAPK14, and, although OGT does not seem to be phosphorylated by MAPK14, their interaction increases upon MAPK14 activation induced by glucose deprivation. This interaction may regulate OGT activity by recruiting it to specific targets such as neurofilament H, stimulating its O-Glc-N-acylation. Required in mid-fetal development for the growth of embryo-derived blood vessels in the labyrinth layer of the placenta. Also plays an essential role in developmental and stress-induced erythropoiesis, through regulation of EPO gene expression.confidentP47811
Mitogen-activated protein kinase 14 Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additionnal targets. RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1. RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2. MAPK14 interacts also with casein kinase II, leading to its activation through autophosphorylation and further phosphorylation of TP53/p53. In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. In a similar way, MAPK14 phosphorylates the ubiquitin ligase SIAH2, regulating its activity towards EGLN3. MAPK14 may also inhibit the lysosomal degradation pathway of autophagy by interfering with the intracellular trafficking of the transmembrane protein ATG9. Another function of MAPK14 is to regulate the endocytosis of membrane receptors by different mechanisms that impinge on the small GTPase RAB5A. In addition, clathrin-mediated EGFR internalization induced by inflammatory cytokines and UV irradiation depends on MAPK14-mediated phosphorylation of EGFR itself as well as of RAB5A effectors. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Another p38 MAPK substrate is FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates CDC25B and CDC25C which is required for binding to 14-3-3 proteins and leads to initiation of a G2 delay after ultraviolet radiation. Phosphorylates TIAR following DNA damage, releasing TIAR from GADD45A mRNA and preventing mRNA degradation. The p38 MAPKs may also have kinase-independent roles, which are thought to be due to the binding to targets in the absence of phosphorylation. Protein O-Glc-N-acylation catalyzed by the OGT is regulated by MAPK14, and, although OGT does not seem to be phosphorylated by MAPK14, their interaction increases upon MAPK14 activation induced by glucose deprivation. This interaction may regulate OGT activity by recruiting it to specific targets such as neurofilament H, stimulating its O-Glc-N-acylation. Required in mid-fetal development for the growth of embryo-derived blood vessels in the labyrinth layer of the placenta. Also plays an essential role in developmental and stress-induced erythropoiesis, through regulation of EPO gene expression. Isoform MXI2 activation is stimulated by mitogens and oxidative stress and only poorly phosphorylates ELK1 and ATF2. Isoform EXIP may play a role in the early onset of apoptosis.confidentQ16539
Mitogen-activated protein kinase 14A Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Mapk14a is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additionnal targets. Required for cytokinesis on the future dorsal side of the blastodisc, suggesting a role in symmetrical and synchronous blastomere cleavage.confidentQ9DGE2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000165 [BP]MAPK cascadeconfidentGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0048856 [BP]anatomical structure developmentconfidentGO:0032502, GO:0008150
GO:0007275 [BP]multicellular organismal developmentconfidentGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:1901701 [BP]cellular response to oxygen-containing compoundconfidentGO:1901700, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0044444 [CC]cytoplasmic partconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004707 [MF]MAP kinase activityconfidentGO:0016301, GO:0004674, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0060089, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0006468 [BP]protein phosphorylationconfidentGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0033554 [BP]cellular response to stressconfidentGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0040016 [BP]embryonic cleavageprobableGO:0032502, GO:0009987, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0032501, GO:0044763, GO:0044699, GO:0008150, GO:0007275, GO:0051301
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0051403 [BP]stress-activated MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0000165, GO:0031098, GO:0050794, GO:0008150, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0035924 [BP]cellular response to vascular endothelial growth factor stimulusprobableGO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0044445 [CC]cytosolic partprobableGO:0005737, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0023014 [BP]signal transduction by phosphorylationprobableGO:0044700, GO:0051716, GO:0008152, GO:0016310, GO:0050896, GO:0009987, GO:0044237, GO:0050794, GO:0008150, GO:0006796, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0006793, GO:0007154, GO:0050789, GO:0044699
GO:0032495 [BP]response to muramyl dipeptideprobableGO:1901700, GO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:1901652, GO:0042221, GO:1901698
GO:0071276 [BP]cellular response to cadmium ionprobableGO:0051716, GO:0071248, GO:0010038, GO:0050896, GO:0009987, GO:0071241, GO:0008150, GO:0044763, GO:0070887, GO:0046686, GO:0042221, GO:0010035, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0071243 [BP]cellular response to arsenic-containing substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0046685, GO:0044699
GO:0045087 [BP]innate immune responseprobableGO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0002062 [BP]chondrocyte differentiationprobableGO:0032502, GO:0051216, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0009888, GO:0061448, GO:0008150, GO:0001501, GO:0048513, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0031663 [BP]lipopolysaccharide-mediated signaling pathwayprobableGO:0071222, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0032496, GO:0050789, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0065007, GO:0071219, GO:0071216, GO:0044700, GO:0009987, GO:0071396, GO:0050794, GO:0044763, GO:0007154, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0008150
GO:0034614 [BP]cellular response to reactive oxygen speciesprobableGO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0030510 [BP]regulation of BMP signaling pathwayprobableGO:0090092, GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0009574 [CC]preprophase bandprobableGO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0050832 [BP]defense response to fungusprobableGO:0009607, GO:0009620, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0045445 [BP]myoblast differentiationprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0032755 [BP]positive regulation of interleukin-6 productionprobableGO:0051240, GO:0050789, GO:0001817, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0032675, GO:0001819
GO:0044711 [BP]single-organism biosynthetic processprobableGO:0009058, GO:0008150, GO:0044710, GO:0008152
GO:0050829 [BP]defense response to Gram-negative bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0051707, GO:0051704
GO:0071479 [BP]cellular response to ionizing radiationprobableGO:0009628, GO:0051716, GO:0071478, GO:0010212, GO:0009314, GO:0050896, GO:0009987, GO:0044763, GO:0008150, GO:0071214, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0009749 [BP]response to glucose stimulusprobableGO:0009746, GO:1901700, GO:0009743, GO:0034284, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0019731 [BP]antibacterial humoral responseprobableGO:0002376, GO:0009607, GO:0019730, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0042742, GO:0006955, GO:0006959, GO:0051707, GO:0051704
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:1901615 [BP]organic hydroxy compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006006 [BP]glucose metabolic processprobableGO:0044238, GO:0005975, GO:0005996, GO:0019318, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0048610 [BP]cellular process involved in reproductionprobableGO:0009987, GO:0008150, GO:0000003
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0006913 [BP]nucleocytoplasmic transportprobableGO:0051169, GO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0007519 [BP]skeletal muscle tissue developmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0044767, GO:0061061, GO:0014706, GO:0048513, GO:0008150, GO:0060537, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0019725 [BP]cellular homeostasisprobableGO:0009987, GO:0042592, GO:0065007, GO:0008150, GO:0044763, GO:0065008, GO:0044699
GO:0044732 [CC]mitotic spindle pole bodyprobableGO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0045648 [BP]positive regulation of erythrocyte differentiationprobableGO:0051094, GO:0050793, GO:0045646, GO:0065007, GO:0032844, GO:0045597, GO:0050789, GO:0045595, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0050794, GO:0045637, GO:0048522
GO:0034142 [BP]toll-like receptor 4 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0042770 [BP]signal transduction in response to DNA damageprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:2000017 [BP]positive regulation of determination of dorsal identityprobableGO:0051094, GO:0050793, GO:0051240, GO:2000015, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0019395 [BP]fatty acid oxidationprobableGO:0034440, GO:0006631, GO:0006629, GO:0006082, GO:0044238, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0030258, GO:0055114, GO:0044281
GO:0009636 [BP]response to toxic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0006935 [BP]chemotaxisprobableGO:0040011, GO:0042330, GO:0009605, GO:0050896, GO:0008150, GO:0042221
GO:0036180 [BP]filamentous growth of a population of unicellular organisms in response to biotic stimulusprobableGO:0009607, GO:0040007, GO:0050896, GO:0044182, GO:0008150, GO:0030447, GO:0044699
GO:0090400 [BP]stress-induced premature senescenceprobableGO:0032502, GO:0051716, GO:0009987, GO:0007568, GO:0007569, GO:0050896, GO:0044767, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0051525 [MF]NFAT protein bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0048082 [BP]regulation of adult chitin-containing cuticle pigmentationprobableGO:0048079, GO:0007564, GO:0048070, GO:0008150, GO:0050793, GO:2000026, GO:0051239, GO:0065007, GO:0050789
GO:0006928 [BP]cellular component movementprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0048011 [BP]neurotrophin TRK receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0080135 [BP]regulation of cellular response to stressprobableGO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0034138 [BP]toll-like receptor 3 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034134 [BP]toll-like receptor 2 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0034130 [BP]toll-like receptor 1 signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0071702 [BP]organic substance transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0035666 [BP]TRIF-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002756, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0030168 [BP]platelet activationprobableGO:0009987, GO:0007599, GO:0050878, GO:0044707, GO:0006950, GO:0032501, GO:0007596, GO:0009611, GO:0042060, GO:0065007, GO:0001775, GO:0050817, GO:0044763, GO:0008150, GO:0065008, GO:0050896, GO:0044699
GO:0051090 [BP]regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0016482 [BP]cytoplasmic transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0009524 [CC]phragmoplastprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0051146 [BP]striated muscle cell differentiationprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0051149 [BP]positive regulation of muscle cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0051147, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0016909 [MF]SAP kinase activityprobableGO:0016301, GO:0060089, GO:0016773, GO:0005057, GO:0003824, GO:0004702, GO:0016740, GO:0004674, GO:0004707, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0030427 [CC]site of polarized growthprobableGO:0005575, GO:0044464, GO:0005623
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045793 [BP]positive regulation of cell sizeprobableGO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0008361, GO:0065007, GO:0044763, GO:0044699, GO:0008150, GO:0065008, GO:0032535
GO:0071444 [BP]cellular response to pheromoneprobableGO:0051716, GO:0050896, GO:0009987, GO:0010033, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0019236, GO:0044699
GO:0002755 [BP]MyD88-dependent toll-like receptor signaling pathwayprobableGO:0048584, GO:0048583, GO:0031349, GO:0023052, GO:0007165, GO:0050789, GO:0031347, GO:0051716, GO:0002764, GO:0002684, GO:0002682, GO:0044699, GO:0002224, GO:0065007, GO:0002221, GO:0045089, GO:0045088, GO:0009987, GO:0050794, GO:0048518, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002757, GO:0080134, GO:0002758, GO:0050778, GO:0002376, GO:0002218, GO:0002253, GO:0044763, GO:0050896
GO:0000077 [BP]DNA damage checkpointprobableGO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0008348 [BP]negative regulation of antimicrobial humoral responseprobableGO:0050777, GO:0050776, GO:0048583, GO:0048585, GO:0065007, GO:0002831, GO:0002921, GO:0002759, GO:0008150, GO:0043900, GO:0043901, GO:0002920, GO:0002683, GO:0002682, GO:0048519, GO:0002832, GO:0050789
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699
GO:0008063 [BP]Toll signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0070935 [BP]3'-UTR-mediated mRNA stabilizationprobableGO:0019222, GO:0043489, GO:0043488, GO:0043487, GO:0010608, GO:0050789, GO:0060255, GO:0065007, GO:0048255, GO:0008150, GO:0065008, GO:0010468
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:2000379 [BP]positive regulation of reactive oxygen species metabolic processprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:2000377, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0030316 [BP]osteoclast differentiationprobableGO:0032502, GO:0002376, GO:0048856, GO:0044707, GO:0008150, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0048731, GO:0002573, GO:0044767, GO:0048513, GO:0044763, GO:0044699, GO:0030099, GO:0030097, GO:0048534, GO:0007275, GO:0002521, GO:0002520
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0043536 [BP]positive regulation of blood vessel endothelial cell migrationprobableGO:0010634, GO:0051272, GO:0030335, GO:0030334, GO:0010595, GO:0010594, GO:0010632, GO:0040017, GO:0040012, GO:0051239, GO:0043535, GO:0051270, GO:2000145, GO:0008150, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0004708 [MF]MAP kinase kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0004712, GO:0004672, GO:0003674
GO:0019953 [BP]sexual reproductionprobableGO:0008150, GO:0000003
GO:0071474 [BP]cellular hyperosmotic responseprobableGO:0009628, GO:0051716, GO:0009987, GO:0006972, GO:0050896, GO:0071470, GO:0008150, GO:0006950, GO:0006970, GO:0033554, GO:0044763, GO:0071214, GO:0044699
GO:0002385 [BP]mucosal immune responseprobableGO:0002376, GO:0008150, GO:0050896, GO:0002251, GO:0006955
GO:0042539 [BP]hypotonic salinity responseprobableGO:0009628, GO:0050896, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0009651
GO:0051101 [BP]regulation of DNA bindingprobableGO:0008150, GO:0065009, GO:0051098, GO:0065007
GO:0048010 [BP]vascular endothelial growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0042307 [BP]positive regulation of protein import into nucleusprobableGO:1900180, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0033157, GO:0051049, GO:0032386, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0046824, GO:0065007, GO:0046822, GO:0048518, GO:0042306, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0034504 [BP]protein localization to nucleusprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0009723 [BP]response to ethylene stimulusprobableGO:0009719, GO:0009725, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0070321 [BP]regulation of translation in response to nitrogen starvationprobableGO:0009991, GO:0080090, GO:0019222, GO:0051246, GO:0031323, GO:0042594, GO:0032268, GO:0050789, GO:0044699, GO:0051716, GO:0043562, GO:0010608, GO:2000112, GO:0065007, GO:0031326, GO:0010468, GO:0071496, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0006950, GO:0031669, GO:0044763, GO:0009267, GO:0007154, GO:0031668, GO:0006995, GO:0043555, GO:0009605, GO:0050896, GO:0031667, GO:0010556, GO:0033554, GO:0006417, GO:0008150

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.24Mitogen-activated protein kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FST, chain X
Confidence level:very confident
Coverage over the Query: 64-211,227-264,282-286,302-425
View the alignment between query and template
View the model in PyMOL
Template: 3A62, chain A
Confidence level:very confident
Coverage over the Query: 60-101,114-216,286-391
View the alignment between query and template
View the model in PyMOL
Template: 3PG1, chain A
Confidence level:very confident
Coverage over the Query: 249-275,289-376
View the alignment between query and template
View the model in PyMOL
Template: 1KOA, chain A
Confidence level:probable
Coverage over the Query: 33-236
View the alignment between query and template
View the model in PyMOL