Query         psy8271
Match_columns 65
No_of_seqs    37 out of 39
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 23:09:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8271.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8271hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2715|consensus              100.0 1.7E-36 3.8E-41  218.5   1.0   63    2-65     98-160 (210)
  2 KOG2716|consensus               95.9  0.0038 8.2E-08   45.8   1.3   25    2-26     81-105 (230)
  3 KOG1665|consensus               78.9    0.77 1.7E-05   35.4   0.5   19    2-20     87-105 (302)
  4 PF14695 LINES_C:  Lines C-term  76.9     1.8 3.9E-05   24.6   1.5   11    9-19     24-34  (39)
  5 KOG2723|consensus               59.9     2.4 5.3E-05   31.1  -0.4   19    2-20     86-104 (221)
  6 PF00651 BTB:  BTB/POZ domain;   57.7     6.2 0.00013   22.9   1.1   22    3-24     88-109 (111)
  7 PF09103 BRCA-2_OB1:  BRCA2, ol  53.7     6.3 0.00014   26.0   0.8   38   20-61      4-44  (118)
  8 KOG2714|consensus               49.0     7.7 0.00017   31.7   0.7   14    3-16     89-102 (465)
  9 PF01466 Skp1:  Skp1 family, di  46.8      11 0.00024   22.5   1.0   23    3-25     20-42  (78)
 10 PF11791 Aconitase_B_N:  Aconit  35.9      17 0.00037   25.7   0.8   12    9-20     94-105 (154)
 11 PF07539 DRIM:  Down-regulated   35.9      18 0.00038   24.3   0.8   47   11-57     90-138 (141)
 12 PF03965 Penicillinase_R:  Peni  32.3      96  0.0021   19.2   3.7   39   14-52     37-75  (115)
 13 PF14703 DUF4463:  Domain of un  29.3      47   0.001   19.2   1.8   14    9-22      3-16  (85)
 14 KOG0887|consensus               25.3      24 0.00052   24.1   0.0    7    4-10     43-49  (111)
 15 PF10678 DUF2492:  Protein of u  25.0      41 0.00088   21.3   1.0   22    1-22     12-33  (78)
 16 PHA03098 kelch-like protein; P  22.9      46 0.00099   25.2   1.1   23    3-25     82-104 (534)
 17 KOG0972|consensus               21.4      30 0.00065   27.7  -0.1   39   14-52    316-354 (384)
 18 PF01329 Pterin_4a:  Pterin 4 a  21.3      67  0.0015   19.8   1.5   18   45-63      6-23  (95)
 19 PF10498 IFT57:  Intra-flagella  21.2      38 0.00083   26.2   0.4   43   10-52    305-347 (359)
 20 PF00558 Vpu:  Vpu protein;  In  21.1      61  0.0013   20.7   1.3   13   46-58     62-74  (81)
 21 KOG0212|consensus               21.0      24 0.00051   30.2  -0.8   29    1-29    155-183 (675)
 22 PF13783 DUF4177:  Domain of un  20.8      30 0.00065   19.6  -0.2    9   56-64     30-38  (61)
 23 cd04751 Commd3 COMM_Domain con  20.8      46   0.001   20.8   0.7   20   40-59     67-86  (95)
 24 PF07097 DUF1359:  Protein of u  20.7      52  0.0011   22.1   0.9   17    9-25     70-86  (102)
 25 PF14135 DUF4302:  Domain of un  20.6      46   0.001   23.5   0.7   18   46-63     18-35  (235)
 26 COG0799 Uncharacterized homolo  20.6      39 0.00086   22.6   0.4   13    4-16     93-105 (115)
 27 PF09974 DUF2209:  Uncharacteri  20.2      35 0.00077   23.6   0.1   12    2-13     73-84  (128)
 28 PHA00692 hypothetical protein   20.1      39 0.00084   21.4   0.2   18   48-65     57-74  (74)

No 1  
>KOG2715|consensus
Probab=100.00  E-value=1.7e-36  Score=218.48  Aligned_cols=63  Identities=62%  Similarity=0.994  Sum_probs=61.8

Q ss_pred             ccccccccChHHHHHHHHHhhhhhccccccccCCCceeeeeccchhHHHhhhhhcCCCcccccC
Q psy8271           2 YTQEAEFYNIAELVRLIKDRICTRDSLSVKDANKKHVYRVIQCHEDELTQMVSTMSDGWKFEQV   65 (65)
Q Consensus         2 VLEEAEFYNI~~LI~likdri~erd~~~~q~~~~k~VyRVLqc~e~eLt~mvStmSdgWkfeQL   65 (65)
                      |||||||||+++||+||||||++||++++|. +.|||||||||||+|||||+|||||||||+||
T Consensus        98 vL~EAefyn~~~li~likd~i~dRd~~~tq~-~~k~vyrvLqcqeeeltqmvStmsDgw~~~ql  160 (210)
T KOG2715|consen   98 VLEEAEFYNDPSLIQLIKDRIQDRDAMVTQE-ADKFVYRVLQCQEEELTQMVSTMSDGWKIEQL  160 (210)
T ss_pred             cchhhhccCChHHHHHHHHHHHHHhhhcccc-chhHHHHHHHHHHHHHHHHHhhccccHhHHHH
Confidence            7999999999999999999999999999999 99999999999999999999999999999996


No 2  
>KOG2716|consensus
Probab=95.88  E-value=0.0038  Score=45.83  Aligned_cols=25  Identities=36%  Similarity=0.450  Sum_probs=22.5

Q ss_pred             ccccccccChHHHHHHHHHhhhhhc
Q psy8271           2 YTQEAEFYNIAELVRLIKDRICTRD   26 (65)
Q Consensus         2 VLEEAEFYNI~~LI~likdri~erd   26 (65)
                      ++.||+||.+..||.+|+.+|....
T Consensus        81 l~~EA~fYlL~~Lv~~C~~~i~~~~  105 (230)
T KOG2716|consen   81 LLREAEFYLLDGLVELCQSAIARLI  105 (230)
T ss_pred             HHHHHHHhhHHHHHHHHHHHhhhcc
Confidence            5789999999999999999987664


No 3  
>KOG1665|consensus
Probab=78.94  E-value=0.77  Score=35.43  Aligned_cols=19  Identities=32%  Similarity=0.532  Sum_probs=17.7

Q ss_pred             ccccccccChHHHHHHHHH
Q psy8271           2 YTQEAEFYNIAELVRLIKD   20 (65)
Q Consensus         2 VLEEAEFYNI~~LI~likd   20 (65)
                      |||||.||-|-+|+.-++|
T Consensus        87 vLeeArff~i~sL~~hle~  105 (302)
T KOG1665|consen   87 VLEEARFFQILSLKDHLED  105 (302)
T ss_pred             HHHHhhHHhhHhHHhHHhh
Confidence            7999999999999988888


No 4  
>PF14695 LINES_C:  Lines C-terminus
Probab=76.91  E-value=1.8  Score=24.55  Aligned_cols=11  Identities=45%  Similarity=0.851  Sum_probs=10.1

Q ss_pred             cChHHHHHHHH
Q psy8271           9 YNIAELVRLIK   19 (65)
Q Consensus         9 YNI~~LI~lik   19 (65)
                      ||+++|+++++
T Consensus        24 YN~~pLLrlL~   34 (39)
T PF14695_consen   24 YNPSPLLRLLE   34 (39)
T ss_pred             CChHHHHHHHH
Confidence            99999999876


No 5  
>KOG2723|consensus
Probab=59.88  E-value=2.4  Score=31.12  Aligned_cols=19  Identities=26%  Similarity=0.536  Sum_probs=14.2

Q ss_pred             ccccccccChHHHHHHHHH
Q psy8271           2 YTQEAEFYNIAELVRLIKD   20 (65)
Q Consensus         2 VLEEAEFYNI~~LI~likd   20 (65)
                      +.+||+||+|+.+......
T Consensus        86 L~rEA~f~~l~~~~~~l~~  104 (221)
T KOG2723|consen   86 LVREAEFFQLEAPVTYLLN  104 (221)
T ss_pred             HHHHHHHHccccHHHHHhc
Confidence            4689999999966665443


No 6  
>PF00651 BTB:  BTB/POZ domain;  InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation []. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule []. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [, , ]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.; GO: 0005515 protein binding; PDB: 3M5B_A 1R28_B 3LBZ_A 3E4U_F 3BIM_B 1R2B_A 1R29_A 2VPK_A 2YY9_B 3GA1_A ....
Probab=57.74  E-value=6.2  Score=22.92  Aligned_cols=22  Identities=18%  Similarity=0.146  Sum_probs=19.0

Q ss_pred             cccccccChHHHHHHHHHhhhh
Q psy8271           3 TQEAEFYNIAELVRLIKDRICT   24 (65)
Q Consensus         3 LEEAEFYNI~~LI~likdri~e   24 (65)
                      |+=|++|+|+.|++.|.+.|.+
T Consensus        88 l~lA~~~~~~~L~~~~~~~l~~  109 (111)
T PF00651_consen   88 LELADKLQIPELKKACEKFLQE  109 (111)
T ss_dssp             HHHHHHTTBHHHHHHHHHHHHH
T ss_pred             HHHHHHhCcHHHHHHHHHHHHh
Confidence            5568999999999999998854


No 7  
>PF09103 BRCA-2_OB1:  BRCA2, oligonucleotide/oligosaccharide-binding, domain 1;  InterPro: IPR015187 This domain assumes an OB fold, which consists of a highly curved five-stranded beta-sheet that closes on itself to form a beta-barrel. OB1 has a shallow groove formed by one face of the curved sheet and is demarcated by two loops, one between beta 1 and beta 2 and another between beta 4 and beta 5, which allows for weak single strand DNA binding. The domain also binds the 70-amino acid DSS1 (deleted in split-hand/split foot syndrome) protein, which was originally identified as one of three genes that map to a 1.5-Mb locus deleted in an inherited developmental malformation syndrome []. ; GO: 0000724 double-strand break repair via homologous recombination; PDB: 1IYJ_D 1MIU_A.
Probab=53.65  E-value=6.3  Score=26.00  Aligned_cols=38  Identities=26%  Similarity=0.387  Sum_probs=17.5

Q ss_pred             HhhhhhccccccccCCCceeeeecc---chhHHHhhhhhcCCCcc
Q psy8271          20 DRICTRDSLSVKDANKKHVYRVIQC---HEDELTQMVSTMSDGWK   61 (65)
Q Consensus        20 dri~erd~~~~q~~~~k~VyRVLqc---~e~eLt~mvStmSdgWk   61 (65)
                      .||.|+|...+..    -|.-|..=   ....-....=.+||||=
T Consensus         4 rrI~E~D~~~~~~----mVL~Vs~i~~~~~~~~~~~~lelTDGWY   44 (118)
T PF09103_consen    4 RRILEGDDSASKP----MVLCVSSISSSDNDSPESAILELTDGWY   44 (118)
T ss_dssp             HHHHTTSSTTB-S----EEEEEEE-------------EEEE-SS-
T ss_pred             HHHhhCCCCcCCc----EEEEEEEEccCCCCCCccCEEEEecCCE
Confidence            5899999775443    35555553   22222334446889995


No 8  
>KOG2714|consensus
Probab=49.00  E-value=7.7  Score=31.72  Aligned_cols=14  Identities=43%  Similarity=0.790  Sum_probs=12.6

Q ss_pred             cccccccChHHHHH
Q psy8271           3 TQEAEFYNIAELVR   16 (65)
Q Consensus         3 LEEAEFYNI~~LI~   16 (65)
                      ..||+||-|+||++
T Consensus        89 hdEA~fYGl~~llr  102 (465)
T KOG2714|consen   89 HDEAMFYGLTPLLR  102 (465)
T ss_pred             hhhhhhcCcHHHHH
Confidence            35999999999998


No 9  
>PF01466 Skp1:  Skp1 family, dimerisation domain;  InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex []. It was found to bind several F-box containing proteins (e.g., Cdc4, Skp2, cyclin F) and to be involved in the ubiquitin protein degradation pathway. A yeast homologue of SKP1 (P52286) was identified in the centromere bound kinetochore complex [] and is also involved in the ubiquitin pathway []. In Dictyostelium discoideum (Slime mold) FP21 was shown to be glycosylated in the cytosol and has homology to SKP1 []. This entry represents a dimerisation domain found at the C-terminal of SKP1 proteins [], as well as in subunit D of the centromere DNA-binding protein complex Cbf3 []. This domain is multi-helical in structure, and consists of an interlocked herterodimer in F-box proteins.; GO: 0006511 ubiquitin-dependent protein catabolic process; PDB: 2P1O_A 3OGL_G 3OGM_A 3C6O_A 2P1N_A 2P1Q_A 3OGK_I 3C6N_A 3C6P_A 2P1P_A ....
Probab=46.80  E-value=11  Score=22.48  Aligned_cols=23  Identities=22%  Similarity=0.297  Sum_probs=18.1

Q ss_pred             cccccccChHHHHHHHHHhhhhh
Q psy8271           3 TQEAEFYNIAELVRLIKDRICTR   25 (65)
Q Consensus         3 LEEAEFYNI~~LI~likdri~er   25 (65)
                      +.-|.|.||.+|+.++-..|..+
T Consensus        20 ~~AA~yL~I~~L~~~~~~~iA~~   42 (78)
T PF01466_consen   20 LNAANYLDIKGLLDLCCKYIANM   42 (78)
T ss_dssp             HHHHHHHT-HHHHHHHHHHHHHH
T ss_pred             HHHHHHHcchHHHHHHHHHHHHH
Confidence            56689999999999998777554


No 10 
>PF11791 Aconitase_B_N:  Aconitate B N-terminal domain;  InterPro: IPR015933 Aconitase (aconitate hydratase; 4.2.1.3 from EC) is an iron-sulphur protein that contains a [4Fe-4S]-cluster and catalyses the interconversion of isocitrate and citrate via a cis-aconitate intermediate. Aconitase functions in both the TCA and glyoxylate cycles, however unlike the majority of iron-sulphur proteins that function as electron carriers, the [4Fe-4S]-cluster of aconitase reacts directly with an enzyme substrate. In eukaryotes there is a cytosolic form (cAcn) and a mitochondrial form (mAcn) of the enzyme. In bacteria there are also 2 forms, aconitase A (AcnA) and B (AcnB). Several aconitases are known to be multi-functional enzymes with a second non-catalytic, but essential function that arises when the cellular environment changes, such as when iron levels drop [, ]. Eukaryotic cAcn and mAcn, and bacterial AcnA have the same domain organisation, consisting of three N-terminal alpha/beta/alpha domains, a linker region, followed by a C-terminal 'swivel' domain with a beta/beta/alpha structure (1-2-3-linker-4), although mAcn is small than cAcn. However, bacterial AcnB has a different organisation: it contains an N-terminal HEAT-like domain, followed by the 'swivel' domain, then the three alpha/beta/alpha domains (HEAT-4-1-2-3) []. Below is a description of some of the multi-functional activities associated with different aconitases.   Eukaryotic mAcn catalyses the second step of the mitochondrial TCA cycle, which is important for energy production, providing high energy electrons in the form of NADH and FADH2 to the mitochondrial oxidative phosphorylation pathway []. The TCA cycle also provides precursors for haem and amino acid production. This enzyme has a second, non-catalytic but essential role in mitochondrial DNA (mtDNA) maintenance: mAcn acts to stabilise mtDNA, forming part of mtDNA protein-DNA complexes known as nucleoids. mAcn is thought to reversibly model nucleoids to directly influence mitochondrial gene expression in response to changes in the cellular environment. Therefore, mAcn can influence the expression of components of the oxidative phosphorylation pathway encoded in mtDNA.      Eukaryotic cAcn enzyme balances the amount of citrate and isocitrate in the cytoplasm, which in turn creates a balance between the amount of NADPH generated from isocitrate by isocitrate dehydrogenase with the amount of acetyl-CoA generated from citrate by citrate lyase. Fatty acid synthesis requires both NADPH and acetyl-CoA, as do other metabolic processes, including the need for NADPH to combat oxidative stress. The enzymatic form of cAcn predominates when iron levels are normal, but if they drop sufficiently to cause the disassembly of the [4Fe-4S]-cluster, then cAcn undergoes a conformational change from a compact enzyme to a more open L-shaped protein known as iron regulatory protein 1 (IRP1; or IRE-binding protein 1, IREBP1) [, ]. As IRP1, the catalytic site and the [4Fe-4S]-cluster are lost, and two new RNA-binding sites appear. IRP1 functions in the post-transcriptional regulation of genes involved in iron metabolism - it binds to mRNA iron-responsive elements (IRE), 30-nucleotide stem-loop structures at the 3' or 5' end of specific transcripts. Transcripts containing an IRE include ferritin L and H subunits (iron storage), transferrin (iron plasma chaperone), transferrin receptor (iron uptake into cells), ferroportin (iron exporter), mAcn, succinate dehydrogenase, erythroid aminolevulinic acid synthetase (tetrapyrrole biosynthesis), among others. If the IRE is in the 5'-UTR of the transcript (e.g. in ferritin mRNA), then IRP1-binding prevents its translation by blocking the transcript from binding to the ribosome. If the IRE is in the 3'-UTR of the transcript (e.g. transferrin receptor), then IRP1-binding protects it from endonuclease degradation, thereby prolonging the half-life of the transcript and enabling it to be translated [].     IRP2 is another IRE-binding protein that binds to the same transcripts as IRP1. However, since IRP1 is predominantly in the enzymatic cAcn form, it is IRP2 that acts as the major metabolic regulator that maintains iron homeostasis []. Although IRP2 is homologous to IRP1, IRP2 lacks aconitase activity, and is known only to have a single function in the post-transcriptional regulation of iron metabolism genes []. In iron-replete cells, IRP2 activity is regulated primarily by iron-dependent degradation through the ubiquitin-proteasomal system.     Bacterial AcnB is also known to be multi-functional. In addition to its role in the TCA cycle, AcnB was shown to be a post-transcriptional regulator of gene expression in Escherichia coli and Salmonella enterica [, ]. In S. enterica, AcnB initiates a regulatory cascade controlling flagella biosynthesis through an interaction with the ftsH transcript, an alternative RNA polymerase sigma factor. This binding lowers the intracellular concentration of FtsH protease, which in turn enhances the amount of RNA polymerase sigma32 factor (normally degraded by FtsH protease), and sigma32 then increases the synthesis of chaperone DnaK, which in turn promotes the synthesis of the flagellar protein FliC. AcnB regulates the synthesis of other proteins as well, such as superoxide dismutase (SodA) and other enzymes involved in oxidative stress.    This entry represents the N-terminal HEAT-like domain, which is present in bacterial aconitase (AcnB), but not in AcnA or eukaryotic cAcn/IRP2 or mAcn. This domain is multi-helical, forming two curved layers in a right-handed alpha-alpha superhelix. HEAT-like domains are usually implicated in protein-protein interactions. The HEAT-like domain and the 'swivel' domain that follows it were shown to be sufficient for dimerisation and for AcnB binding to mRNA. An iron-mediated dimerisation mechanism may be responsible for switching AcnB between its catalytic and regulatory roles, as dimerisation requires iron while mRNA binding is inhibited by iron. More information about these proteins can be found at Protein of the Month: Aconitase [].; GO: 0003994 aconitate hydratase activity, 0006099 tricarboxylic acid cycle; PDB: 1L5J_B.
Probab=35.93  E-value=17  Score=25.75  Aligned_cols=12  Identities=42%  Similarity=0.869  Sum_probs=9.8

Q ss_pred             cChHHHHHHHHH
Q psy8271           9 YNIAELVRLIKD   20 (65)
Q Consensus         9 YNI~~LI~likd   20 (65)
                      |||.+||.+++.
T Consensus        94 YNV~~LI~~L~~  105 (154)
T PF11791_consen   94 YNVQPLIDLLKS  105 (154)
T ss_dssp             TTHHHHHHGG--
T ss_pred             CcHHHHHHHHcC
Confidence            999999999943


No 11 
>PF07539 DRIM:  Down-regulated in metastasis;  InterPro: IPR011430 These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691 from SWISSPROT), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells []. It is believed to be involved in processing of non-coding RNA [].
Probab=35.92  E-value=18  Score=24.34  Aligned_cols=47  Identities=17%  Similarity=0.360  Sum_probs=35.1

Q ss_pred             hHHHHHHHHHhhhhhccccccc-cCCCceeeee-ccchhHHHhhhhhcC
Q psy8271          11 IAELVRLIKDRICTRDSLSVKD-ANKKHVYRVI-QCHEDELTQMVSTMS   57 (65)
Q Consensus        11 I~~LI~likdri~erd~~~~q~-~~~k~VyRVL-qc~e~eLt~mvStmS   57 (65)
                      |+=+++++--||..|-.+.++. +-++-|.|.| +|+++|+...++-|.
T Consensus        90 ~pvvlRILygk~~~~~~~~~~~~~rR~aIL~~L~~l~~~El~~Fl~l~~  138 (141)
T PF07539_consen   90 MPVVLRILYGKMQSRKGSGSKKASRRAAILRFLAGLSEEELGLFLDLML  138 (141)
T ss_pred             HHHHHHHHHHHHhhcCCCCCcchHHHHHHHHHHhCCCHHHHHHHHHHHh
Confidence            5668999999998887654443 2456688887 789999998877553


No 12 
>PF03965 Penicillinase_R:  Penicillinase repressor;  InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea. Many are BlaI/MecI proteins which regulate resistance to penicillins (beta-lactams), though at least one protein (Q47839 from SWISSPROT) appears to be involved in the regulation of copper homeostasis []. BlaI regulators repress the expression of penicillin-degrading enzymes (penicillinases) until the cell encounters the antiobiotic, at which point repression ceases and penicillinase expression occurs, allowing cell growth []. MecI regulators repress the expression of MecA, a cell-wall biosynthetic enzyme not inhibited by penicillins at clinically achievable concentrations, until the presence of the antibiotic is detected []. At this point repression ends and MecA expression occurs which, together with the switching off of the penicillin-sensitive enzymes, allows the cell to grow despite the presence of antibiotic.; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2G9W_A 2K4B_A 1XSD_A 1SD4_A 1SD7_A 1SD6_A 2P7C_B 1P6R_A 1OKR_B 2D45_B ....
Probab=32.25  E-value=96  Score=19.20  Aligned_cols=39  Identities=21%  Similarity=0.319  Sum_probs=24.4

Q ss_pred             HHHHHHHhhhhhccccccccCCCceeeeeccchhHHHhh
Q psy8271          14 LVRLIKDRICTRDSLSVKDANKKHVYRVIQCHEDELTQM   52 (65)
Q Consensus        14 LI~likdri~erd~~~~q~~~~k~VyRVLqc~e~eLt~m   52 (65)
                      =|+-+-.|+.++..-..+...+.++|+++.-+++=+.+.
T Consensus        37 Tv~t~L~rL~~Kg~l~~~~~gr~~~Y~p~is~~e~~~~~   75 (115)
T PF03965_consen   37 TVQTLLNRLVEKGFLTREKIGRAYVYSPLISREEYLAQE   75 (115)
T ss_dssp             HHHHHHHHHHHTTSEEEEEETTCEEEEESSSHHHHHHHH
T ss_pred             HHHHHHHHHHhCCceeEeecCCceEEEeCCcHHHHHHHH
Confidence            355566677777653222214779999998877744433


No 13 
>PF14703 DUF4463:  Domain of unknown function (DUF4463)
Probab=29.33  E-value=47  Score=19.23  Aligned_cols=14  Identities=21%  Similarity=0.446  Sum_probs=11.6

Q ss_pred             cChHHHHHHHHHhh
Q psy8271           9 YNIAELVRLIKDRI   22 (65)
Q Consensus         9 YNI~~LI~likdri   22 (65)
                      ||...|.+|+++|-
T Consensus         3 rd~~~L~~Lv~~R~   16 (85)
T PF14703_consen    3 RDWSKLEKLVEERE   16 (85)
T ss_pred             CCHHHHHHHHHHHH
Confidence            78889999988874


No 14 
>KOG0887|consensus
Probab=25.29  E-value=24  Score=24.06  Aligned_cols=7  Identities=57%  Similarity=0.937  Sum_probs=5.4

Q ss_pred             ccccccC
Q psy8271           4 QEAEFYN   10 (65)
Q Consensus         4 EEAEFYN   10 (65)
                      |||+||-
T Consensus        43 eEa~fYl   49 (111)
T KOG0887|consen   43 EEASFYL   49 (111)
T ss_pred             hhhheee
Confidence            6888883


No 15 
>PF10678 DUF2492:  Protein of unknown function (DUF2492);  InterPro: IPR019620  This entry describes a family of small cytosolic proteins, about 80 amino acids in length, in which the eight invariant residues include three His residues and two Cys residues. Two pairs of these invariant residues occur in motifs HxH (where x is A or G) and CxH, both of which suggest metal-binding activity. This protein family was identified by searching with a phylogenetic profile based on an anaerobic sulphatase-maturase enzyme, which contains multiple 4Fe-4S clusters. The linkages by phylogenetic profiling and by iron-sulphur cluster-related motifs together suggest this protein may be an accessory protein to certain maturases in sulphatase/maturase systems. 
Probab=25.02  E-value=41  Score=21.30  Aligned_cols=22  Identities=23%  Similarity=0.329  Sum_probs=18.5

Q ss_pred             CccccccccChHHHHHHHHHhh
Q psy8271           1 MYTQEAEFYNIAELVRLIKDRI   22 (65)
Q Consensus         1 ~VLEEAEFYNI~~LI~likdri   22 (65)
                      |.++..+-|+..+|++.|.++-
T Consensus        12 mmi~~~~~~t~~~L~~ai~~~F   33 (78)
T PF10678_consen   12 MMIESGNPYTKEELKAAIIEKF   33 (78)
T ss_pred             HHHHcCCCcCHHHHHHHHHHHh
Confidence            3456778999999999999887


No 16 
>PHA03098 kelch-like protein; Provisional
Probab=22.93  E-value=46  Score=25.19  Aligned_cols=23  Identities=22%  Similarity=0.158  Sum_probs=15.7

Q ss_pred             cccccccChHHHHHHHHHhhhhh
Q psy8271           3 TQEAEFYNIAELVRLIKDRICTR   25 (65)
Q Consensus         3 LEEAEFYNI~~LI~likdri~er   25 (65)
                      |+=|.||.|+.|+++|.+.+...
T Consensus        82 l~~A~~l~~~~l~~~C~~~l~~~  104 (534)
T PHA03098         82 LSIANYLIIDFLINLCINYIIKI  104 (534)
T ss_pred             HHHHHHhCcHHHHHHHHHHHHHh
Confidence            55677777777777777776543


No 17 
>KOG0972|consensus
Probab=21.42  E-value=30  Score=27.71  Aligned_cols=39  Identities=10%  Similarity=0.127  Sum_probs=25.5

Q ss_pred             HHHHHHHhhhhhccccccccCCCceeeeeccchhHHHhh
Q psy8271          14 LVRLIKDRICTRDSLSVKDANKKHVYRVIQCHEDELTQM   52 (65)
Q Consensus        14 LI~likdri~erd~~~~q~~~~k~VyRVLqc~e~eLt~m   52 (65)
                      =|..+|.-|++|.++.|.+||...+-..+..-++|+.+|
T Consensus       316 e~E~~KqemEe~G~~msDGaplvkIkqavsKLk~et~~m  354 (384)
T KOG0972|consen  316 EIEQLKQEMEEQGAKMSDGAPLVKIKQAVSKLKEETQTM  354 (384)
T ss_pred             HHHHHHHHHHHhcccccCCchHHHHHHHHHHHHHHHHhh
Confidence            366788888888888888866544444455555555544


No 18 
>PF01329 Pterin_4a:  Pterin 4 alpha carbinolamine dehydratase;  InterPro: IPR001533 DCoH is the dimerisation cofactor of hepatocyte nuclear factor 1 (HNF-1) that functions as both a transcriptional coactivator and a pterin dehydratase []. X-ray crystallographic studies have shown that the ligand binds at four sites per tetrameric enzyme, with little apparent conformational change in the protein.; GO: 0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity, 0006729 tetrahydrobiopterin biosynthetic process; PDB: 2V6T_B 2V6U_A 2V6S_B 2EBB_A 1USM_A 1F93_B 1DCP_C 1DCH_E 3HXA_E 1DCO_C ....
Probab=21.33  E-value=67  Score=19.78  Aligned_cols=18  Identities=28%  Similarity=0.883  Sum_probs=14.5

Q ss_pred             chhHHHhhhhhcCCCcccc
Q psy8271          45 HEDELTQMVSTMSDGWKFE   63 (65)
Q Consensus        45 ~e~eLt~mvStmSdgWkfe   63 (65)
                      .++|+...+..+ +||+..
T Consensus         6 s~~ei~~~L~~l-~~W~~~   23 (95)
T PF01329_consen    6 SEEEIAEALAEL-PGWKLD   23 (95)
T ss_dssp             THHHHHHHHHTS-TTSEEE
T ss_pred             CHHHHHHhhhcC-cCCEEC
Confidence            478888888888 899864


No 19 
>PF10498 IFT57:  Intra-flagellar transport protein 57  ;  InterPro: IPR019530  Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bi-directional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated []. This protein is known as Huntington-interacting protein-1 in humans. 
Probab=21.21  E-value=38  Score=26.17  Aligned_cols=43  Identities=19%  Similarity=0.248  Sum_probs=31.3

Q ss_pred             ChHHHHHHHHHhhhhhccccccccCCCceeeeeccchhHHHhh
Q psy8271          10 NIAELVRLIKDRICTRDSLSVKDANKKHVYRVIQCHEDELTQM   52 (65)
Q Consensus        10 NI~~LI~likdri~erd~~~~q~~~~k~VyRVLqc~e~eLt~m   52 (65)
                      .|+.-+..+|..|.||.++.|-++|...+=..|+-=..|+.+|
T Consensus       305 ~IseeLe~vK~emeerg~~mtD~sPlv~IKqAl~kLk~EI~qM  347 (359)
T PF10498_consen  305 EISEELEQVKQEMEERGSSMTDGSPLVKIKQALTKLKQEIKQM  347 (359)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            4777788899999999999888866555555555555666555


No 20 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=21.13  E-value=61  Score=20.69  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=7.9

Q ss_pred             hhHHHhhhhhcCC
Q psy8271          46 EDELTQMVSTMSD   58 (65)
Q Consensus        46 e~eLt~mvStmSd   58 (65)
                      |++|.+++..|..
T Consensus        62 EeeL~~Lv~~~G~   74 (81)
T PF00558_consen   62 EEELSALVESMGF   74 (81)
T ss_dssp             HH-CHCCHH-GCC
T ss_pred             HHHHHHHHHHcCC
Confidence            5558888886653


No 21 
>KOG0212|consensus
Probab=20.96  E-value=24  Score=30.19  Aligned_cols=29  Identities=21%  Similarity=0.552  Sum_probs=23.4

Q ss_pred             CccccccccChHHHHHHHHHhhhhhcccc
Q psy8271           1 MYTQEAEFYNIAELVRLIKDRICTRDSLS   29 (65)
Q Consensus         1 ~VLEEAEFYNI~~LI~likdri~erd~~~   29 (65)
                      .|.|+|.=++|+.+|.+++|||-.-+..+
T Consensus       155 IVte~~~tFsL~~~ipLL~eriy~~n~~t  183 (675)
T KOG0212|consen  155 IVTESASTFSLPEFIPLLRERIYVINPMT  183 (675)
T ss_pred             hccccccccCHHHHHHHHHHHHhcCCchH
Confidence            37888867799999999999997665443


No 22 
>PF13783 DUF4177:  Domain of unknown function (DUF4177)
Probab=20.81  E-value=30  Score=19.59  Aligned_cols=9  Identities=22%  Similarity=0.800  Sum_probs=6.8

Q ss_pred             cCCCccccc
Q psy8271          56 MSDGWKFEQ   64 (65)
Q Consensus        56 mSdgWkfeQ   64 (65)
                      -+|||.+.+
T Consensus        30 g~eGWeLV~   38 (61)
T PF13783_consen   30 GKEGWELVS   38 (61)
T ss_pred             HhCCcEEEE
Confidence            369999865


No 23 
>cd04751 Commd3 COMM_Domain containing protein 3. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=20.80  E-value=46  Score=20.79  Aligned_cols=20  Identities=20%  Similarity=0.491  Sum_probs=16.9

Q ss_pred             eeeccchhHHHhhhhhcCCC
Q psy8271          40 RVIQCHEDELTQMVSTMSDG   59 (65)
Q Consensus        40 RVLqc~e~eLt~mvStmSdg   59 (65)
                      -+++|..++|..|+..+-|.
T Consensus        67 i~f~c~~e~L~~Li~~Lk~A   86 (95)
T cd04751          67 INFTCTLEQLQDLVNKLKDA   86 (95)
T ss_pred             EEEEeCHHHHHHHHHHHHHH
Confidence            67899999999999877653


No 24 
>PF07097 DUF1359:  Protein of unknown function (DUF1359);  InterPro: IPR010772 This family consists of several hypothetical bacterial and phage proteins of around 100 residues in length. Members of this family seem to be found exclusively in Lactococcus lactis and the bacteriophages that infect this species. The function of this family is unknown.
Probab=20.67  E-value=52  Score=22.08  Aligned_cols=17  Identities=24%  Similarity=0.458  Sum_probs=14.5

Q ss_pred             cChHHHHHHHHHhhhhh
Q psy8271           9 YNIAELVRLIKDRICTR   25 (65)
Q Consensus         9 YNI~~LI~likdri~er   25 (65)
                      -|++.||.|+++.|++.
T Consensus        70 I~VGTLI~LL~~NIE~N   86 (102)
T PF07097_consen   70 INVGTLIPLLEQNIEDN   86 (102)
T ss_pred             cchhhhhHHHHhccccc
Confidence            47899999999999654


No 25 
>PF14135 DUF4302:  Domain of unknown function (DUF4302)
Probab=20.64  E-value=46  Score=23.49  Aligned_cols=18  Identities=28%  Similarity=0.757  Sum_probs=14.5

Q ss_pred             hhHHHhhhhhcCCCcccc
Q psy8271          46 EDELTQMVSTMSDGWKFE   63 (65)
Q Consensus        46 e~eLt~mvStmSdgWkfe   63 (65)
                      -+++.+++....+||+++
T Consensus        18 ~~~~k~~L~~a~~GW~~~   35 (235)
T PF14135_consen   18 LAEYKKILTSAPNGWKLE   35 (235)
T ss_pred             HHHHHHHHhcCCCceEEE
Confidence            457778888999999964


No 26 
>COG0799 Uncharacterized homolog of plant Iojap protein [Function unknown]
Probab=20.57  E-value=39  Score=22.61  Aligned_cols=13  Identities=46%  Similarity=0.802  Sum_probs=10.0

Q ss_pred             ccccccChHHHHH
Q psy8271           4 QEAEFYNIAELVR   16 (65)
Q Consensus         4 EEAEFYNI~~LI~   16 (65)
                      |+-||||+..|-+
T Consensus        93 e~R~~Y~LEklW~  105 (115)
T COG0799          93 EEREFYNLEKLWG  105 (115)
T ss_pred             HHHHHccHHHHhc
Confidence            5679999987743


No 27 
>PF09974 DUF2209:  Uncharacterized protein conserved in archaea (DUF2209);  InterPro: IPR014514 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.18  E-value=35  Score=23.64  Aligned_cols=12  Identities=42%  Similarity=0.731  Sum_probs=9.7

Q ss_pred             ccccccccChHH
Q psy8271           2 YTQEAEFYNIAE   13 (65)
Q Consensus         2 VLEEAEFYNI~~   13 (65)
                      |-|..||||.+.
T Consensus        73 vaE~Gefyn~p~   84 (128)
T PF09974_consen   73 VAEKGEFYNEPE   84 (128)
T ss_pred             EeeccccccChH
Confidence            467789999885


No 28 
>PHA00692 hypothetical protein
Probab=20.07  E-value=39  Score=21.37  Aligned_cols=18  Identities=33%  Similarity=0.619  Sum_probs=13.8

Q ss_pred             HHHhhhhhcCCCcccccC
Q psy8271          48 ELTQMVSTMSDGWKFEQV   65 (65)
Q Consensus        48 eLt~mvStmSdgWkfeQL   65 (65)
                      -|.-++.-|...||=|||
T Consensus        57 aldvlltrmeqhwkdeql   74 (74)
T PHA00692         57 ALDVLLTRMEQHWKDEQL   74 (74)
T ss_pred             HHHHHHHHHHHhhccccC
Confidence            355567778889999987


Done!