Query         psy8289
Match_columns 91
No_of_seqs    106 out of 232
Neff          5.0 
Searched_HMMs 46136
Date          Fri Aug 16 23:40:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8289.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8289hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1213|consensus              100.0 8.2E-36 1.8E-40  248.2   4.9   88    1-88      1-98  (614)
  2 PF04825 Rad21_Rec8_N:  N termi 100.0   2E-32 4.3E-37  185.8   3.0   87    1-87      1-97  (111)
  3 PF06278 DUF1032:  Protein of u  80.8    0.77 1.7E-05   39.0   1.1   40   36-81      2-41  (565)
  4 COG1965 CyaY Protein implicate  68.0     1.9   4E-05   29.7   0.2   20    4-23     47-66  (106)
  5 TIGR03422 mito_frataxin fratax  67.3     1.5 3.1E-05   29.3  -0.4   19    4-22     46-64  (97)
  6 TIGR03421 FeS_CyaY iron donor   62.3     1.6 3.6E-05   29.2  -0.9   20    4-23     44-63  (102)
  7 cd00503 Frataxin Frataxin is a  61.0     2.1 4.6E-05   28.7  -0.6   20    4-23     47-66  (105)
  8 PRK00446 cyaY frataxin-like pr  56.0       2 4.3E-05   29.0  -1.3   20    4-23     46-65  (105)
  9 PRK01379 cyaY frataxin-like pr  53.4     3.4 7.3E-05   28.0  -0.6   17    6-22     48-64  (103)
 10 COG0779 Uncharacterized protei  53.3      17 0.00037   26.1   3.0   48   34-81      3-67  (153)
 11 COG5242 TFB4 RNA polymerase II  42.0      23 0.00051   27.9   2.4   23   50-72     65-87  (296)
 12 KOG2359|consensus               38.9      23  0.0005   30.9   2.1   26   51-76     68-93  (688)
 13 COG4953 PbpC Membrane carboxyp  33.1      19 0.00041   32.0   0.8   27   11-37    129-155 (733)
 14 PF01491 Frataxin_Cyay:  Fratax  31.8     3.5 7.7E-05   27.6  -3.1   18    5-22     50-67  (109)
 15 PF00912 Transgly:  Transglycos  28.3      30 0.00064   25.2   1.0   25   13-37     88-112 (178)
 16 PF08180 BAGE:  B melanoma anti  26.2      36 0.00078   18.2   0.8   18   15-32      4-24  (28)
 17 PRK13481 glycosyltransferase;   22.5      50  0.0011   25.3   1.3   23   13-35    118-140 (232)
 18 PF15572 Imm26:  Immunity prote  22.1      50  0.0011   22.3   1.1   25    3-27     60-85  (96)

No 1  
>KOG1213|consensus
Probab=100.00  E-value=8.2e-36  Score=248.21  Aligned_cols=88  Identities=52%  Similarity=0.755  Sum_probs=84.5

Q ss_pred             CccchhhhhccCchhHHHHHhhhccccchhhhhcccHHHHHHhhcCCCCcc----------ceeEeeecccCccccchHH
Q psy8289           1 MFYAQFVLAKKGPLARIWLAAHWDKKLTKAHVFETNIEKSVDGILQPKFNQ----------VTERLESRKVCPGGDNFEK   70 (91)
Q Consensus         1 MFys~~lLskkgpLa~iWlAA~~~kkL~K~~i~~~dI~~s~~~I~~p~~pl----------gvvRIYsrK~~yL~~D~~~   70 (91)
                      |||||.+|+||||||+|||||||+|||+|+||++|||+++|++|++|.+||          ||||||||||+||++|||+
T Consensus         1 MFYs~~vLakKGPLa~IWlAAh~~kKL~K~qv~~tdI~~sve~Il~p~~~lALRtSghLLlGVVRIYSrK~~YLl~Dcne   80 (614)
T KOG1213|consen    1 MFYSHFVLAKKGPLAKIWLAAHWEKKLSKAQVFETDIPQSVEEILQPKVPLALRTSGHLLLGVVRIYSRKVKYLLDDCNE   80 (614)
T ss_pred             CcchhhhHhhcCchhhhhHHhHHhhhcchhheeeccHHHHHHHHhCcccceehhhhcccceeeEEeehhhHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999884          6899999999999999999


Q ss_pred             HHHHhhhcCCCCCCCCCC
Q psy8289          71 HWFRIKVHPDWESNPRPS   88 (91)
Q Consensus        71 ~~~rik~~~~~~~~~~~~   88 (91)
                      ++.|||.+|+......|+
T Consensus        81 al~kIk~afr~~~vd~p~   98 (614)
T KOG1213|consen   81 ALLKIKMAFRSGQVDLPE   98 (614)
T ss_pred             HHHHHHHHhccccccCCC
Confidence            999999999999877775


No 2  
>PF04825 Rad21_Rec8_N:  N terminus of Rad21 / Rec8 like protein;  InterPro: IPR006910 This domain represents a conserved N-terminal region found in eukaryotic cohesins of the Rad21, Rec8 and Scc1 families. Rad21/Rec8 like proteins mediate sister chromatid cohesion during mitosis and meiosis, as part of the cohesin complex []. Cohesion is necessary for homologous recombination (including double-strand break repair) and correct chromatid segregation. These proteins may also be involved in chromosome condensation. Dissociation at the metaphase to anaphase transition causes loss of cohesion and chromatid segregation [].; GO: 0005515 protein binding
Probab=99.97  E-value=2e-32  Score=185.81  Aligned_cols=87  Identities=32%  Similarity=0.443  Sum_probs=80.5

Q ss_pred             CccchhhhhccCchhHHHHHhhhccccchhhhhcccHHHHHHhhcCCCCcc----------ceeEeeecccCccccchHH
Q psy8289           1 MFYAQFVLAKKGPLARIWLAAHWDKKLTKAHVFETNIEKSVDGILQPKFNQ----------VTERLESRKVCPGGDNFEK   70 (91)
Q Consensus         1 MFys~~lLskkgpLa~iWlAA~~~kkL~K~~i~~~dI~~s~~~I~~p~~pl----------gvvRIYsrK~~yL~~D~~~   70 (91)
                      ||||++||+++|||+.+|+|||+++||+|++|+++||+++|++|++|+.|+          |+||||++|++||++||++
T Consensus         1 MFy~~~iL~k~~~l~~vWlaat~~~kl~k~~i~~vdI~~~c~~I~~~~~~~sLRlss~LL~Gvv~Iy~kKv~yLl~D~~~   80 (111)
T PF04825_consen    1 MFYSHDILSKKGPLATVWLAATLGKKLSKKQILQVDIPKICEEIIEPENPLSLRLSSQLLYGVVRIYSKKVEYLLSDCNE   80 (111)
T ss_pred             CCccHHHHhcCCcHHHHHHHHhccCCCCHHHHHhCCHHHHHHHHhCCCcCeeHHHHhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999998774          7899999999999999999


Q ss_pred             HHHHhhhcCCCCCCCCC
Q psy8289          71 HWFRIKVHPDWESNPRP   87 (91)
Q Consensus        71 ~~~rik~~~~~~~~~~~   87 (91)
                      ++.+|+..+......-|
T Consensus        81 ~~~~l~~~~~~~~~dl~   97 (111)
T PF04825_consen   81 LLSKLKRAFRPKKIDLP   97 (111)
T ss_pred             HHHHHHHHhcccccCCC
Confidence            99999999885433333


No 3  
>PF06278 DUF1032:  Protein of unknown function (DUF1032);  InterPro: IPR009378 This entry includes a regulatory subunit of Non-SMC condensin II complex called H2. Non-SMC condensin II complex seems to provide chromosomes with an additional level of organisation and rigidity and in establishing mitotic chromosome architecture. May play a role in lineage-specific role in T-cell development.
Probab=80.79  E-value=0.77  Score=39.02  Aligned_cols=40  Identities=15%  Similarity=-0.159  Sum_probs=30.2

Q ss_pred             cHHHHHHhhcCCCCccceeEeeecccCccccchHHHHHHhhhcCCC
Q psy8289          36 NIEKSVDGILQPKFNQVTERLESRKVCPGGDNFEKHWFRIKVHPDW   81 (91)
Q Consensus        36 dI~~s~~~I~~p~~plgvvRIYsrK~~yL~~D~~~~~~rik~~~~~   81 (91)
                      |..+|+--|      -|-+-||||||+||+.-+-.++.-|...-+-
T Consensus         2 nFaEAalli------Qgsa~vYskKVeyly~lv~~~l~~l~~~~~~   41 (565)
T PF06278_consen    2 NFAEAALLI------QGSACVYSKKVEYLYSLVYQALDFLSGKKRA   41 (565)
T ss_pred             CHHHHHHHH------hcchhhHHHHHHHHHHHHHHHHHHHhccccc
Confidence            555555555      3667799999999999999999888655543


No 4  
>COG1965 CyaY Protein implicated in iron transport, frataxin homolog [Inorganic ion transport and metabolism]
Probab=67.95  E-value=1.9  Score=29.65  Aligned_cols=20  Identities=40%  Similarity=0.848  Sum_probs=16.6

Q ss_pred             chhhhhccCchhHHHHHhhh
Q psy8289           4 AQFVLAKKGPLARIWLAAHW   23 (91)
Q Consensus         4 s~~lLskkgpLa~iWlAA~~   23 (91)
                      |+-++.|..|+-+||||+-.
T Consensus        47 s~iiINkQ~P~~qiWlAs~~   66 (106)
T COG1965          47 SQIIINKQEPLQQIWLASKV   66 (106)
T ss_pred             cEEEEeCCChHHHHHhhccC
Confidence            45577899999999999865


No 5  
>TIGR03422 mito_frataxin frataxin. Frataxin is a mitochondrial protein, mutation of which leads to the disease Friedreich's ataxia. Its orthologs are widely distributed in the bacteria, associated with the ISC system for iron-sulfur cluster assembly, and designated CyaY. This exception-type model allows those examples of frataxin per se that score above the trusted cutoff to the CyaY equivalog-type model (TIGR03421) to be named appropriately.
Probab=67.34  E-value=1.5  Score=29.29  Aligned_cols=19  Identities=32%  Similarity=0.765  Sum_probs=16.1

Q ss_pred             chhhhhccCchhHHHHHhh
Q psy8289           4 AQFVLAKKGPLARIWLAAH   22 (91)
Q Consensus         4 s~~lLskkgpLa~iWlAA~   22 (91)
                      ++.|++|..|.-+|||||-
T Consensus        46 ~~~VINkQ~p~~QIWlsSp   64 (97)
T TIGR03422        46 GTYVINKQPPNKQIWLSSP   64 (97)
T ss_pred             CEEEEeCCChhhHHheecC
Confidence            4557889999999999984


No 6  
>TIGR03421 FeS_CyaY iron donor protein CyaY. Members of this protein family are the iron-sulfur cluster (FeS) metabolism protein CyaY, a homolog of eukaryotic frataxin. ISC is one of several bacterial systems for FeS assembly; we find by Partial Phylogenetic Profiling vs. the ISC system that CyaY most like work with the ISC system for FeS cluster biosynthesis. A study of of cyaY mutants in Salmonella enterica bears this out. Although the trusted cutoff is set low enough to include eukaryotic frataxin sequences, a narrower, exception-type model (TIGR03421) identifies identifies members of that specific set.
Probab=62.35  E-value=1.6  Score=29.19  Aligned_cols=20  Identities=45%  Similarity=0.848  Sum_probs=16.4

Q ss_pred             chhhhhccCchhHHHHHhhh
Q psy8289           4 AQFVLAKKGPLARIWLAAHW   23 (91)
Q Consensus         4 s~~lLskkgpLa~iWlAA~~   23 (91)
                      ++.|++|..|.-+||||+-.
T Consensus        44 ~~~VINkQ~p~~QIWlasps   63 (102)
T TIGR03421        44 SQIIINKQEPLHQIWLAAKS   63 (102)
T ss_pred             CEEEEeCCchhhhheeecCC
Confidence            45578899999999999753


No 7  
>cd00503 Frataxin Frataxin is a nuclear-encoded mitochondrial protein implicated in Friedreich's ataxia (FRDA), an human autosomal recessive neurodegenerative disease; Frataxin is found in eukaryotes and in purple bacteria; lack of frataxin causes iron to accumulate in the mitochondrial matrix suggesting that frataxin is involved in mitochondrial iron homeostasis and possibly in iron transport; the domain has an alpha-beta fold consisting of two helices flanking an antiparallel beta sheet.
Probab=61.00  E-value=2.1  Score=28.72  Aligned_cols=20  Identities=35%  Similarity=0.793  Sum_probs=16.2

Q ss_pred             chhhhhccCchhHHHHHhhh
Q psy8289           4 AQFVLAKKGPLARIWLAAHW   23 (91)
Q Consensus         4 s~~lLskkgpLa~iWlAA~~   23 (91)
                      ++.|++|..|.-+||||+-.
T Consensus        47 ~~~VINkQ~p~~QIWlaSp~   66 (105)
T cd00503          47 STIVINRQEPLRQIWLASKV   66 (105)
T ss_pred             CEEEEeCCchhhhhheecCC
Confidence            34577899999999999754


No 8  
>PRK00446 cyaY frataxin-like protein; Provisional
Probab=56.03  E-value=2  Score=28.97  Aligned_cols=20  Identities=30%  Similarity=0.781  Sum_probs=16.3

Q ss_pred             chhhhhccCchhHHHHHhhh
Q psy8289           4 AQFVLAKKGPLARIWLAAHW   23 (91)
Q Consensus         4 s~~lLskkgpLa~iWlAA~~   23 (91)
                      ++.|++|..|.-+||||+-.
T Consensus        46 ~~~VINkQ~p~~QIWlas~s   65 (105)
T PRK00446         46 SKIIINRQEPLHELWLAAKS   65 (105)
T ss_pred             CEEEEeCCCchhheeEecCC
Confidence            34578899999999999853


No 9  
>PRK01379 cyaY frataxin-like protein; Provisional
Probab=53.43  E-value=3.4  Score=27.95  Aligned_cols=17  Identities=29%  Similarity=0.755  Sum_probs=14.6

Q ss_pred             hhhhccCchhHHHHHhh
Q psy8289           6 FVLAKKGPLARIWLAAH   22 (91)
Q Consensus         6 ~lLskkgpLa~iWlAA~   22 (91)
                      .|++|..|.-+||||+-
T Consensus        48 ~VINkQ~p~~QIWlASp   64 (103)
T PRK01379         48 YVINKQSAAKEIWLSSP   64 (103)
T ss_pred             EEEeCCChhhhheeecc
Confidence            46788999999999984


No 10 
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=53.28  E-value=17  Score=26.14  Aligned_cols=48  Identities=19%  Similarity=0.097  Sum_probs=34.6

Q ss_pred             cccHHHHHHhhcCCCCc-c---------------ceeEeeecc-cCccccchHHHHHHhhhcCCC
Q psy8289          34 ETNIEKSVDGILQPKFN-Q---------------VTERLESRK-VCPGGDNFEKHWFRIKVHPDW   81 (91)
Q Consensus        34 ~~dI~~s~~~I~~p~~p-l---------------gvvRIYsrK-~~yL~~D~~~~~~rik~~~~~   81 (91)
                      ..++.+-+.+|++|.+. |               .++|||-.+ ..--++||.++-..+...+..
T Consensus         3 ~~~~~~~v~~liep~~~~lG~ELv~ve~~~~~~~~~lrI~id~~g~v~lddC~~vSr~is~~LD~   67 (153)
T COG0779           3 ESPITEKVTELIEPVVESLGFELVDVEFVKEGRDSVLRIYIDKEGGVTLDDCADVSRAISALLDV   67 (153)
T ss_pred             ccchHHHHHHHHHHhHhhcCcEEEEEEEEEcCCCcEEEEEeCCCCCCCHHHHHHHHHHHHHHhcc
Confidence            34556666677766432 3               259999998 555599999999999888873


No 11 
>COG5242 TFB4 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB4 [Transcription / DNA replication, recombination, and repair]
Probab=41.97  E-value=23  Score=27.88  Aligned_cols=23  Identities=9%  Similarity=-0.318  Sum_probs=19.1

Q ss_pred             ccceeEeeecccCccccchHHHH
Q psy8289          50 NQVTERLESRKVCPGGDNFEKHW   72 (91)
Q Consensus        50 plgvvRIYsrK~~yL~~D~~~~~   72 (91)
                      -.||+-=||++.+||+...+..+
T Consensus        65 rVaVva~~s~~~~yLypss~s~~   87 (296)
T COG5242          65 RVAVVAGYSQGKTYLYPSSESAL   87 (296)
T ss_pred             eEEEEEeccCceEEeccCcchhh
Confidence            36788899999999999877743


No 12 
>KOG2359|consensus
Probab=38.86  E-value=23  Score=30.94  Aligned_cols=26  Identities=15%  Similarity=-0.197  Sum_probs=19.9

Q ss_pred             cceeEeeecccCccccchHHHHHHhh
Q psy8289          51 QVTERLESRKVCPGGDNFEKHWFRIK   76 (91)
Q Consensus        51 lgvvRIYsrK~~yL~~D~~~~~~rik   76 (91)
                      .|-|-||+|||+|+++=+-.++.-+.
T Consensus        68 qgs~~vy~~kv~~~y~l~~~~~~~~~   93 (688)
T KOG2359|consen   68 QGSCAVYGRKVDHVYELTISVVDLVE   93 (688)
T ss_pred             hcchhhhhhhhHHHHHHHHHHHHHHH
Confidence            36699999999999987666665443


No 13 
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=33.13  E-value=19  Score=31.95  Aligned_cols=27  Identities=26%  Similarity=0.612  Sum_probs=23.1

Q ss_pred             cCchhHHHHHhhhccccchhhhhcccH
Q psy8289          11 KGPLARIWLAAHWDKKLTKAHVFETNI   37 (91)
Q Consensus        11 kgpLa~iWlAA~~~kkL~K~~i~~~dI   37 (91)
                      .|.+-++|.|=.+|.++||++|++.=+
T Consensus       129 ~gK~~qi~rAiqLE~~lSK~EIL~lYL  155 (733)
T COG4953         129 GGKIRQIWRAIQLESRLSKREILELYL  155 (733)
T ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHH
Confidence            367889999999999999999987533


No 14 
>PF01491 Frataxin_Cyay:  Frataxin-like domain;  InterPro: IPR002908 The eukaryotic proteins in this entry include frataxin, the protein that is mutated in Friedreich's ataxia [], and related sequences. Friedreich's ataxia is a progressive neurodegenerative disorder caused by loss of function mutations in the gene encoding frataxin (FRDA). Frataxin mRNA is predominantly expressed in tissues with a high metabolic rate (including liver, kidney, brown fat and heart). Mouse and yeast frataxin homologues contain a potential N-terminal mitochondrial targeting sequence, and human frataxin has been observed to co-localise with a mitochondrial protein. Furthermore, disruption of the yeast gene has been shown to result in mitochondrial dysfunction. Friedreich's ataxia is thus believed to be a mitochondrial disease caused by a mutation in the nuclear genome (specifically, expansion of an intronic GAA triplet repeat) [, , ]. The bacterial proteins in this entry are iron-sulphur cluster (FeS) metabolism CyaY proteins hmologous to eukaryotic frataxin. Partial Phylogenetic Profiling [] suggests that CyaY most likely functions as part of the ISC system for FeS cluster biosynthesis, and is supported by expermimental data in some species [, ]. ; PDB: 1EW4_A 2P1X_A 1SOY_A 2EFF_A 3T3T_B 3S4M_A 3T3K_A 3S5D_A 1LY7_A 3T3X_B ....
Probab=31.82  E-value=3.5  Score=27.63  Aligned_cols=18  Identities=39%  Similarity=0.844  Sum_probs=15.4

Q ss_pred             hhhhhccCchhHHHHHhh
Q psy8289           5 QFVLAKKGPLARIWLAAH   22 (91)
Q Consensus         5 ~~lLskkgpLa~iWlAA~   22 (91)
                      +.+++|..|.-+||||+-
T Consensus        50 ~~VINkQ~p~~QIWlsSp   67 (109)
T PF01491_consen   50 QYVINKQPPNRQIWLSSP   67 (109)
T ss_dssp             EEEEEEECCCTEEEEEET
T ss_pred             EEEEeCCCHHHHHHHhcc
Confidence            457788999999999987


No 15 
>PF00912 Transgly:  Transglycosylase;  InterPro: IPR001264 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (2.4.1.- from EC) and related proteins into distinct sequence based families has been described []. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'. Glycosyltransferase family 51 GT51 from CAZY comprises enzymes with only one known activity; murein polymerases (2.4 from EC). These enzymes utilise MurNAc-GlcNAc-P-P-lipid II as the sugar donor.  The family includes the bifunctional penicillin-binding proteins that have a transglycosylase (N terminus) and transpeptidase (C terminus) domain [] and the monofunctional biosynthetic peptidoglycan transglycosylases [].; GO: 0003824 catalytic activity, 0009252 peptidoglycan biosynthetic process, 0009274 peptidoglycan-based cell wall; PDB: 3VMT_A 3VMS_B 3VMQ_A 3VMR_A 3D3H_A 3NB7_A 3NB6_A 2OQO_A 2V2F_A 3HZS_A ....
Probab=28.28  E-value=30  Score=25.20  Aligned_cols=25  Identities=20%  Similarity=0.367  Sum_probs=20.9

Q ss_pred             chhHHHHHhhhccccchhhhhcccH
Q psy8289          13 PLARIWLAAHWDKKLTKAHVFETNI   37 (91)
Q Consensus        13 pLa~iWlAA~~~kkL~K~~i~~~dI   37 (91)
                      .+..+|+|..++++++|++|++.=+
T Consensus        88 K~~E~~~A~~le~~~sK~~ILe~YL  112 (178)
T PF00912_consen   88 KLREAILALRLERRYSKDEILELYL  112 (178)
T ss_dssp             HHHHHHHHHHHHHHSHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCHHHHHHHHH
Confidence            5778899999999999999887533


No 16 
>PF08180 BAGE:  B melanoma antigen family;  InterPro: IPR012530 This family consists of the B melanoma antigen (BAGE) peptides. The BAGE gene encodes a human tumour antigen that is recognised by a cytolytic T lymphocyte. BAGE genes are expressed in melanomas, bladder and lung carcinomas and in a few tumours of other histological types [].
Probab=26.22  E-value=36  Score=18.21  Aligned_cols=18  Identities=44%  Similarity=0.752  Sum_probs=11.9

Q ss_pred             hHHHHHhhh---ccccchhhh
Q psy8289          15 ARIWLAAHW---DKKLTKAHV   32 (91)
Q Consensus        15 a~iWlAA~~---~kkL~K~~i   32 (91)
                      +.+||||.-   +.|+++.++
T Consensus         4 as~~LAaSaqaLeAkl~~~dl   24 (28)
T PF08180_consen    4 ASLWLAASAQALEAKLSKEDL   24 (28)
T ss_pred             HHHHHHHHHHHHHhhhchhcc
Confidence            568998732   667777653


No 17 
>PRK13481 glycosyltransferase; Provisional
Probab=22.55  E-value=50  Score=25.32  Aligned_cols=23  Identities=13%  Similarity=0.353  Sum_probs=19.9

Q ss_pred             chhHHHHHhhhccccchhhhhcc
Q psy8289          13 PLARIWLAAHWDKKLTKAHVFET   35 (91)
Q Consensus        13 pLa~iWlAA~~~kkL~K~~i~~~   35 (91)
                      .+..+|+|-.+|+.+||++|++.
T Consensus       118 K~~E~~~A~~lE~~~SK~eILe~  140 (232)
T PRK13481        118 KVKELFVAHRVEKQYSKNEILSF  140 (232)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHH
Confidence            56778999999999999998874


No 18 
>PF15572 Imm26:  Immunity protein 26
Probab=22.12  E-value=50  Score=22.25  Aligned_cols=25  Identities=24%  Similarity=0.690  Sum_probs=18.2

Q ss_pred             cchhhhhccC-chhHHHHHhhhcccc
Q psy8289           3 YAQFVLAKKG-PLARIWLAAHWDKKL   27 (91)
Q Consensus         3 ys~~lLskkg-pLa~iWlAA~~~kkL   27 (91)
                      |+++-.++.+ .+++-||..||++.+
T Consensus        60 fP~Ea~~~~~~aiSt~Wli~NW~kwi   85 (96)
T PF15572_consen   60 FPKEAESKEGRAISTEWLIENWEKWI   85 (96)
T ss_pred             CCHHHhhcccccccHHHHHHHHHHhh
Confidence            4555555554 999999999998643


Done!