Query         psy8304
Match_columns 593
No_of_seqs    221 out of 616
Neff          5.8 
Searched_HMMs 46136
Date          Sat Aug 17 00:17:57 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8304.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8304hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00241 ZP Zona pellucida ( 100.0 3.7E-36   8E-41  303.8  25.9  235  168-421     1-246 (253)
  2 PF00100 Zona_pellucida:  Zona  100.0 1.3E-29 2.9E-34  252.8  22.5  234  168-416     1-254 (265)
  3 KOG1924|consensus               98.8 8.3E-09 1.8E-13  115.9   8.4   22  108-129   567-588 (1102)
  4 KOG1924|consensus               98.3 2.9E-06 6.2E-11   96.1  10.1   15  186-202   632-646 (1102)
  5 KOG3671|consensus               91.8    0.62 1.4E-05   51.8   8.3   10  122-131   427-436 (569)
  6 KOG3671|consensus               90.2    0.76 1.6E-05   51.2   7.2   10   68-77    373-382 (569)
  7 KOG1830|consensus               82.0      13 0.00028   41.0  11.0   19   15-33    286-304 (518)
  8 PF12273 RCR:  Chitin synthesis  78.9     1.6 3.5E-05   40.4   2.7   18  550-567    16-33  (130)
  9 PRK14094 psbM photosystem II r  71.6     6.5 0.00014   30.4   3.8   16  544-559    15-30  (50)
 10 PRK15319 AIDA autotransporter-  68.2     7.6 0.00016   49.8   5.5   10  123-132  1723-1732(2039)
 11 PF05454 DAG1:  Dystroglycan (D  63.5     2.3 5.1E-05   44.9   0.0   24  537-560   152-175 (290)
 12 PF07172 GRP:  Glycine rich pro  62.6     8.5 0.00018   34.1   3.4   23  530-552     3-25  (95)
 13 PF15102 TMEM154:  TMEM154 prot  62.0     6.9 0.00015   37.4   2.8   22  539-560    66-87  (146)
 14 KOG0162|consensus               60.4      38 0.00082   40.1   8.7   12   23-34    921-932 (1106)
 15 PF14991 MLANA:  Protein melan-  60.4     1.6 3.5E-05   39.8  -1.6   27  534-560    26-52  (118)
 16 PF02009 Rifin_STEVOR:  Rifin/s  58.9     4.8  0.0001   42.8   1.4   37  525-562   249-285 (299)
 17 KOG2675|consensus               57.3     6.1 0.00013   43.7   1.8   12   22-33    154-165 (480)
 18 PF05568 ASFV_J13L:  African sw  56.1      10 0.00022   36.2   2.8   37  542-579    39-75  (189)
 19 PF01102 Glycophorin_A:  Glycop  51.3      14 0.00031   34.2   3.0   27  534-561    68-94  (122)
 20 KOG1922|consensus               49.9      41 0.00089   40.5   7.4    8  529-536   765-772 (833)
 21 KOG0132|consensus               49.6      47   0.001   39.5   7.4   13    2-14    478-490 (894)
 22 PTZ00046 rifin; Provisional     48.5     9.1  0.0002   41.6   1.4   30  535-564   317-346 (358)
 23 COG5178 PRP8 U5 snRNP spliceos  48.5      14 0.00031   45.3   3.1   17  163-180   139-155 (2365)
 24 PF11980 DUF3481:  Domain of un  46.9      27 0.00058   30.4   3.7   35  530-564    14-49  (87)
 25 PF11770 GAPT:  GRB2-binding ad  46.9      11 0.00023   36.2   1.4   13  574-586    41-53  (158)
 26 PF01299 Lamp:  Lysosome-associ  46.5      16 0.00035   38.6   2.9   20  543-562   282-301 (306)
 27 TIGR01477 RIFIN variant surfac  46.4      10 0.00022   41.1   1.4   30  535-564   312-341 (353)
 28 PRK09752 adhesin; Provisional   45.9      22 0.00048   44.1   4.2    6    9-14    851-856 (1250)
 29 PF15330 SIT:  SHP2-interacting  45.7      43 0.00092   30.4   5.1   26  537-562     6-31  (107)
 30 PF14575 EphA2_TM:  Ephrin type  43.2      27 0.00059   29.5   3.2   24  536-559     4-27  (75)
 31 PRK15319 AIDA autotransporter-  41.7      37 0.00081   44.0   5.3    6  389-394  1947-1952(2039)
 32 PF06809 NPDC1:  Neural prolife  40.6      21 0.00045   38.2   2.6   31  543-573   209-239 (341)
 33 PLN02983 biotin carboxyl carri  40.2      98  0.0021   32.6   7.3   40  148-189   214-253 (274)
 34 PF05308 Mito_fiss_reg:  Mitoch  39.5      62  0.0014   33.7   5.8   12   22-33     97-108 (253)
 35 PF05337 CSF-1:  Macrophage col  38.6      10 0.00022   39.7   0.0   22  542-563   234-255 (285)
 36 KOG2675|consensus               38.4      22 0.00048   39.5   2.5    7  149-155   331-337 (480)
 37 PF01034 Syndecan:  Syndecan do  38.4      13 0.00029   30.6   0.6   24  542-565    20-43  (64)
 38 KOG2199|consensus               37.1      68  0.0015   35.5   5.8   10  150-159   450-459 (462)
 39 PF05518 Totivirus_coat:  Totiv  37.1 1.5E+02  0.0034   35.3   9.0   15  109-123   711-725 (759)
 40 PRK09752 adhesin; Provisional   35.2      37  0.0008   42.3   3.8    6  127-132   954-959 (1250)
 41 KOG1925|consensus               35.0      44 0.00096   37.9   4.1   10   27-36    164-173 (817)
 42 PF00943 Alpha_E2_glycop:  Alph  34.0      28  0.0006   38.3   2.3   28  534-561   354-381 (403)
 43 PHA02902 putative IMV membrane  33.6      72  0.0016   26.5   4.0   27  536-562     5-31  (70)
 44 KOG2236|consensus               33.4      72  0.0016   35.9   5.4   59   68-129   418-480 (483)
 45 KOG2893|consensus               32.6 2.3E+02   0.005   29.4   8.4    9  149-157   216-224 (341)
 46 KOG1922|consensus               32.0      88  0.0019   37.7   6.4    7  111-117   347-353 (833)
 47 PF00558 Vpu:  Vpu protein;  In  31.8      51  0.0011   28.6   3.1   24  535-558     7-30  (81)
 48 PF12273 RCR:  Chitin synthesis  31.3      35 0.00075   31.5   2.2   19  542-560    11-29  (130)
 49 PF02439 Adeno_E3_CR2:  Adenovi  30.6      73  0.0016   23.8   3.3   13  548-560    21-33  (38)
 50 KOG4368|consensus               29.5 2.2E+02  0.0047   33.2   8.3   23   69-91    291-316 (757)
 51 KOG3895|consensus               29.3 2.1E+02  0.0044   31.5   7.7    9   26-34    369-377 (488)
 52 KOG0608|consensus               29.3 1.7E+02  0.0038   34.7   7.6   10  126-135   270-279 (1034)
 53 PHA03211 serine/threonine kina  29.2      62  0.0013   36.2   4.2   16   47-62     14-29  (461)
 54 PF15179 Myc_target_1:  Myc tar  29.0 1.2E+02  0.0027   30.1   5.6    8  585-592    77-84  (197)
 55 PF12191 stn_TNFRSF12A:  Tumour  28.3      19 0.00042   33.5   0.0   22  542-563    87-108 (129)
 56 PF02009 Rifin_STEVOR:  Rifin/s  27.8      46   0.001   35.5   2.7   38  525-563   252-289 (299)
 57 KOG1830|consensus               27.5 1.3E+02  0.0028   33.7   5.9   10  109-118   399-408 (518)
 58 PF05506 DUF756:  Domain of unk  26.3 3.1E+02  0.0067   23.3   7.2   45  300-344    33-77  (89)
 59 KOG3441|consensus               26.1 2.8E+02   0.006   26.0   7.0   65  295-371    53-122 (149)
 60 PF04881 Adeno_GP19K:  Adenovir  24.6      73  0.0016   29.9   3.0   31  532-562   100-130 (139)
 61 PRK14758 hypothetical protein;  24.4      88  0.0019   21.5   2.5   17  539-555     9-25  (27)
 62 PF07174 FAP:  Fibronectin-atta  24.3 2.5E+02  0.0054   29.8   7.1    6   67-72     36-41  (297)
 63 PF15145 DUF4577:  Domain of un  24.3      95  0.0021   28.5   3.6   31  529-559    59-89  (128)
 64 KOG2546|consensus               23.6   2E+02  0.0043   32.3   6.5    7  146-152   411-417 (483)
 65 PF14141 YqzM:  YqzM-like prote  23.4      95  0.0021   23.7   2.9   25  529-553    17-41  (43)
 66 PF06365 CD34_antigen:  CD34/Po  22.8      49  0.0011   33.3   1.7   50  533-582   101-157 (202)
 67 PF05283 MGC-24:  Multi-glycosy  22.7      78  0.0017   31.6   3.0   25  531-557   161-185 (186)
 68 PF13388 DUF4106:  Protein of u  22.7 2.2E+02  0.0048   30.4   6.4   11   69-79    171-181 (422)
 69 KOG1984|consensus               22.2 3.5E+02  0.0075   33.1   8.5   11  361-371   600-610 (1007)
 70 KOG1785|consensus               21.9 4.5E+02  0.0098   29.4   8.7   10   57-66    467-476 (563)
 71 PF11884 DUF3404:  Domain of un  21.3      63  0.0014   33.9   2.1   40  523-562   217-258 (262)
 72 PTZ00208 65 kDa invariant surf  20.8      98  0.0021   34.3   3.6   26  535-560   389-414 (436)
 73 PF15330 SIT:  SHP2-interacting  20.4      74  0.0016   28.9   2.2   32  536-567     2-33  (107)
 74 PF01690 PLRV_ORF5:  Potato lea  20.1      76  0.0016   35.8   2.6   10  259-268   181-190 (465)
 75 PF10717 ODV-E18:  Occlusion-de  20.1   1E+02  0.0023   26.8   2.9   12  572-583    61-72  (85)
 76 KOG3397|consensus               20.1      91   0.002   31.0   2.8   10   47-56    126-135 (225)
 77 PF01213 CAP_N:  Adenylate cycl  20.0      35 0.00076   36.6   0.0   18  106-123   228-245 (312)

No 1  
>smart00241 ZP Zona pellucida (ZP) domain. ZP proteins are responsible for sperm-adhesion fo the zona pellucida. ZP domains are also present in multidomain transmembrane proteins such as glycoprotein GP2, uromodulin and TGF-beta receptor type III (betaglycan).
Probab=100.00  E-value=3.7e-36  Score=303.77  Aligned_cols=235  Identities=22%  Similarity=0.405  Sum_probs=186.0

Q ss_pred             EecCCeEEEEEEeCCCccceeeecCCCC-CCCceeccCCCCceEEEEEEeeccCCCCCccCCCccccccCCCCceEEEEE
Q psy8304         168 KCEKNSMKVFISFDKPFFGIVFSKGHYS-NVNCVHLPAGLGRTSANFEIGIHACGTSGNTENGLYGYGADAGSGTYFENI  246 (593)
Q Consensus       168 ~C~~d~M~V~V~~~~pF~G~Iyskg~~~-dp~C~~v~~g~g~t~~~F~I~l~~CGt~~~~~~~~~~y~~~n~~g~~ysNt  246 (593)
                      +|.++.|+|.|+++.+|.|.||+++.+. |+.|+......+.+++.|++++++||++++.          ++++++|+|+
T Consensus         1 ~C~~~~m~v~v~~~~~~~g~i~~~~l~l~d~~C~~~~~~~~~~~~~f~~~l~~CGt~~~~----------~~~~~~ysn~   70 (253)
T smart00241        1 QCGEDQMVVSVSTDLLFPGGIYVKGLYLGDPSCRPVFTDSTSAFVSFEVPLNGCGTRRQV----------NPDGIVYSNT   70 (253)
T ss_pred             CCCCCEEEEEEEecCCCCCeEEEeeEEeCCCCCCCccccCCCcEEEEEeccccCCCeEEE----------CCCeEEEEEE
Confidence            5999999999999999999999998765 8999995334567899999999999999853          3568899999


Q ss_pred             EEEe-eCCcceeeecc-eEEEEeeecCCccceeeeccccccccceeee-eccCCCceEEEEEEeCCCCCcccccc--eee
Q psy8304         247 IVIQ-YDPQVQEVWDQ-ARKLRCTWHDQYEKSVTFRPFPVDMLDVVRA-DFAGDNVGCWMQIQVGKGPWASEVSG--LVK  321 (593)
Q Consensus       247 VVVQ-~hp~I~T~~D~-~~~V~C~y~~~~eksVt~~p~~V~m~~v~~~-~fsg~~p~~~M~I~~g~GP~~~~Vs~--~V~  321 (593)
                      |+++ .|+.++|..|+ .++|+|.|.... + ++. .+.+.......+ ....+.+.|+|+|+.++ .|+.++..  .++
T Consensus        71 v~~~~~~~~~itr~~~~~~~~~C~y~~~~-~-~~~-~~~~~~~~~~~~~~~~~g~~~~~m~l~~~~-~~~~~~~~~~~~~  146 (253)
T smart00241       71 LVVSPFHPGFITRDDRAAYHFQCFYPENE-K-VSL-NLDVSTIPPTELSSVSEGPPTCSYRLYKDD-SFGSPYQSADYPV  146 (253)
T ss_pred             EEEccCCCCceEecCceEEEEEEEEeCCC-c-eEE-EEEecCCCCCCcccccCCCcEEEEEeccCC-CCCCcccCCCCcc
Confidence            9999 79999999988 899999999853 3 322 123322111111 11235679999999875 57776633  238


Q ss_pred             cCCEEEEEEEEecC-CCcceEEEeEEEEecCC----CCcEEeeccCCcccccccccceeeeccCCCccceeEEEEEEeeE
Q psy8304         322 IGQTMTMVLAIKDD-DSKFDMLVRNCMAHDGK----RAPIQLVDQRGCVTRSKLMSRFTKIKNFGASASVLSYAHFQAFK  396 (593)
Q Consensus       322 IGd~L~l~v~i~~~-~~~~~l~V~sC~Atdg~----g~~~~LIDenGCp~D~~L~~~f~~~~d~g~s~slla~a~f~AFK  396 (593)
                      |||+|+++|++... ++.|+|+|++|||+|+.    +.++.||| +||++|+.++....+..+.    +..++|.|+|||
T Consensus       147 lg~~l~~~~~~~~~~~~~~~l~v~~C~at~~~~~~~~~~~~lI~-~GC~~d~~~~~~~~~~~~~----~~~~~f~~~aF~  221 (253)
T smart00241      147 LGDPVYHEWSCDGADDPPLGLLVDNCYATPGSDPSSGPKYFIID-NGCPVDGYLDSTIPYNSSP----NHYARFSVKVFK  221 (253)
T ss_pred             cCCeEEEEEEEccCCCCCeEEEEeeEEEcCCCCCCCCCcEEEEE-CccCCCCccccceecCCCC----cceEEEEEEEEE
Confidence            99999999999875 68999999999999987    36899999 9999998877766665541    224699999999


Q ss_pred             eCCCCeEEEEEEEEEccCCCCCcCC
Q psy8304         397 FPDSMEVHFQCTIQICRYQCPDQCS  421 (593)
Q Consensus       397 Fpds~~Vyf~C~V~vC~~~CP~~C~  421 (593)
                      |+++..|||||+|++|....+..|.
T Consensus       222 F~~~~~v~~hC~v~vC~~~~~~~C~  246 (253)
T smart00241      222 FADRSLVYFHCQIRLCDKSDGSSCD  246 (253)
T ss_pred             ecCCCcEEEEEEEEEECCCCCCCCC
Confidence            9999999999999999985433444


No 2  
>PF00100 Zona_pellucida:  Zona pellucida-like domain;  InterPro: IPR001507 A large domain, containing around 260 amino acids, has been recognised in a variety of receptor-like eukaryotic glycoproteins []. All of these proteins are mosaic proteins composed of various domains and that all have a large extracellular region followed by either a transmembrane region and a very short cytoplasmic region or by a GPI-anchor. The domain common to all these proteins is located in the C-terminal portion of the extracellular region, and contains 8 conserved Cys residues, which are probably involved in disulphide bond formation. This entry includes a domain found in the zona pellucida proteins. The zona pellucida is a specialised extracellular matrix of mammailian eggs, which plays a crucial role in fertilisation by directly mediating species-restricted recongition between gametes. In mammals, up to four zona pellucida subnits are known, named ZP1-4. The full-length crystal structure of murine ZP3 has been solved []. This entry is also found in other glycoproteins, such as CD105 (also called endoglin) which is the regulatory component of the TGF-beta receptor complex. It is a modulator of cellular responses to TGF-beta 1. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; PDB: 3D4G_G 3EF7_A 3D4C_A 3NK4_B 3NK3_B 3QW9_A.
Probab=99.97  E-value=1.3e-29  Score=252.82  Aligned_cols=234  Identities=24%  Similarity=0.425  Sum_probs=156.7

Q ss_pred             EecCCeEEEEEEeCCCccceeee-cCCCCCCCceeccCCCCceEEEEEEeecc--CCCCCccCCCccccccCCCCceEEE
Q psy8304         168 KCEKNSMKVFISFDKPFFGIVFS-KGHYSNVNCVHLPAGLGRTSANFEIGIHA--CGTSGNTENGLYGYGADAGSGTYFE  244 (593)
Q Consensus       168 ~C~~d~M~V~V~~~~pF~G~Iys-kg~~~dp~C~~v~~g~g~t~~~F~I~l~~--CGt~~~~~~~~~~y~~~n~~g~~ys  244 (593)
                      +|..+.|+|.|+++.+|.|.||. ++++.++.|++.. ..+.+++.|++++..  ||+......         +.++.|+
T Consensus         1 ~C~~~~~~v~i~~~~~~~~~i~~~~~~~~~~~C~~~~-~~~~~~~~~~~~~~~~~Cg~~~~~~~---------~~~~~y~   70 (265)
T PF00100_consen    1 TCGSDSMTVTIKKDYLFTGNIYVSDLHLNDPSCRARS-DTNSTHITFSIPFNSPSCGTTRSIEN---------GDSIVYS   70 (265)
T ss_dssp             EE-SSEEEEEEESSTTSSS-B-GGGEEETTTTB--EE-ECTTTEEEEEEECCC--CTSEEEE-----------SSEEEEE
T ss_pred             CcCCCEEEEEEEeccccCCCEEeeeeEECCCCCCCcc-cCCCcEEEEEEecCCCCCcccccccc---------cCcceee
Confidence            69999999999999999998877 6777889999921 245678999999999  999976431         2347899


Q ss_pred             EEEEEeeCC--------cceeeecceEEEEeee-cCCccceeeeccccccccceeeeeccCCCceEEEEEEeCCCCCcc-
Q psy8304         245 NIIVIQYDP--------QVQEVWDQARKLRCTW-HDQYEKSVTFRPFPVDMLDVVRADFAGDNVGCWMQIQVGKGPWAS-  314 (593)
Q Consensus       245 NtVVVQ~hp--------~I~T~~D~~~~V~C~y-~~~~eksVt~~p~~V~m~~v~~~~fsg~~p~~~M~I~~g~GP~~~-  314 (593)
                      |+|+++.+.        .|++..|..++|+|.| ...  .+++......................++|+++.++ .+.. 
T Consensus        71 n~i~~~~~~~~~~~~~~~i~~~~~~~~~~~C~y~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~l~~~~-~~~~~  147 (265)
T PF00100_consen   71 NTIVSSQDVSFNDSPGGNITRDSDRRFNFTCTYSSSQ--YSVSSGSPNISSVTIHISQESSGSFSFSMRLYKDD-SFSSP  147 (265)
T ss_dssp             EEEEEE--SSSS---STTECSSS-EEEEEEEEE-EC--------------B-TTT---STT--EEEEEEEESTT-TSSCB
T ss_pred             eeeeeeccccccccccCceEEecccccccEEEECCcc--ceeccccccceeccccceeccCCccceEEEeccCc-ccccc
Confidence            999987653        4566789999999999 432  23322111111111111111234467899999864 3432 


Q ss_pred             --cccceeecCCEEEEEEEEecCC-CcceEEEeEEEEecC----CCCcEEeeccCCcccccccccceeeeccCCCcccee
Q psy8304         315 --EVSGLVKIGQTMTMVLAIKDDD-SKFDMLVRNCMAHDG----KRAPIQLVDQRGCVTRSKLMSRFTKIKNFGASASVL  387 (593)
Q Consensus       315 --~Vs~~V~IGd~L~l~v~i~~~~-~~~~l~V~sC~Atdg----~g~~~~LIDenGCp~D~~L~~~f~~~~d~g~s~sll  387 (593)
                        .-...+.+||.|+++|+++... ..+.|+|++|||+++    .+..+.|||++||++|...+..+.+....+.+ . .
T Consensus       148 ~~~~~~~~~vg~~v~~~v~~~~~~~~~~~~~v~~C~a~~~~~~~~~~~~~lId~~GC~~~~~~~~~~~~~~~~~~~-~-~  225 (265)
T PF00100_consen  148 YSQPPATVEVGDRVYVEVSVSPDSSDPLGLFVDSCWATPSSDPDSSPSYTLIDENGCPVDSDDFVTFEYSGPNGDS-S-R  225 (265)
T ss_dssp             ---SSEEE-TT-EEEEEEEEEECCC-TEEEEEEEEEEESSSSTTSSSCEEEEBCTTEEGGGCTTTEEEEETTTCCC-C-E
T ss_pred             ccCCceeEEeeeeEEEEEEeccccceeeEEEeCEEEEeCCCCcccccccceeccccccccccceeEEEeccccccc-c-E
Confidence              1123689999999999986543 128899999999999    34689999999999999888777765111221 2 4


Q ss_pred             EEEEEEeeEeCCCCeEEEEEEEEEccCCC
Q psy8304         388 SYAHFQAFKFPDSMEVHFQCTIQICRYQC  416 (593)
Q Consensus       388 a~a~f~AFKFpds~~Vyf~C~V~vC~~~C  416 (593)
                      ++|+|+||||+++..|||||+|++|...|
T Consensus       226 ~~f~f~aF~f~~~~~v~i~C~v~~C~~~~  254 (265)
T PF00100_consen  226 ARFSFRAFRFPDSSSVYIHCSVRVCDKSD  254 (265)
T ss_dssp             EEEEEE-EEETSSSEEEEEEEEEEEETTS
T ss_pred             EEEEeeEEEecCCCeEEEEEEEEEECCCC
Confidence            68999999999999999999999999875


No 3  
>KOG1924|consensus
Probab=98.82  E-value=8.3e-09  Score=115.91  Aligned_cols=22  Identities=55%  Similarity=1.242  Sum_probs=13.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCcc
Q psy8304         108 YHGPPPPPPPLSAAKPPPVQPE  129 (593)
Q Consensus       108 ~~~p~~~~~~~~~~~~~~~~~~  129 (593)
                      ..|||||||||.-.++||||++
T Consensus       567 aG~PPpPppppg~~gppPPPpp  588 (1102)
T KOG1924|consen  567 AGGPPPPPPPPGGGGPPPPPPP  588 (1102)
T ss_pred             cCCCCccCCCCCCCCCCCcCCC
Confidence            4456666666665666655555


No 4  
>KOG1924|consensus
Probab=98.28  E-value=2.9e-06  Score=96.06  Aligned_cols=15  Identities=13%  Similarity=0.344  Sum_probs=7.1

Q ss_pred             ceeeecCCCCCCCceec
Q psy8304         186 GIVFSKGHYSNVNCVHL  202 (593)
Q Consensus       186 G~Iyskg~~~dp~C~~v  202 (593)
                      +.|-...-.  .+|.++
T Consensus       632 ~kI~p~d~s--~~cFWv  646 (1102)
T KOG1924|consen  632 SKIVPRDLS--ENCFWV  646 (1102)
T ss_pred             cccCccccC--ccceee
Confidence            444444333  347665


No 5  
>KOG3671|consensus
Probab=91.78  E-value=0.62  Score=51.85  Aligned_cols=10  Identities=50%  Similarity=1.062  Sum_probs=4.6

Q ss_pred             CCCCCCcccc
Q psy8304         122 KPPPVQPEAM  131 (593)
Q Consensus       122 ~~~~~~~~~~  131 (593)
                      ++++++++-|
T Consensus       427 pPppPPPPPm  436 (569)
T KOG3671|consen  427 PPPPPPPPPM  436 (569)
T ss_pred             CCCCCcCCCC
Confidence            3444444455


No 6  
>KOG3671|consensus
Probab=90.20  E-value=0.76  Score=51.20  Aligned_cols=10  Identities=30%  Similarity=0.587  Sum_probs=4.2

Q ss_pred             CCCCCCCCCC
Q psy8304          68 GYVDRPPPPP   77 (593)
Q Consensus        68 ~~~~~~~~~~   77 (593)
                      +-.+|||+++
T Consensus       373 ar~PPPpp~s  382 (569)
T KOG3671|consen  373 ARPPPPPPRS  382 (569)
T ss_pred             CCCCcCCCCC
Confidence            3344444443


No 7  
>KOG1830|consensus
Probab=81.97  E-value=13  Score=41.03  Aligned_cols=19  Identities=21%  Similarity=0.307  Sum_probs=8.0

Q ss_pred             ecccccccccccCCccccc
Q psy8304          15 TGSQFAEKTEVPNVSKVEE   33 (593)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~   33 (593)
                      +|..-|++-...++-.+++
T Consensus       286 ~g~g~a~~r~~~n~~rPt~  304 (518)
T KOG1830|consen  286 RGGGLASARPSSNVVRPTQ  304 (518)
T ss_pred             cCCcccCcCCCcCCCCCCC
Confidence            3444444444444444433


No 8  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=78.90  E-value=1.6  Score=40.41  Aligned_cols=18  Identities=11%  Similarity=0.052  Sum_probs=7.7

Q ss_pred             HHHhhheeecccccCCCC
Q psy8304         550 VSACLCIRLRPFSNKTSQ  567 (593)
Q Consensus       550 va~~L~~r~r~~~~~~~~  567 (593)
                      +++++|+++||++++..+
T Consensus        16 ~~~~~~~~rRR~r~G~~P   33 (130)
T PF12273_consen   16 LFLFYCHNRRRRRRGLQP   33 (130)
T ss_pred             HHHHHHHHHHHhhcCCCC
Confidence            334444444444433333


No 9  
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=71.57  E-value=6.5  Score=30.42  Aligned_cols=16  Identities=19%  Similarity=0.148  Sum_probs=8.4

Q ss_pred             HHHHHHHHHhhheeec
Q psy8304         544 LVVSCLVSACLCIRLR  559 (593)
Q Consensus       544 llvs~~va~~L~~r~r  559 (593)
                      ++|-+++..+||++..
T Consensus        15 i~iPT~FLlilYVkT~   30 (50)
T PRK14094         15 VGVPTIFLIGLFISTQ   30 (50)
T ss_pred             HHHHHHHhhheeEEec
Confidence            3345555555655543


No 10 
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional
Probab=68.24  E-value=7.6  Score=49.80  Aligned_cols=10  Identities=10%  Similarity=0.145  Sum_probs=5.6

Q ss_pred             CCCCCccccc
Q psy8304         123 PPPVQPEAMD  132 (593)
Q Consensus       123 ~~~~~~~~~~  132 (593)
                      ++|.++|+..
T Consensus      1723 ~~P~YRPEVg 1732 (2039)
T PRK15319       1723 VAPQYRADIG 1732 (2039)
T ss_pred             CcccccCchh
Confidence            4456666554


No 11 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=63.49  E-value=2.3  Score=44.90  Aligned_cols=24  Identities=21%  Similarity=0.350  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHhhheeecc
Q psy8304         537 LFVLLGILVVSCLVSACLCIRLRP  560 (593)
Q Consensus       537 ~v~ll~~llvs~~va~~L~~r~r~  560 (593)
                      +|+++++||||+++++++|.|+|.
T Consensus       152 aVVI~~iLLIA~iIa~icyrrkR~  175 (290)
T PF05454_consen  152 AVVIAAILLIAGIIACICYRRKRK  175 (290)
T ss_dssp             ------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhhhhhhc
Confidence            334445555666666665554443


No 12 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=62.62  E-value=8.5  Score=34.14  Aligned_cols=23  Identities=26%  Similarity=0.336  Sum_probs=14.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHH
Q psy8304         530 TIGFSATLFVLLGILVVSCLVSA  552 (593)
Q Consensus       530 ~~~f~~~~v~ll~~llvs~~va~  552 (593)
                      ...|.++.++|+++||||+.|++
T Consensus         3 SK~~llL~l~LA~lLlisSevaa   25 (95)
T PF07172_consen    3 SKAFLLLGLLLAALLLISSEVAA   25 (95)
T ss_pred             hhHHHHHHHHHHHHHHHHhhhhh
Confidence            34555555555566777766665


No 13 
>PF15102 TMEM154:  TMEM154 protein family
Probab=61.96  E-value=6.9  Score=37.36  Aligned_cols=22  Identities=32%  Similarity=0.368  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHHHhhheeecc
Q psy8304         539 VLLGILVVSCLVSACLCIRLRP  560 (593)
Q Consensus       539 ~ll~~llvs~~va~~L~~r~r~  560 (593)
                      +||++||+++|+.++.+.|+|.
T Consensus        66 VLLvlLLl~vV~lv~~~kRkr~   87 (146)
T PF15102_consen   66 VLLVLLLLSVVCLVIYYKRKRT   87 (146)
T ss_pred             HHHHHHHHHHHHheeEEeeccc
Confidence            3334444444443433333333


No 14 
>KOG0162|consensus
Probab=60.39  E-value=38  Score=40.09  Aligned_cols=12  Identities=33%  Similarity=0.382  Sum_probs=6.6

Q ss_pred             ccccCCcccccc
Q psy8304          23 TEVPNVSKVEEQ   34 (593)
Q Consensus        23 ~~~~~~~~~~~~   34 (593)
                      +..|..+++.-+
T Consensus       921 ~GlP~~Skps~k  932 (1106)
T KOG0162|consen  921 TGLPPNSKPSRK  932 (1106)
T ss_pred             CCCCCCCCcCCc
Confidence            445666665433


No 15 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=60.36  E-value=1.6  Score=39.76  Aligned_cols=27  Identities=26%  Similarity=0.346  Sum_probs=1.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhheeecc
Q psy8304         534 SATLFVLLGILVVSCLVSACLCIRLRP  560 (593)
Q Consensus       534 ~~~~v~ll~~llvs~~va~~L~~r~r~  560 (593)
                      |+++.||.+||.+..++.||.|.|+.-
T Consensus        26 AaGIGiL~VILgiLLliGCWYckRRSG   52 (118)
T PF14991_consen   26 AAGIGILIVILGILLLIGCWYCKRRSG   52 (118)
T ss_dssp             --SSS----------------------
T ss_pred             hccceeHHHHHHHHHHHhheeeeecch
Confidence            345555556666666788898877653


No 16 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=58.87  E-value=4.8  Score=42.78  Aligned_cols=37  Identities=14%  Similarity=0.095  Sum_probs=21.9

Q ss_pred             ceeechhHHHHHHHHHHHHHHHHHHHHHhhheeecccc
Q psy8304         525 MICMTTIGFSATLFVLLGILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       525 ~iC~S~~~f~~~~v~ll~~llvs~~va~~L~~r~r~~~  562 (593)
                      ..+++-...+++.+++ ++++|.++|.++|..|+||..
T Consensus       249 ~~~~~~~t~I~aSiia-IliIVLIMvIIYLILRYRRKK  285 (299)
T PF02009_consen  249 STYASLTTAIIASIIA-ILIIVLIMVIIYLILRYRRKK  285 (299)
T ss_pred             chhhhhHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHh
Confidence            4566655444444443 444456777788888877743


No 17 
>KOG2675|consensus
Probab=57.26  E-value=6.1  Score=43.69  Aligned_cols=12  Identities=25%  Similarity=0.457  Sum_probs=7.3

Q ss_pred             cccccCCccccc
Q psy8304          22 KTEVPNVSKVEE   33 (593)
Q Consensus        22 ~~~~~~~~~~~~   33 (593)
                      .|++|||.+--+
T Consensus       154 ~tP~p~vke~~d  165 (480)
T KOG2675|consen  154 PTPAPYVKEFKD  165 (480)
T ss_pred             CCCchHHHHHHH
Confidence            477777765433


No 18 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=56.07  E-value=10  Score=36.19  Aligned_cols=37  Identities=16%  Similarity=0.336  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHhhheeecccccCCCCCccccccCCCcc
Q psy8304         542 GILVVSCLVSACLCIRLRPFSNKTSQKTMSVSYTNPIV  579 (593)
Q Consensus       542 ~~llvs~~va~~L~~r~r~~~~~~~~~~~~~~~~~~~~  579 (593)
                      +++++-++|.++||-+++++.. .+--+...-|.||..
T Consensus        39 vVliiiiivli~lcssRKkKaa-AAi~eediQfinpyq   75 (189)
T PF05568_consen   39 VVLIIIIIVLIYLCSSRKKKAA-AAIEEEDIQFINPYQ   75 (189)
T ss_pred             HHHHHHHHHHHHHHhhhhHHHH-hhhhhhcccccCccc
Confidence            4444555666677766555443 222234556777654


No 19 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=51.34  E-value=14  Score=34.24  Aligned_cols=27  Identities=22%  Similarity=0.262  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhheeeccc
Q psy8304         534 SATLFVLLGILVVSCLVSACLCIRLRPF  561 (593)
Q Consensus       534 ~~~~v~ll~~llvs~~va~~L~~r~r~~  561 (593)
                      .|.|.++++++++ +++.+|++.|+|++
T Consensus        68 ~Ii~gv~aGvIg~-Illi~y~irR~~Kk   94 (122)
T PF01102_consen   68 GIIFGVMAGVIGI-ILLISYCIRRLRKK   94 (122)
T ss_dssp             HHHHHHHHHHHHH-HHHHHHHHHHHS--
T ss_pred             ehhHHHHHHHHHH-HHHHHHHHHHHhcc
Confidence            3444333333332 33444444444443


No 20 
>KOG1922|consensus
Probab=49.88  E-value=41  Score=40.49  Aligned_cols=8  Identities=25%  Similarity=0.081  Sum_probs=3.0

Q ss_pred             chhHHHHH
Q psy8304         529 TTIGFSAT  536 (593)
Q Consensus       529 S~~~f~~~  536 (593)
                      ....|.+.
T Consensus       765 ~~~~f~~~  772 (833)
T KOG1922|consen  765 PEQVFSIL  772 (833)
T ss_pred             HHHHHHHH
Confidence            33333333


No 21 
>KOG0132|consensus
Probab=49.61  E-value=47  Score=39.46  Aligned_cols=13  Identities=15%  Similarity=0.396  Sum_probs=5.7

Q ss_pred             ceeeEEeeeEEEe
Q psy8304           2 KTYKIVSTQLQIT   14 (593)
Q Consensus         2 ~~~~~~~~~~~~~   14 (593)
                      +.||+..+.+.|-
T Consensus       478 ~n~kv~~k~Iki~  490 (894)
T KOG0132|consen  478 SNVKVADKTIKIA  490 (894)
T ss_pred             hcccccceeeEEe
Confidence            3445444444333


No 22 
>PTZ00046 rifin; Provisional
Probab=48.54  E-value=9.1  Score=41.60  Aligned_cols=30  Identities=17%  Similarity=0.174  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhheeecccccC
Q psy8304         535 ATLFVLLGILVVSCLVSACLCIRLRPFSNK  564 (593)
Q Consensus       535 ~~~v~ll~~llvs~~va~~L~~r~r~~~~~  564 (593)
                      |.+.++.++++|.++|.++|..|.||...-
T Consensus       317 IiaSiiAIvVIVLIMvIIYLILRYRRKKKM  346 (358)
T PTZ00046        317 IIASIVAIVVIVLIMVIIYLILRYRRKKKM  346 (358)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhcchh
Confidence            334444444555678889999999987653


No 23 
>COG5178 PRP8 U5 snRNP spliceosome subunit [RNA processing and modification]
Probab=48.50  E-value=14  Score=45.32  Aligned_cols=17  Identities=12%  Similarity=0.286  Sum_probs=8.4

Q ss_pred             cceeEEecCCeEEEEEEe
Q psy8304         163 VSLDVKCEKNSMKVFISF  180 (593)
Q Consensus       163 ~~v~V~C~~d~M~V~V~~  180 (593)
                      +.+.+.|. +.|++..+.
T Consensus       139 vkvlyh~~-Gaitfvne~  155 (2365)
T COG5178         139 VKVLYHCH-GAITFVNEV  155 (2365)
T ss_pred             eeEEeecc-ceEEEeecC
Confidence            34444555 445555544


No 24 
>PF11980 DUF3481:  Domain of unknown function (DUF3481);  InterPro: IPR022579  This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptor family of proteins. It is found in association with PF00754 from PFAM, PF00431 from PFAM and PF00629 from PFAM. There are two completely conserved residues (Y and E) that may be functionally important.
Probab=46.90  E-value=27  Score=30.41  Aligned_cols=35  Identities=14%  Similarity=0.046  Sum_probs=17.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHH-HHHhhheeecccccC
Q psy8304         530 TIGFSATLFVLLGILVVSCL-VSACLCIRLRPFSNK  564 (593)
Q Consensus       530 ~~~f~~~~v~ll~~llvs~~-va~~L~~r~r~~~~~  564 (593)
                      ...+++.+...+++||+++. +..+.|.|.++-..+
T Consensus        14 ~~~yyiiA~gga~llL~~v~l~vvL~C~r~~~a~kk   49 (87)
T PF11980_consen   14 PYWYYIIAMGGALLLLVAVCLGVVLYCHRFHWAAKK   49 (87)
T ss_pred             ceeeHHHhhccHHHHHHHHHHHHHHhhhhhcccccc
Confidence            34444444444444555555 444555666664433


No 25 
>PF11770 GAPT:  GRB2-binding adapter (GAPT);  InterPro: IPR021082  This entry represents a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells []. In contrast to other transmembrane adaptor proteins, GAPT, which this entry represents, is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region []. 
Probab=46.90  E-value=11  Score=36.21  Aligned_cols=13  Identities=31%  Similarity=0.485  Sum_probs=5.7

Q ss_pred             cCCCccccccccc
Q psy8304         574 YTNPIVSVKKTSK  586 (593)
Q Consensus       574 ~~~~~~~~~~~~~  586 (593)
                      |+=|.|-+.+.+|
T Consensus        41 ftLPkflqRRssk   53 (158)
T PF11770_consen   41 FTLPKFLQRRSSK   53 (158)
T ss_pred             cchHHHHHhhhhh
Confidence            4444444444433


No 26 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=46.54  E-value=16  Score=38.65  Aligned_cols=20  Identities=25%  Similarity=0.076  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHhhheeecccc
Q psy8304         543 ILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       543 ~llvs~~va~~L~~r~r~~~  562 (593)
                      ..||.++++|+|+.|+|+..
T Consensus       282 a~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  282 AGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             HHHHHHHHHhheeEeccccc
Confidence            33344566778888877664


No 27 
>TIGR01477 RIFIN variant surface antigen, rifin family. This model represents the rifin branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of rifin sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 20 bits.
Probab=46.44  E-value=10  Score=41.12  Aligned_cols=30  Identities=17%  Similarity=0.193  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhheeecccccC
Q psy8304         535 ATLFVLLGILVVSCLVSACLCIRLRPFSNK  564 (593)
Q Consensus       535 ~~~v~ll~~llvs~~va~~L~~r~r~~~~~  564 (593)
                      |.+.++..+++|.++|.++|..|.||...-
T Consensus       312 IiaSiIAIvvIVLIMvIIYLILRYRRKKKM  341 (353)
T TIGR01477       312 IIASIIAILIIVLIMVIIYLILRYRRKKKM  341 (353)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhcchh
Confidence            344444444555678889999999987643


No 28 
>PRK09752 adhesin; Provisional
Probab=45.92  E-value=22  Score=44.10  Aligned_cols=6  Identities=17%  Similarity=0.357  Sum_probs=3.0

Q ss_pred             eeEEEe
Q psy8304           9 TQLQIT   14 (593)
Q Consensus         9 ~~~~~~   14 (593)
                      |.|.|+
T Consensus       851 T~V~V~  856 (1250)
T PRK09752        851 TTVVVN  856 (1250)
T ss_pred             EEEEEE
Confidence            445554


No 29 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=45.68  E-value=43  Score=30.41  Aligned_cols=26  Identities=15%  Similarity=0.124  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHhhheeecccc
Q psy8304         537 LFVLLGILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       537 ~v~ll~~llvs~~va~~L~~r~r~~~  562 (593)
                      |+.||++|++++-+.+|-+.|+|...
T Consensus         6 il~llLll~l~asl~~wr~~~rq~k~   31 (107)
T PF15330_consen    6 ILALLLLLSLAASLLAWRMKQRQKKA   31 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            33344444445555555555555443


No 30 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=43.25  E-value=27  Score=29.55  Aligned_cols=24  Identities=13%  Similarity=0.297  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhheeec
Q psy8304         536 TLFVLLGILVVSCLVSACLCIRLR  559 (593)
Q Consensus       536 ~~v~ll~~llvs~~va~~L~~r~r  559 (593)
                      +.+++++++++.+++..++|.|++
T Consensus         4 ~~~~~g~~~ll~~v~~~~~~~rr~   27 (75)
T PF14575_consen    4 ASIIVGVLLLLVLVIIVIVCFRRC   27 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHCCCTT-
T ss_pred             ehHHHHHHHHHHhheeEEEEEeeE
Confidence            333443444443444444444443


No 31 
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional
Probab=41.71  E-value=37  Score=44.00  Aligned_cols=6  Identities=0%  Similarity=-0.042  Sum_probs=2.2

Q ss_pred             EEEEEe
Q psy8304         389 YAHFQA  394 (593)
Q Consensus       389 ~a~f~A  394 (593)
                      +.-+++
T Consensus      1947 RLGLR~ 1952 (2039)
T PRK15319       1947 RLGLRV 1952 (2039)
T ss_pred             EEEEEE
Confidence            333333


No 32 
>PF06809 NPDC1:  Neural proliferation differentiation control-1 protein (NPDC1);  InterPro: IPR009635 This family consists of several neural proliferation differentiation control-1 (NPDC1) proteins. NPDC1 plays a role in the control of neural cell proliferation and differentiation. It has been suggested that NPDC1 may be involved in the development of several secretion glands. This family also contains the C-terminal region of the Caenorhabditis elegans protein CAB-1 (Q93249 from SWISSPROT) which is known to interact with AEX-3 [].; GO: 0016021 integral to membrane
Probab=40.64  E-value=21  Score=38.18  Aligned_cols=31  Identities=10%  Similarity=0.033  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHhhheeecccccCCCCCccccc
Q psy8304         543 ILVVSCLVSACLCIRLRPFSNKTSQKTMSVS  573 (593)
Q Consensus       543 ~llvs~~va~~L~~r~r~~~~~~~~~~~~~~  573 (593)
                      +.+++++++++.|+|+++-.+-+.+..|+..
T Consensus       209 aG~aAliva~~cW~Rlqr~~rlaqk~DY~a~  239 (341)
T PF06809_consen  209 AGAAALIVAGYCWYRLQREIRLAQKVDYPAT  239 (341)
T ss_pred             HHHHHHHHhhheEEEeccccccccccccccc
Confidence            3445777888888999988776666666443


No 33 
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase
Probab=40.16  E-value=98  Score=32.58  Aligned_cols=40  Identities=20%  Similarity=0.248  Sum_probs=25.8

Q ss_pred             CCCCCCCCCCCCCCccceeEEecCCeEEEEEEeCCCccceee
Q psy8304         148 APDPWPNAVADTPKIVSLDVKCEKNSMKVFISFDKPFFGIVF  189 (593)
Q Consensus       148 ~~~~wp~~~~d~~~i~~v~V~C~~d~M~V~V~~~~pF~G~Iy  189 (593)
                      .++.|-....|.  +..=++.|.-+.|.+.++...++.|.|-
T Consensus       214 pge~w~VkvGDs--VkkGQvLavIEAMKmeieV~AP~sGtV~  253 (274)
T PLN02983        214 PGEPPFVKVGDK--VQKGQVVCIIEAMKLMNEIEADQSGTIV  253 (274)
T ss_pred             CCCcceeCCCCE--ecCCCEEEEEEeeceeeEEecCCCeEEE
Confidence            345676665543  3444567777777777777788999764


No 34 
>PF05308 Mito_fiss_reg:  Mitochondrial fission regulator;  InterPro: IPR007972 This family consists of several uncharacterised eukaryotic proteins of unknown function.
Probab=39.55  E-value=62  Score=33.70  Aligned_cols=12  Identities=25%  Similarity=0.432  Sum_probs=6.0

Q ss_pred             cccccCCccccc
Q psy8304          22 KTEVPNVSKVEE   33 (593)
Q Consensus        22 ~~~~~~~~~~~~   33 (593)
                      ...+|+...-++
T Consensus        97 ~~s~P~l~~~~~  108 (253)
T PF05308_consen   97 NPSSPNLRQNEP  108 (253)
T ss_pred             cCcCCCcCCCcc
Confidence            345555555444


No 35 
>PF05337 CSF-1:  Macrophage colony stimulating factor-1 (CSF-1);  InterPro: IPR008001 Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [].; GO: 0005125 cytokine activity, 0008083 growth factor activity, 0016021 integral to membrane; PDB: 3EJJ_A.
Probab=38.65  E-value=10  Score=39.71  Aligned_cols=22  Identities=32%  Similarity=0.295  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhhheeeccccc
Q psy8304         542 GILVVSCLVSACLCIRLRPFSN  563 (593)
Q Consensus       542 ~~llvs~~va~~L~~r~r~~~~  563 (593)
                      +||||...|..+||||+|+++.
T Consensus       234 SiILVLLaVGGLLfYr~rrRs~  255 (285)
T PF05337_consen  234 SIILVLLAVGGLLFYRRRRRSH  255 (285)
T ss_dssp             ----------------------
T ss_pred             chhhhhhhccceeeeccccccc
Confidence            5666778899999999999875


No 36 
>KOG2675|consensus
Probab=38.43  E-value=22  Score=39.51  Aligned_cols=7  Identities=14%  Similarity=0.449  Sum_probs=4.0

Q ss_pred             CCCCCCC
Q psy8304         149 PDPWPNA  155 (593)
Q Consensus       149 ~~~wp~~  155 (593)
                      +..|-..
T Consensus       331 GkkW~VE  337 (480)
T KOG2675|consen  331 GKKWRVE  337 (480)
T ss_pred             cceEEEe
Confidence            5556654


No 37 
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=38.42  E-value=13  Score=30.63  Aligned_cols=24  Identities=21%  Similarity=0.174  Sum_probs=0.9

Q ss_pred             HHHHHHHHHHHhhheeecccccCC
Q psy8304         542 GILVVSCLVSACLCIRLRPFSNKT  565 (593)
Q Consensus       542 ~~llvs~~va~~L~~r~r~~~~~~  565 (593)
                      +.+++++++..|+++|.|+++-+.
T Consensus        20 vgll~ailLIlf~iyR~rkkdEGS   43 (64)
T PF01034_consen   20 VGLLFAILLILFLIYRMRKKDEGS   43 (64)
T ss_dssp             -----------------S------
T ss_pred             HHHHHHHHHHHHHHHHHHhcCCCC
Confidence            444456667778888888877643


No 38 
>KOG2199|consensus
Probab=37.13  E-value=68  Score=35.50  Aligned_cols=10  Identities=30%  Similarity=0.351  Sum_probs=6.2

Q ss_pred             CCCCCCCCCC
Q psy8304         150 DPWPNAVADT  159 (593)
Q Consensus       150 ~~wp~~~~d~  159 (593)
                      ..||.+..++
T Consensus       450 q~~pa~~a~~  459 (462)
T KOG2199|consen  450 QQPPAPTADP  459 (462)
T ss_pred             CCCCCCCCCc
Confidence            6677766543


No 39 
>PF05518 Totivirus_coat:  Totivirus coat protein;  InterPro: IPR008871 This family of proteins contain the coat proteins of the Totiviruses.
Probab=37.12  E-value=1.5e+02  Score=35.34  Aligned_cols=15  Identities=47%  Similarity=1.139  Sum_probs=6.2

Q ss_pred             CCCCCCCCCCCCCCC
Q psy8304         109 HGPPPPPPPLSAAKP  123 (593)
Q Consensus       109 ~~p~~~~~~~~~~~~  123 (593)
                      ..||||++++..++.
T Consensus       711 ~~~ppp~~~~g~~~~  725 (759)
T PF05518_consen  711 AAPPPPAPPPGPPPP  725 (759)
T ss_pred             CCCCCCCCCCCCCCC
Confidence            344444444443333


No 40 
>PRK09752 adhesin; Provisional
Probab=35.18  E-value=37  Score=42.26  Aligned_cols=6  Identities=0%  Similarity=-0.064  Sum_probs=2.4

Q ss_pred             Cccccc
Q psy8304         127 QPEAMD  132 (593)
Q Consensus       127 ~~~~~~  132 (593)
                      .+++..
T Consensus       954 lRPEvG  959 (1250)
T PRK09752        954 LNAKVG  959 (1250)
T ss_pred             cccccc
Confidence            344433


No 41 
>KOG1925|consensus
Probab=35.02  E-value=44  Score=37.88  Aligned_cols=10  Identities=30%  Similarity=0.471  Sum_probs=4.3

Q ss_pred             CCccccccch
Q psy8304          27 NVSKVEEQPK   36 (593)
Q Consensus        27 ~~~~~~~~~~   36 (593)
                      ++.+-|-|-|
T Consensus       164 ~~~~AE~~~~  173 (817)
T KOG1925|consen  164 NVAAAETEKQ  173 (817)
T ss_pred             hhHHHHHHHH
Confidence            3444444443


No 42 
>PF00943 Alpha_E2_glycop:  Alphavirus E2 glycoprotein;  InterPro: IPR000936 Alphaviruses are enveloped RNA viruses that use arthropods such as mosquitoes for transmission to their vertebrate hosts, and include Semliki Forest and Sindbis viruses []. Alphaviruses consist of three structural proteins: the core nucleocapsid protein C, and the envelope proteins P62 and E1 (IPR002548 from INTERPRO) that associate as a heterodimer. The viral membrane-anchored surface glycoproteins are responsible for receptor recognition and entry into target cells through membrane fusion. The proteolytic maturation of P62 into E2 and E3 (IPR002533 from INTERPRO) causes a change in the viral surface. Together the E1, E2, and sometimes E3 glycoprotein "spikes" form an E1/E2 dimer or an E1/E2/E3 trimer, where E2 extends from the centre to the vertices, E1 fills the space between the vertices, and E3, if present, is at the distal end of the spike [, ]. Upon exposure of the virus to the acidity of the endosome, E1 dissociates from E2 to form an E1 homotrimer, which is necessary for the fusion step to drive the cellular and viral membranes together []. This entry represents the alphaviral E2 glycoprotein. The E2 glycoprotein functions to interact with the nucleocapsid through its cytoplasmic domain, while its ectodomain is responsible for binding a cellular receptor.; GO: 0005198 structural molecule activity, 0019028 viral capsid; PDB: 2XFC_B 3N42_B 3N41_B 2XFB_E 3N40_P 3N43_B 3N44_B 3MUU_B 1Z8Y_P 3J0C_H ....
Probab=33.98  E-value=28  Score=38.29  Aligned_cols=28  Identities=29%  Similarity=0.306  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhheeeccc
Q psy8304         534 SATLFVLLGILVVSCLVSACLCIRLRPF  561 (593)
Q Consensus       534 ~~~~v~ll~~llvs~~va~~L~~r~r~~  561 (593)
                      +++++.+.+++++++.+++|||.|.|+.
T Consensus       354 i~~~~~~~~~~~i~~~~s~~~~~~aR~~  381 (403)
T PF00943_consen  354 IVVLSGAAAIILISLAASAWLCCKARRK  381 (403)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            3566667778888999999999999864


No 43 
>PHA02902 putative IMV membrane protein; Provisional
Probab=33.59  E-value=72  Score=26.48  Aligned_cols=27  Identities=22%  Similarity=0.397  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhheeecccc
Q psy8304         536 TLFVLLGILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       536 ~~v~ll~~llvs~~va~~L~~r~r~~~  562 (593)
                      ++||+++++++.|++...+|.|.+-+.
T Consensus         5 tfvi~~v~v~Ivclliya~YrR~kci~   31 (70)
T PHA02902          5 TFVILAVIVIIFCLLIYAAYKRYKCIP   31 (70)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhcCCC
Confidence            456666666565666666665554433


No 44 
>KOG2236|consensus
Probab=33.37  E-value=72  Score=35.86  Aligned_cols=59  Identities=25%  Similarity=0.400  Sum_probs=0.0

Q ss_pred             CCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCcc
Q psy8304          68 GYVDR----PPPPPAPIVAPPRPHPNGRHPSHGKPQFNHKLGGVYHGPPPPPPPLSAAKPPPVQPE  129 (593)
Q Consensus        68 ~~~~~----~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  129 (593)
                      ||++|    ++-++||+-.++++.-....|.-|-++.+   -+.+..||||+||++-.+.-+-+.+
T Consensus       418 Nyppp~p~f~m~~~hP~~~~p~~~~g~~~P~~~mpp~~---P~~~~pppP~~pp~p~~~~~q~q~~  480 (483)
T KOG2236|consen  418 NYPPPSPSFPMFQPHPPESNPPANFGQANPFNQMPPAY---PHQQSPPPPPPPPPPNSPMNQMQNP  480 (483)
T ss_pred             CCCCCCCCCCccCCCCCCCCCcccccccCccccCCCCC---ccccCCCCCCCCCCCCChhhcccCC


No 45 
>KOG2893|consensus
Probab=32.65  E-value=2.3e+02  Score=29.41  Aligned_cols=9  Identities=22%  Similarity=0.564  Sum_probs=5.2

Q ss_pred             CCCCCCCCC
Q psy8304         149 PDPWPNAVA  157 (593)
Q Consensus       149 ~~~wp~~~~  157 (593)
                      .+.|+.+.-
T Consensus       216 ~~r~~~p~~  224 (341)
T KOG2893|consen  216 GDRWGPPMR  224 (341)
T ss_pred             CCCCCCCcC
Confidence            466776643


No 46 
>KOG1922|consensus
Probab=32.00  E-value=88  Score=37.73  Aligned_cols=7  Identities=100%  Similarity=2.527  Sum_probs=2.6

Q ss_pred             CCCCCCC
Q psy8304         111 PPPPPPP  117 (593)
Q Consensus       111 p~~~~~~  117 (593)
                      |+|||||
T Consensus       347 p~ppppp  353 (833)
T KOG1922|consen  347 PPPPPPP  353 (833)
T ss_pred             CCCCCCC
Confidence            3333333


No 47 
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=31.82  E-value=51  Score=28.55  Aligned_cols=24  Identities=17%  Similarity=0.325  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhheee
Q psy8304         535 ATLFVLLGILVVSCLVSACLCIRL  558 (593)
Q Consensus       535 ~~~v~ll~~llvs~~va~~L~~r~  558 (593)
                      ++++.+.+.++++++|..+.++..
T Consensus         7 ~~iialiv~~iiaIvvW~iv~ieY   30 (81)
T PF00558_consen    7 LAIIALIVALIIAIVVWTIVYIEY   30 (81)
T ss_dssp             -HHHHHHHHHHHHHHHHHHH----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444445455555666666655433


No 48 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=31.32  E-value=35  Score=31.54  Aligned_cols=19  Identities=26%  Similarity=0.135  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHhhheeecc
Q psy8304         542 GILVVSCLVSACLCIRLRP  560 (593)
Q Consensus       542 ~~llvs~~va~~L~~r~r~  560 (593)
                      ++||+.++++++--.|+|+
T Consensus        11 ~i~l~~~~~~~~~rRR~r~   29 (130)
T PF12273_consen   11 AILLFLFLFYCHNRRRRRR   29 (130)
T ss_pred             HHHHHHHHHHHHHHHHhhc
Confidence            4444456666777777775


No 49 
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=30.62  E-value=73  Score=23.79  Aligned_cols=13  Identities=8%  Similarity=0.013  Sum_probs=5.8

Q ss_pred             HHHHHhhheeecc
Q psy8304         548 CLVSACLCIRLRP  560 (593)
Q Consensus       548 ~~va~~L~~r~r~  560 (593)
                      ..+..+.|.++|.
T Consensus        21 i~~~~YaCcykk~   33 (38)
T PF02439_consen   21 ICMFYYACCYKKH   33 (38)
T ss_pred             HHHHHHHHHHccc
Confidence            3444444544443


No 50 
>KOG4368|consensus
Probab=29.52  E-value=2.2e+02  Score=33.22  Aligned_cols=23  Identities=17%  Similarity=0.167  Sum_probs=10.9

Q ss_pred             CCCCCCCCCCCC---CCCCCCCCCCC
Q psy8304          69 YVDRPPPPPAPI---VAPPRPHPNGR   91 (593)
Q Consensus        69 ~~~~~~~~~~p~---~~~~~~~~~~~   91 (593)
                      ..+||-+-|+++   +++.++-++||
T Consensus       291 ~~~~p~~GPgdH~h~~~~~p~dq~hp  316 (757)
T KOG4368|consen  291 TPPPPAPGPGPHDQIPPNKPFDQPHP  316 (757)
T ss_pred             cCCCCCCCCCcccccCCCCCCCCCCC
Confidence            344444444444   45555544444


No 51 
>KOG3895|consensus
Probab=29.29  E-value=2.1e+02  Score=31.54  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=3.4

Q ss_pred             cCCcccccc
Q psy8304          26 PNVSKVEEQ   34 (593)
Q Consensus        26 ~~~~~~~~~   34 (593)
                      |+.-+-.||
T Consensus       369 pliGeh~ee  377 (488)
T KOG3895|consen  369 PLIGEHQEE  377 (488)
T ss_pred             cccccchhH
Confidence            344333333


No 52 
>KOG0608|consensus
Probab=29.26  E-value=1.7e+02  Score=34.72  Aligned_cols=10  Identities=40%  Similarity=0.285  Sum_probs=4.2

Q ss_pred             CCccccccCC
Q psy8304         126 VQPEAMDKSG  135 (593)
Q Consensus       126 ~~~~~~~~~~  135 (593)
                      ++..+-++..
T Consensus       270 ~q~s~y~ssP  279 (1034)
T KOG0608|consen  270 PQQSAYDSSP  279 (1034)
T ss_pred             CCccccccCC
Confidence            3333444443


No 53 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=29.20  E-value=62  Score=36.24  Aligned_cols=16  Identities=19%  Similarity=0.370  Sum_probs=9.2

Q ss_pred             chhhhcccCccccccC
Q psy8304          47 TDQVASETSSDQESQQ   62 (593)
Q Consensus        47 ~~~~~~~~~~~~~~~~   62 (593)
                      ||.+-.|+..+.+..+
T Consensus        14 ~~~~~~~~~~~~~~~~   29 (461)
T PHA03211         14 TEDAGREEAVEPETTT   29 (461)
T ss_pred             CccccccccCCCCCCC
Confidence            4555556666666643


No 54 
>PF15179 Myc_target_1:  Myc target protein 1
Probab=28.97  E-value=1.2e+02  Score=30.15  Aligned_cols=8  Identities=38%  Similarity=0.928  Sum_probs=4.2

Q ss_pred             cccccccC
Q psy8304         585 SKSSFYTS  592 (593)
Q Consensus       585 ~~~~~~~~  592 (593)
                      .+.-||.+
T Consensus        77 nr~GfyR~   84 (197)
T PF15179_consen   77 NRTGFYRS   84 (197)
T ss_pred             Cccceecc
Confidence            45556654


No 55 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=28.26  E-value=19  Score=33.54  Aligned_cols=22  Identities=23%  Similarity=0.240  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhhheeeccccc
Q psy8304         542 GILVVSCLVSACLCIRLRPFSN  563 (593)
Q Consensus       542 ~~llvs~~va~~L~~r~r~~~~  563 (593)
                      +++||.++++.+|++|++++..
T Consensus        87 ~v~lVl~llsg~lv~rrcrrr~  108 (129)
T PF12191_consen   87 SVVLVLALLSGFLVWRRCRRRE  108 (129)
T ss_dssp             ----------------------
T ss_pred             HHHHHHHHHHHHHHHhhhhccc
Confidence            4445567777888877776654


No 56 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=27.83  E-value=46  Score=35.50  Aligned_cols=38  Identities=13%  Similarity=0.114  Sum_probs=25.3

Q ss_pred             ceeechhHHHHHHHHHHHHHHHHHHHHHhhheeeccccc
Q psy8304         525 MICMTTIGFSATLFVLLGILVVSCLVSACLCIRLRPFSN  563 (593)
Q Consensus       525 ~iC~S~~~f~~~~v~ll~~llvs~~va~~L~~r~r~~~~  563 (593)
                      ..|-+....++.+++++ +|+|.+|-.+|.|.|.+....
T Consensus       252 ~~~~t~I~aSiiaIliI-VLIMvIIYLILRYRRKKKmkK  289 (299)
T PF02009_consen  252 ASLTTAIIASIIAILII-VLIMVIIYLILRYRRKKKMKK  289 (299)
T ss_pred             hhhHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHhhhhH
Confidence            35666666665555553 334558889999999887654


No 57 
>KOG1830|consensus
Probab=27.55  E-value=1.3e+02  Score=33.69  Aligned_cols=10  Identities=70%  Similarity=1.660  Sum_probs=4.4

Q ss_pred             CCCCCCCCCC
Q psy8304         109 HGPPPPPPPL  118 (593)
Q Consensus       109 ~~p~~~~~~~  118 (593)
                      ..||||||||
T Consensus       399 ~sppPppppp  408 (518)
T KOG1830|consen  399 GSPPPPPPPP  408 (518)
T ss_pred             CCCCCCCCCC
Confidence            3444444444


No 58 
>PF05506 DUF756:  Domain of unknown function (DUF756);  InterPro: IPR008475 This domain is found, normally as a tandem repeat, at the C terminus of bacterial phospholipase C proteins.; GO: 0004629 phospholipase C activity, 0016042 lipid catabolic process
Probab=26.35  E-value=3.1e+02  Score=23.32  Aligned_cols=45  Identities=13%  Similarity=0.114  Sum_probs=30.5

Q ss_pred             eEEEEEEeCCCCCcccccceeecCCEEEEEEEEecCCCcceEEEe
Q psy8304         300 GCWMQIQVGKGPWASEVSGLVKIGQTMTMVLAIKDDDSKFDMLVR  344 (593)
Q Consensus       300 ~~~M~I~~g~GP~~~~Vs~~V~IGd~L~l~v~i~~~~~~~~l~V~  344 (593)
                      .+.++|+......+.+....|.-|+.+.+.|.+...++-|++.|+
T Consensus        33 ~~~~~v~~~~y~~~~~~~~~v~ag~~~~~~w~l~~s~gwYDl~v~   77 (89)
T PF05506_consen   33 AVTFTVYDNAYGGGGPWTYTVAAGQTVSLTWPLAASGGWYDLTVT   77 (89)
T ss_pred             cEEEEEEeCCcCCCCCEEEEECCCCEEEEEEeecCCCCcEEEEEE
Confidence            456677752211122334578889999999999766788998775


No 59 
>KOG3441|consensus
Probab=26.09  E-value=2.8e+02  Score=25.95  Aligned_cols=65  Identities=20%  Similarity=0.347  Sum_probs=42.3

Q ss_pred             cCCCceEEEEEEeCCCCCcccccceeecCCEEEEEEEEecCCCcceEEEeEEEEecCC-----CCcEEeeccCCcccccc
Q psy8304         295 AGDNVGCWMQIQVGKGPWASEVSGLVKIGQTMTMVLAIKDDDSKFDMLVRNCMAHDGK-----RAPIQLVDQRGCVTRSK  369 (593)
Q Consensus       295 sg~~p~~~M~I~~g~GP~~~~Vs~~V~IGd~L~l~v~i~~~~~~~~l~V~sC~Atdg~-----g~~~~LIDenGCp~D~~  369 (593)
                      +|..|.| ..+|+-+|        ..++||.+-+  .|+. +-.-.+.|..|.-..-.     .+.+.|||+||-|+...
T Consensus        53 ~gr~PrC-IHVYkkrg--------vg~~GDkiLv--AIkG-QmkKa~vVGh~~~~k~~~P~fDsNniVLiddnGnPlGtR  120 (149)
T KOG3441|consen   53 TGRLPRC-IHVYKKRG--------VGELGDKILV--AIKG-QMKKAYVVGHVHYRKHGVPVFDSNNIVLIDDNGNPLGTR  120 (149)
T ss_pred             cCCCCce-EEEEeccc--------ccccccEEEE--EEec-ceeeeEEEEeeccCCCCCcccCCCcEEEECCCCCcccce
Confidence            3444555 67776543        5689999754  4543 23345677777655431     25799999999999865


Q ss_pred             cc
Q psy8304         370 LM  371 (593)
Q Consensus       370 L~  371 (593)
                      |.
T Consensus       121 I~  122 (149)
T KOG3441|consen  121 IT  122 (149)
T ss_pred             Ee
Confidence            53


No 60 
>PF04881 Adeno_GP19K:  Adenovirus GP19K;  InterPro: IPR006965 This 19 kDa glycoprotein binds the major histocompatibility (MHC) class I antigens in the endoplasmic reticulum (ER). The ER retention signal at the C terminus of Gp19K causes retention of the complex in the ER, preventing lysis of the cell by cytotoxic T-lymphocytes [].; GO: 0005537 mannose binding, 0050690 regulation of defense response to virus by virus
Probab=24.58  E-value=73  Score=29.94  Aligned_cols=31  Identities=23%  Similarity=0.401  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhheeecccc
Q psy8304         532 GFSATLFVLLGILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       532 ~f~~~~v~ll~~llvs~~va~~L~~r~r~~~  562 (593)
                      +|.+++++...++-..+++++.|+++.|++.
T Consensus       100 ~fS~af~~~aclit~l~~~~i~~~i~~kpR~  130 (139)
T PF04881_consen  100 GFSIAFCICACLITALLCVCIHLLIKIKPRN  130 (139)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHhhheeecccc
Confidence            4556666554333333455666667666554


No 61 
>PRK14758 hypothetical protein; Provisional
Probab=24.43  E-value=88  Score=21.47  Aligned_cols=17  Identities=29%  Similarity=0.507  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHhhh
Q psy8304         539 VLLGILVVSCLVSACLC  555 (593)
Q Consensus       539 ~ll~~llvs~~va~~L~  555 (593)
                      ++|+++++++++++-++
T Consensus         9 liLivlIlCalia~~fy   25 (27)
T PRK14758          9 FILIILILCALIAARFY   25 (27)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            34455556666666554


No 62 
>PF07174 FAP:  Fibronectin-attachment protein (FAP);  InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=24.33  E-value=2.5e+02  Score=29.75  Aligned_cols=6  Identities=17%  Similarity=0.135  Sum_probs=2.2

Q ss_pred             CCCCCC
Q psy8304          67 HGYVDR   72 (593)
Q Consensus        67 ~~~~~~   72 (593)
                      +++..|
T Consensus        36 ~A~AdP   41 (297)
T PF07174_consen   36 TAQADP   41 (297)
T ss_pred             cccCCC
Confidence            333333


No 63 
>PF15145 DUF4577:  Domain of unknown function (DUF4577)
Probab=24.31  E-value=95  Score=28.53  Aligned_cols=31  Identities=16%  Similarity=0.110  Sum_probs=21.6

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHhhheeec
Q psy8304         529 TTIGFSATLFVLLGILVVSCLVSACLCIRLR  559 (593)
Q Consensus       529 S~~~f~~~~v~ll~~llvs~~va~~L~~r~r  559 (593)
                      +..-|.++++++|.+-|+.+.+++||.+-.+
T Consensus        59 ~~~lffvglii~LivSLaLVsFvIFLiiQTg   89 (128)
T PF15145_consen   59 SRSLFFVGLIIVLIVSLALVSFVIFLIIQTG   89 (128)
T ss_pred             ceeehHHHHHHHHHHHHHHHHHHHHheeecc
Confidence            3445778888877777777777788876543


No 64 
>KOG2546|consensus
Probab=23.63  E-value=2e+02  Score=32.28  Aligned_cols=7  Identities=43%  Similarity=1.203  Sum_probs=3.2

Q ss_pred             CCCCCCC
Q psy8304         146 APAPDPW  152 (593)
Q Consensus       146 ~~~~~~w  152 (593)
                      +..+..|
T Consensus       411 ap~sp~w  417 (483)
T KOG2546|consen  411 APSSPAW  417 (483)
T ss_pred             CCCCccc
Confidence            3444455


No 65 
>PF14141 YqzM:  YqzM-like protein
Probab=23.36  E-value=95  Score=23.72  Aligned_cols=25  Identities=12%  Similarity=0.386  Sum_probs=19.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHh
Q psy8304         529 TTIGFSATLFVLLGILVVSCLVSAC  553 (593)
Q Consensus       529 S~~~f~~~~v~ll~~llvs~~va~~  553 (593)
                      |..+|++++.++.+++++++++-.+
T Consensus        17 sgvGF~vsFgFF~~iFiIa~ii~~~   41 (43)
T PF14141_consen   17 SGVGFIVSFGFFATIFIIATIIKFI   41 (43)
T ss_pred             ccchhhhhHHHHHHHHHHHHHHHHh
Confidence            5678999998888888888877543


No 66 
>PF06365 CD34_antigen:  CD34/Podocalyxin family;  InterPro: IPR013836 This family consists of several mammalian CD34 antigen proteins. The CD34 antigen is a human leukocyte membrane protein expressed specifically by lymphohematopoietic progenitor cells. CD34 is a phosphoprotein. Activation of protein kinase C (PKC) has been found to enhance CD34 phosphorylation [, ]. This family contains several eukaryotic podocalyxin proteins. Podocalyxin is a major membrane protein of the glomerular epithelium and is thought to be involved in maintenance of the architecture of the foot processes and filtration slits characteristic of this unique epithelium by virtue of its high negative charge. Podocalyxin functions as an anti-adhesin that maintains an open filtration pathway between neighbouring foot processes in the glomerular epithelium by charge repulsion [].
Probab=22.84  E-value=49  Score=33.34  Aligned_cols=50  Identities=24%  Similarity=0.235  Sum_probs=22.8

Q ss_pred             HHHHHHHHH-HHHHHHHHHHHhhheeecccccCCCCCc---cccc---cCCCccccc
Q psy8304         533 FSATLFVLL-GILVVSCLVSACLCIRLRPFSNKTSQKT---MSVS---YTNPIVSVK  582 (593)
Q Consensus       533 f~~~~v~ll-~~llvs~~va~~L~~r~r~~~~~~~~~~---~~~~---~~~~~~~~~  582 (593)
                      ..|+||+++ .+||++++++++.|+.+|.-+.+...+.   +..+   -.||.++.+
T Consensus       101 ~lI~lv~~g~~lLla~~~~~~Y~~~~Rrs~~~~~~rl~Ee~~~vEng~h~n~~l~v~  157 (202)
T PF06365_consen  101 TLIALVTSGSFLLLAILLGAGYCCHQRRSWSKKGQRLGEELYTVENGYHDNPTLSVA  157 (202)
T ss_pred             EEEehHHhhHHHHHHHHHHHHHHhhhhccCCcchhhhccCceecccCccCCcccccC
Confidence            344555554 3444455555555544444333333333   1111   247777554


No 67 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=22.73  E-value=78  Score=31.57  Aligned_cols=25  Identities=16%  Similarity=0.287  Sum_probs=16.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhee
Q psy8304         531 IGFSATLFVLLGILVVSCLVSACLCIR  557 (593)
Q Consensus       531 ~~f~~~~v~ll~~llvs~~va~~L~~r  557 (593)
                      .+|+.+||+.|++|.  +++..|=|+|
T Consensus       161 ~SFiGGIVL~LGv~a--I~ff~~KF~k  185 (186)
T PF05283_consen  161 ASFIGGIVLTLGVLA--IIFFLYKFCK  185 (186)
T ss_pred             hhhhhHHHHHHHHHH--HHHHHhhhcc
Confidence            789999998887774  4444444443


No 68 
>PF13388 DUF4106:  Protein of unknown function (DUF4106)
Probab=22.72  E-value=2.2e+02  Score=30.42  Aligned_cols=11  Identities=45%  Similarity=0.975  Sum_probs=6.5

Q ss_pred             CCCCCCCCCCC
Q psy8304          69 YVDRPPPPPAP   79 (593)
Q Consensus        69 ~~~~~~~~~~p   79 (593)
                      |-||-||+-+|
T Consensus       171 YIPPNPPrEAP  181 (422)
T PF13388_consen  171 YIPPNPPREAP  181 (422)
T ss_pred             ccCCCCccccc
Confidence            44665666665


No 69 
>KOG1984|consensus
Probab=22.20  E-value=3.5e+02  Score=33.12  Aligned_cols=11  Identities=27%  Similarity=0.495  Sum_probs=7.1

Q ss_pred             cCCcccccccc
Q psy8304         361 QRGCVTRSKLM  371 (593)
Q Consensus       361 enGCp~D~~L~  371 (593)
                      +.||.+|-.++
T Consensus       600 ~~g~svDlF~t  610 (1007)
T KOG1984|consen  600 ESGCSVDLFLT  610 (1007)
T ss_pred             HhCceEEEEEc
Confidence            46777776554


No 70 
>KOG1785|consensus
Probab=21.90  E-value=4.5e+02  Score=29.36  Aligned_cols=10  Identities=20%  Similarity=0.461  Sum_probs=4.9

Q ss_pred             cccccCCCCC
Q psy8304          57 DQESQQSAPK   66 (593)
Q Consensus        57 ~~~~~~~~~~   66 (593)
                      .+++.++++.
T Consensus       467 a~~~~p~~p~  476 (563)
T KOG1785|consen  467 AHDASPSIPS  476 (563)
T ss_pred             hhhccCCCCc
Confidence            4555554443


No 71 
>PF11884 DUF3404:  Domain of unknown function (DUF3404);  InterPro: IPR021821  This domain is functionally uncharacterised. This domain is found in bacteria. This presumed domain is about 260 amino acids in length. This domain is found associated with PF02518 from PFAM, PF00512 from PFAM. 
Probab=21.26  E-value=63  Score=33.87  Aligned_cols=40  Identities=18%  Similarity=0.143  Sum_probs=21.8

Q ss_pred             CCceeechhHHH--HHHHHHHHHHHHHHHHHHhhheeecccc
Q psy8304         523 SGMICMTTIGFS--ATLFVLLGILVVSCLVSACLCIRLRPFS  562 (593)
Q Consensus       523 ~~~iC~S~~~f~--~~~v~ll~~llvs~~va~~L~~r~r~~~  562 (593)
                      .++||++...=.  +.++++.++++..+++..|..+|++...
T Consensus       217 ~gNlCw~~~~~s~l~~~~~i~L~~~~i~l~~gw~~y~~~~kr  258 (262)
T PF11884_consen  217 YGNLCWSEEDHSHLLRISMIALVLANILLVLGWSLYRWNQKR  258 (262)
T ss_pred             ecceeeccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            468999875443  2223333333344556667777766543


No 72 
>PTZ00208 65 kDa invariant surface glycoprotein; Provisional
Probab=20.80  E-value=98  Score=34.33  Aligned_cols=26  Identities=12%  Similarity=0.180  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhheeecc
Q psy8304         535 ATLFVLLGILVVSCLVSACLCIRLRP  560 (593)
Q Consensus       535 ~~~v~ll~~llvs~~va~~L~~r~r~  560 (593)
                      +..|++-+++|+-+.++.|.|+|+||
T Consensus       389 ~~avl~p~~il~~~~~~~~~~v~rrr  414 (436)
T PTZ00208        389 ILAVLVPAIILAIIAVAFFIMVKRRR  414 (436)
T ss_pred             HHHHHHHHHHHHHHHHHhheeeeecc
Confidence            33343334554434444455566655


No 73 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=20.37  E-value=74  Score=28.87  Aligned_cols=32  Identities=25%  Similarity=0.410  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhheeecccccCCCC
Q psy8304         536 TLFVLLGILVVSCLVSACLCIRLRPFSNKTSQ  567 (593)
Q Consensus       536 ~~v~ll~~llvs~~va~~L~~r~r~~~~~~~~  567 (593)
                      +|.+++++||+..+++.++..|..++..+.+.
T Consensus         2 ~Ll~il~llLll~l~asl~~wr~~~rq~k~~~   33 (107)
T PF15330_consen    2 LLLGILALLLLLSLAASLLAWRMKQRQKKAGQ   33 (107)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhhhccccC
Confidence            46677788887777777777777777766544


No 74 
>PF01690 PLRV_ORF5:  Potato leaf roll virus readthrough protein;  InterPro: IPR002929 This family consists mainly of the Potato leafroll virus (PLrV) read through protein otherwise known as the minor capsid protein. This is generated via a readthrough of open reading frame 3, the coat protein, allowing transcription of open reading frame 5 to give an extended coat protein with a large C-terminal addition or read through domain []. The read through protein is essential for the circulative aphid transmission of PLrV [] and Beet western yellows virus []. The N-terminal region of the luteovirus readthrough domain determines virus binding to Buchnera GroEL and is essential for virus persistence in the aphid [].; GO: 0019028 viral capsid
Probab=20.11  E-value=76  Score=35.79  Aligned_cols=10  Identities=20%  Similarity=0.002  Sum_probs=5.1

Q ss_pred             ecceEEEEee
Q psy8304         259 WDQARKLRCT  268 (593)
Q Consensus       259 ~D~~~~V~C~  268 (593)
                      +...|||+|.
T Consensus       181 ~~~SFhl~~~  190 (465)
T PF01690_consen  181 GTISFHLEAT  190 (465)
T ss_pred             eeEEEEEEec
Confidence            4444555555


No 75 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=20.09  E-value=1e+02  Score=26.81  Aligned_cols=12  Identities=25%  Similarity=0.667  Sum_probs=8.3

Q ss_pred             cccCCCcccccc
Q psy8304         572 VSYTNPIVSVKK  583 (593)
Q Consensus       572 ~~~~~~~~~~~~  583 (593)
                      ..|.||+=+.+.
T Consensus        61 ~~f~NPLNaTMR   72 (85)
T PF10717_consen   61 MGFTNPLNATMR   72 (85)
T ss_pred             ccccccchHHHh
Confidence            458998876553


No 76 
>KOG3397|consensus
Probab=20.07  E-value=91  Score=30.96  Aligned_cols=10  Identities=10%  Similarity=-0.140  Sum_probs=4.6

Q ss_pred             chhhhcccCc
Q psy8304          47 TDQVASETSS   56 (593)
Q Consensus        47 ~~~~~~~~~~   56 (593)
                      ||...-|..+
T Consensus       126 DQ~~FYe~lG  135 (225)
T KOG3397|consen  126 DQCRFYESLG  135 (225)
T ss_pred             cchhhhhhhc
Confidence            4444444443


No 77 
>PF01213 CAP_N:  Adenylate cyclase associated (CAP) N terminal;  InterPro: IPR013992  Cyclase-associated proteins (CAPs) are highly conserved actin-binding proteins present in a wide range of organisms including yeast, fly, plants, and mammals. CAPs are multifunctional proteins that contain several structural domains. CAP is involved in species-specific signalling pathways [, , , ]. In Drosophila, CAP functions in Hedgehog-mediated eye development and in establishing oocyte polarity. In Dictyostelium (slim mold), CAP is involved in microfilament reorganisation near the plasma membrane in a PIP2-regulated manner and is required to perpetuate the cAMP relay signal to organise fruitbody formation. In plants, CAP is involved in plant signalling pathways required for co-ordinated organ expansion. In yeast, CAP is involved in adenylate cyclase activation, as well as in vesicle trafficking and endocytosis. In both yeast and mammals, CAPs appear to be involved in recycling G-actin monomers from ADF/cofilins for subsequent rounds of filament assembly [, ]. In mammals, there are two different CAPs (CAP1 and CAP2) that share 64% amino acid identity.  All CAPs appear to contain a C-terminal actin-binding domain that regulates actin remodelling in response to cellular signals and is required for normal cellular morphology, cell division, growth and locomotion in eukaryotes. CAP directly regulates actin filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localisation and the establishment of cell polarity. Actin exists both as globular (G) (monomeric) actin subunits and assembled into filamentous (F) actin. In cells, actin cycles between these two forms. Proteins that bind F-actin often regulate F-actin assembly and its interaction with other proteins, while proteins that interact with G-actin often control the availability of unpolymerised actin. CAPs bind G-actin.  In addition to actin-binding, CAPs can have additional roles, and may act as bifunctional proteins. In Saccharomyces cerevisiae (Baker's yeast), CAP is a component of the adenylyl cyclase complex (Cyr1p) that serves as an effector of Ras during normal cell signalling. S. cerevisiae CAP functions to expose adenylate cyclase binding sites to Ras, thereby enabling adenylate cyclase to be activated by Ras regulatory signals. In Schizosaccharomyces pombe (Fission yeast), CAP is also required for adenylate cyclase activity, but not through the Ras pathway. In both organisms, the N-terminal domain is responsible for adenylate cyclase activation, but the S cerevisiae and S. pombe N-termini cannot complement one another. Yeast CAPs are unique among the CAP family of proteins, because they are the only ones to directly interact with and activate adenylate cyclase []. S. cerevisiae CAP has four major domains. In addition to the N-terminal adenylate cyclase-interacting domain, and the C-terminal actin-binding domain, it possesses two other domains: a proline-rich domain that interacts with Src homology 3 (SH3) domains of specific proteins, and a domain that is responsible for CAP oligomerisation to form multimeric complexes (although oligomerisation appears to involve the N- and C-terminal domains as well). The proline-rich domain interacts with profilin, a protein that catalyses nucleotide exchange on G-actin monomers and promotes addition to barbed ends of filamentous F-actin []. Since CAP can bind profilin via a proline-rich domain, and G-actin via a C-terminal domain, it has been suggested that a ternary G-actin/CAP/profilin complex could be formed. This entry represents the N-terminal domain of CAP proteins. This domain has an all-alpha structure consisting of six helices in a bundle with a left-handed twist and an up-and-down topology [].; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1TJF_B 1S0P_A.
Probab=20.01  E-value=35  Score=36.60  Aligned_cols=18  Identities=44%  Similarity=1.040  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCC
Q psy8304         106 GVYHGPPPPPPPLSAAKP  123 (593)
Q Consensus       106 ~~~~~p~~~~~~~~~~~~  123 (593)
                      .+...||||||||+|+.+
T Consensus       228 ~~~~~PpPPppPpPP~~~  245 (312)
T PF01213_consen  228 SAPAAPPPPPPPPPPPAP  245 (312)
T ss_dssp             ------------------
T ss_pred             cccCCCCCCCCCCccccc


Done!