Query         psy8310
Match_columns 598
No_of_seqs    4 out of 6
Neff          1.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:29:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8310.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8310hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0350 Ada Methylated DNA-pro  65.6     2.1 4.6E-05   38.9   0.2   14  554-567   130-143 (168)
  2 PRK00901 methylated-DNA--prote  56.4     3.2 6.9E-05   37.7  -0.4   15  554-568   115-129 (155)
  3 TIGR00589 ogt O-6-methylguanin  45.9     5.5 0.00012   32.7  -0.5   14  555-568    45-58  (80)
  4 PRK10286 O-6-alkylguanine-DNA:  39.4     8.5 0.00018   35.8  -0.4   13  555-567   131-143 (171)
  5 PF01035 DNA_binding_1:  6-O-me  30.5      10 0.00023   30.8  -1.2   14  555-568    45-58  (85)
  6 cd06445 ATase The DNA repair p  26.1      18 0.00038   28.9  -0.6   15  555-569    43-57  (79)
  7 PRK03887 methylated-DNA--prote  25.0      20 0.00044   34.1  -0.5   14  555-568   134-147 (175)
  8 PRK15435 bifunctional DNA-bind  24.6      23 0.00049   35.4  -0.3   14  554-567   312-325 (353)
  9 PF04005 Hus1:  Hus1-like prote  13.0 2.5E+02  0.0054   27.1   3.8   51  524-577    95-146 (292)
 10 KOG4062|consensus               11.4      88  0.0019   30.4   0.3   11  556-566   133-143 (178)

No 1  
>COG0350 Ada Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]
Probab=65.65  E-value=2.1  Score=38.89  Aligned_cols=14  Identities=43%  Similarity=0.982  Sum_probs=11.8

Q ss_pred             eeecceEEeehhhh
Q psy8310         554 RVPVPAVVVCHRVK  567 (598)
Q Consensus       554 rvpvpavvvchrvk  567 (598)
                      +=|+|.||.||||-
T Consensus       130 ~NPl~IiIPCHRVi  143 (168)
T COG0350         130 ANPLPIIIPCHRVI  143 (168)
T ss_pred             cCCceEEecCeEeE
Confidence            34899999999984


No 2  
>PRK00901 methylated-DNA--protein-cysteine methyltransferase; Provisional
Probab=56.37  E-value=3.2  Score=37.68  Aligned_cols=15  Identities=40%  Similarity=0.928  Sum_probs=12.3

Q ss_pred             eeecceEEeehhhhh
Q psy8310         554 RVPVPAVVVCHRVKK  568 (598)
Q Consensus       554 rvpvpavvvchrvkk  568 (598)
                      +-|+|.+|.||||-.
T Consensus       115 ~NP~~iiIPCHRVv~  129 (155)
T PRK00901        115 KNPIPIFIPCHRVIG  129 (155)
T ss_pred             hCCCCCccCCceEEC
Confidence            348899999999954


No 3  
>TIGR00589 ogt O-6-methylguanine DNA methyltransferase. All proteins in this family for which functions are known are involved alkyl-DNA transferases which remove alkyl groups from DNA as part of alkylation DNA repair. Some of the proteins in this family are also transcription regulators and have a distinct transcription regulatory domain. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=45.92  E-value=5.5  Score=32.73  Aligned_cols=14  Identities=43%  Similarity=0.774  Sum_probs=11.4

Q ss_pred             eecceEEeehhhhh
Q psy8310         555 VPVPAVVVCHRVKK  568 (598)
Q Consensus       555 vpvpavvvchrvkk  568 (598)
                      -|++.+|.||||-.
T Consensus        45 np~~~~iPcHRVv~   58 (80)
T TIGR00589        45 NPLAILVPCHRVIG   58 (80)
T ss_pred             CCCCCCCCCceeEC
Confidence            37888999999953


No 4  
>PRK10286 O-6-alkylguanine-DNA:cysteine-protein methyltransferase; Provisional
Probab=39.35  E-value=8.5  Score=35.82  Aligned_cols=13  Identities=54%  Similarity=0.938  Sum_probs=11.4

Q ss_pred             eecceEEeehhhh
Q psy8310         555 VPVPAVVVCHRVK  567 (598)
Q Consensus       555 vpvpavvvchrvk  567 (598)
                      -|+|.+|.||||-
T Consensus       131 Np~~i~iPCHRVv  143 (171)
T PRK10286        131 NPISIVVPCHRVI  143 (171)
T ss_pred             CCCCCccCCceEE
Confidence            4889999999994


No 5  
>PF01035 DNA_binding_1:  6-O-methylguanine DNA methyltransferase, DNA binding domain;  InterPro: IPR014048 Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase This entry represents the DNA binding region of 6-O-methylguanine-DNA methyltransferases.  The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase (2.1.1.63 from EC). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme []. This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources [].; GO: 0003824 catalytic activity, 0006281 DNA repair; PDB: 1SFE_A 1T39_B 1T38_A 1EH7_A 1EH6_A 1YFH_C 1EH8_A 1QNT_A 2KIM_A 2KIF_A ....
Probab=30.49  E-value=10  Score=30.83  Aligned_cols=14  Identities=43%  Similarity=1.056  Sum_probs=11.4

Q ss_pred             eecceEEeehhhhh
Q psy8310         555 VPVPAVVVCHRVKK  568 (598)
Q Consensus       555 vpvpavvvchrvkk  568 (598)
                      -|++.+|.||||-.
T Consensus        45 np~~~~iP~HRVv~   58 (85)
T PF01035_consen   45 NPIPIIIPCHRVVN   58 (85)
T ss_dssp             SSCTTTSGGGGEEB
T ss_pred             ccccCCCCeEEEEC
Confidence            36888999999854


No 6  
>cd06445 ATase The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases are specific for repair of guanines with O6-alkyl adducts, however human ATase is not limited to O6-methylguanine, repairing many other adducts at the O6-position of guanine as well. ATase is widely distributed among species. Most ATases have N- and C-terminal domains. The C-terminal domain contains the conserved active-site cysteine motif (PCHR), the O6-alkylguanine binding channel, and the helix-turn-helix (HTH) DNA-binding motif. The active site is located near the recognition helix of the HTH motif. While the C-terminal domain of ATase contains residues that are necessary for DNA binding and alkyl transfer, the function of the N-terminal domain is still unknown. Removal of the N-terminal domain abolishes the activity of
Probab=26.11  E-value=18  Score=28.92  Aligned_cols=15  Identities=40%  Similarity=0.968  Sum_probs=11.6

Q ss_pred             eecceEEeehhhhhh
Q psy8310         555 VPVPAVVVCHRVKKM  569 (598)
Q Consensus       555 vpvpavvvchrvkkm  569 (598)
                      -|.+..|.||||-.-
T Consensus        43 np~~~~vP~HRVv~~   57 (79)
T cd06445          43 NPIPILIPCHRVVRS   57 (79)
T ss_pred             CCCCCCCCceeEECC
Confidence            466778999999654


No 7  
>PRK03887 methylated-DNA--protein-cysteine methyltransferase; Provisional
Probab=25.01  E-value=20  Score=34.11  Aligned_cols=14  Identities=50%  Similarity=0.918  Sum_probs=11.5

Q ss_pred             eecceEEeehhhhh
Q psy8310         555 VPVPAVVVCHRVKK  568 (598)
Q Consensus       555 vpvpavvvchrvkk  568 (598)
                      -|.+.+|.||||-.
T Consensus       134 NP~~i~IPCHRVV~  147 (175)
T PRK03887        134 NPYPIIVPCHRVVG  147 (175)
T ss_pred             CCCCCccCCeeEEC
Confidence            37888999999954


No 8  
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional
Probab=24.57  E-value=23  Score=35.44  Aligned_cols=14  Identities=36%  Similarity=0.631  Sum_probs=11.6

Q ss_pred             eeecceEEeehhhh
Q psy8310         554 RVPVPAVVVCHRVK  567 (598)
Q Consensus       554 rvpvpavvvchrvk  567 (598)
                      +-|++.+|.||||-
T Consensus       312 ~np~~~~iPchRvv  325 (353)
T PRK15435        312 ANKLAIVIPCHRVV  325 (353)
T ss_pred             hCCCCcccCCceeE
Confidence            45788899999985


No 9  
>PF04005 Hus1:  Hus1-like protein;  InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast. These proteins are known to form a stable complex in vivo []. Hus1-Rad1-Rad9 complex may form a PCNA-like ring structure, and could function as a sliding clamp during checkpoint control.; PDB: 3A1J_B 3G65_C 3GGR_B.
Probab=13.02  E-value=2.5e+02  Score=27.06  Aligned_cols=51  Identities=22%  Similarity=0.420  Sum_probs=28.8

Q ss_pred             cceeeecc-ccceeeeehhhhhccccccCeeeeecceEEeehhhhhhccCCCCCc
Q psy8310         524 TKLRLVKK-KVPVVMRQVHLQEMNHQEKNIVRVPVPAVVVCHRVKKMLDHSEPVR  577 (598)
Q Consensus       524 tklrlvkk-kvpvvmrqvhlqemnhqeknivrvpvpavvvchrvkkmldhsepvr  577 (598)
                      .++||.|| ..|+.--.+....++..++.|+. -||..|+ ++ +.+-+..||.-
T Consensus        95 ~~ikL~kk~~~p~L~~~~~~~~~~~~~~~v~h-diPV~vl-~~-~~~~~~~eP~~  146 (292)
T PF04005_consen   95 VKIKLTKKGRMPCLSFEITGTSSSGRSRIVVH-DIPVRVL-PR-REWEELQEPMV  146 (292)
T ss_dssp             EEEEEE-S-SSSEEEEEEEE--SSST-EEEEE-EEEBEE---G-GGGGGGS----
T ss_pred             eEEehhhccCCcEEEEEEEeeccCCCccEEEE-ECCeEec-CH-HHHHHhhhccc
Confidence            48999999 99998777777766555555555 7777776 43 44455666654


No 10 
>KOG4062|consensus
Probab=11.38  E-value=88  Score=30.36  Aligned_cols=11  Identities=45%  Similarity=0.890  Sum_probs=0.0

Q ss_pred             ecceEEeehhh
Q psy8310         556 PVPAVVVCHRV  566 (598)
Q Consensus       556 pvpavvvchrv  566 (598)
                      +++..|.||||
T Consensus       133 ~la~lvPcHRV  143 (178)
T KOG4062|consen  133 NLAILVPCHRV  143 (178)
T ss_pred             CCcEEecceee


Done!