Query psy8310
Match_columns 598
No_of_seqs 4 out of 6
Neff 1.2
Searched_HMMs 46136
Date Sat Aug 17 00:29:36 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy8310.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8310hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG0350 Ada Methylated DNA-pro 65.6 2.1 4.6E-05 38.9 0.2 14 554-567 130-143 (168)
2 PRK00901 methylated-DNA--prote 56.4 3.2 6.9E-05 37.7 -0.4 15 554-568 115-129 (155)
3 TIGR00589 ogt O-6-methylguanin 45.9 5.5 0.00012 32.7 -0.5 14 555-568 45-58 (80)
4 PRK10286 O-6-alkylguanine-DNA: 39.4 8.5 0.00018 35.8 -0.4 13 555-567 131-143 (171)
5 PF01035 DNA_binding_1: 6-O-me 30.5 10 0.00023 30.8 -1.2 14 555-568 45-58 (85)
6 cd06445 ATase The DNA repair p 26.1 18 0.00038 28.9 -0.6 15 555-569 43-57 (79)
7 PRK03887 methylated-DNA--prote 25.0 20 0.00044 34.1 -0.5 14 555-568 134-147 (175)
8 PRK15435 bifunctional DNA-bind 24.6 23 0.00049 35.4 -0.3 14 554-567 312-325 (353)
9 PF04005 Hus1: Hus1-like prote 13.0 2.5E+02 0.0054 27.1 3.8 51 524-577 95-146 (292)
10 KOG4062|consensus 11.4 88 0.0019 30.4 0.3 11 556-566 133-143 (178)
No 1
>COG0350 Ada Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]
Probab=65.65 E-value=2.1 Score=38.89 Aligned_cols=14 Identities=43% Similarity=0.982 Sum_probs=11.8
Q ss_pred eeecceEEeehhhh
Q psy8310 554 RVPVPAVVVCHRVK 567 (598)
Q Consensus 554 rvpvpavvvchrvk 567 (598)
+=|+|.||.||||-
T Consensus 130 ~NPl~IiIPCHRVi 143 (168)
T COG0350 130 ANPLPIIIPCHRVI 143 (168)
T ss_pred cCCceEEecCeEeE
Confidence 34899999999984
No 2
>PRK00901 methylated-DNA--protein-cysteine methyltransferase; Provisional
Probab=56.37 E-value=3.2 Score=37.68 Aligned_cols=15 Identities=40% Similarity=0.928 Sum_probs=12.3
Q ss_pred eeecceEEeehhhhh
Q psy8310 554 RVPVPAVVVCHRVKK 568 (598)
Q Consensus 554 rvpvpavvvchrvkk 568 (598)
+-|+|.+|.||||-.
T Consensus 115 ~NP~~iiIPCHRVv~ 129 (155)
T PRK00901 115 KNPIPIFIPCHRVIG 129 (155)
T ss_pred hCCCCCccCCceEEC
Confidence 348899999999954
No 3
>TIGR00589 ogt O-6-methylguanine DNA methyltransferase. All proteins in this family for which functions are known are involved alkyl-DNA transferases which remove alkyl groups from DNA as part of alkylation DNA repair. Some of the proteins in this family are also transcription regulators and have a distinct transcription regulatory domain. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=45.92 E-value=5.5 Score=32.73 Aligned_cols=14 Identities=43% Similarity=0.774 Sum_probs=11.4
Q ss_pred eecceEEeehhhhh
Q psy8310 555 VPVPAVVVCHRVKK 568 (598)
Q Consensus 555 vpvpavvvchrvkk 568 (598)
-|++.+|.||||-.
T Consensus 45 np~~~~iPcHRVv~ 58 (80)
T TIGR00589 45 NPLAILVPCHRVIG 58 (80)
T ss_pred CCCCCCCCCceeEC
Confidence 37888999999953
No 4
>PRK10286 O-6-alkylguanine-DNA:cysteine-protein methyltransferase; Provisional
Probab=39.35 E-value=8.5 Score=35.82 Aligned_cols=13 Identities=54% Similarity=0.938 Sum_probs=11.4
Q ss_pred eecceEEeehhhh
Q psy8310 555 VPVPAVVVCHRVK 567 (598)
Q Consensus 555 vpvpavvvchrvk 567 (598)
-|+|.+|.||||-
T Consensus 131 Np~~i~iPCHRVv 143 (171)
T PRK10286 131 NPISIVVPCHRVI 143 (171)
T ss_pred CCCCCccCCceEE
Confidence 4889999999994
No 5
>PF01035 DNA_binding_1: 6-O-methylguanine DNA methyltransferase, DNA binding domain; InterPro: IPR014048 Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase This entry represents the DNA binding region of 6-O-methylguanine-DNA methyltransferases. The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase (2.1.1.63 from EC). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme []. This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources [].; GO: 0003824 catalytic activity, 0006281 DNA repair; PDB: 1SFE_A 1T39_B 1T38_A 1EH7_A 1EH6_A 1YFH_C 1EH8_A 1QNT_A 2KIM_A 2KIF_A ....
Probab=30.49 E-value=10 Score=30.83 Aligned_cols=14 Identities=43% Similarity=1.056 Sum_probs=11.4
Q ss_pred eecceEEeehhhhh
Q psy8310 555 VPVPAVVVCHRVKK 568 (598)
Q Consensus 555 vpvpavvvchrvkk 568 (598)
-|++.+|.||||-.
T Consensus 45 np~~~~iP~HRVv~ 58 (85)
T PF01035_consen 45 NPIPIIIPCHRVVN 58 (85)
T ss_dssp SSCTTTSGGGGEEB
T ss_pred ccccCCCCeEEEEC
Confidence 36888999999854
No 6
>cd06445 ATase The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases are specific for repair of guanines with O6-alkyl adducts, however human ATase is not limited to O6-methylguanine, repairing many other adducts at the O6-position of guanine as well. ATase is widely distributed among species. Most ATases have N- and C-terminal domains. The C-terminal domain contains the conserved active-site cysteine motif (PCHR), the O6-alkylguanine binding channel, and the helix-turn-helix (HTH) DNA-binding motif. The active site is located near the recognition helix of the HTH motif. While the C-terminal domain of ATase contains residues that are necessary for DNA binding and alkyl transfer, the function of the N-terminal domain is still unknown. Removal of the N-terminal domain abolishes the activity of
Probab=26.11 E-value=18 Score=28.92 Aligned_cols=15 Identities=40% Similarity=0.968 Sum_probs=11.6
Q ss_pred eecceEEeehhhhhh
Q psy8310 555 VPVPAVVVCHRVKKM 569 (598)
Q Consensus 555 vpvpavvvchrvkkm 569 (598)
-|.+..|.||||-.-
T Consensus 43 np~~~~vP~HRVv~~ 57 (79)
T cd06445 43 NPIPILIPCHRVVRS 57 (79)
T ss_pred CCCCCCCCceeEECC
Confidence 466778999999654
No 7
>PRK03887 methylated-DNA--protein-cysteine methyltransferase; Provisional
Probab=25.01 E-value=20 Score=34.11 Aligned_cols=14 Identities=50% Similarity=0.918 Sum_probs=11.5
Q ss_pred eecceEEeehhhhh
Q psy8310 555 VPVPAVVVCHRVKK 568 (598)
Q Consensus 555 vpvpavvvchrvkk 568 (598)
-|.+.+|.||||-.
T Consensus 134 NP~~i~IPCHRVV~ 147 (175)
T PRK03887 134 NPYPIIVPCHRVVG 147 (175)
T ss_pred CCCCCccCCeeEEC
Confidence 37888999999954
No 8
>PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional
Probab=24.57 E-value=23 Score=35.44 Aligned_cols=14 Identities=36% Similarity=0.631 Sum_probs=11.6
Q ss_pred eeecceEEeehhhh
Q psy8310 554 RVPVPAVVVCHRVK 567 (598)
Q Consensus 554 rvpvpavvvchrvk 567 (598)
+-|++.+|.||||-
T Consensus 312 ~np~~~~iPchRvv 325 (353)
T PRK15435 312 ANKLAIVIPCHRVV 325 (353)
T ss_pred hCCCCcccCCceeE
Confidence 45788899999985
No 9
>PF04005 Hus1: Hus1-like protein; InterPro: IPR007150 Hus1, Rad1, and Rad9 are three evolutionarily conserved proteins required for checkpoint control in fission yeast. These proteins are known to form a stable complex in vivo []. Hus1-Rad1-Rad9 complex may form a PCNA-like ring structure, and could function as a sliding clamp during checkpoint control.; PDB: 3A1J_B 3G65_C 3GGR_B.
Probab=13.02 E-value=2.5e+02 Score=27.06 Aligned_cols=51 Identities=22% Similarity=0.420 Sum_probs=28.8
Q ss_pred cceeeecc-ccceeeeehhhhhccccccCeeeeecceEEeehhhhhhccCCCCCc
Q psy8310 524 TKLRLVKK-KVPVVMRQVHLQEMNHQEKNIVRVPVPAVVVCHRVKKMLDHSEPVR 577 (598)
Q Consensus 524 tklrlvkk-kvpvvmrqvhlqemnhqeknivrvpvpavvvchrvkkmldhsepvr 577 (598)
.++||.|| ..|+.--.+....++..++.|+. -||..|+ ++ +.+-+..||.-
T Consensus 95 ~~ikL~kk~~~p~L~~~~~~~~~~~~~~~v~h-diPV~vl-~~-~~~~~~~eP~~ 146 (292)
T PF04005_consen 95 VKIKLTKKGRMPCLSFEITGTSSSGRSRIVVH-DIPVRVL-PR-REWEELQEPMV 146 (292)
T ss_dssp EEEEEE-S-SSSEEEEEEEE--SSST-EEEEE-EEEBEE---G-GGGGGGS----
T ss_pred eEEehhhccCCcEEEEEEEeeccCCCccEEEE-ECCeEec-CH-HHHHHhhhccc
Confidence 48999999 99998777777766555555555 7777776 43 44455666654
No 10
>KOG4062|consensus
Probab=11.38 E-value=88 Score=30.36 Aligned_cols=11 Identities=45% Similarity=0.890 Sum_probs=0.0
Q ss_pred ecceEEeehhh
Q psy8310 556 PVPAVVVCHRV 566 (598)
Q Consensus 556 pvpavvvchrv 566 (598)
+++..|.||||
T Consensus 133 ~la~lvPcHRV 143 (178)
T KOG4062|consen 133 NLAILVPCHRV 143 (178)
T ss_pred CCcEEecceee
Done!