Query         psy8320
Match_columns 119
No_of_seqs    90 out of 106
Neff          3.4 
Searched_HMMs 46136
Date          Sat Aug 17 00:42:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8320.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8320hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3476|consensus              100.0 2.5E-56 5.3E-61  319.8   2.7  100   20-119     1-100 (100)
  2 PF10235 Cript:  Microtubule-as 100.0 5.7E-48 1.2E-52  273.6   4.0   88   30-119     1-90  (90)
  3 PF10217 DUF2039:  Uncharacteri  94.9  0.0032   7E-08   45.3  -1.8   41   66-107    49-90  (92)
  4 COG5152 Uncharacterized conser  91.3   0.052 1.1E-06   44.9  -0.3   34   75-108   198-240 (259)
  5 PF12773 DZR:  Double zinc ribb  90.3    0.19   4E-06   30.6   1.6   33   76-109     1-40  (50)
  6 KOG3241|consensus               90.1   0.025 5.4E-07   46.1  -3.1   46   65-111    60-106 (227)
  7 PRK14559 putative protein seri  81.0     0.9 1.9E-05   41.8   1.7   35   74-109     2-38  (645)
  8 PF13248 zf-ribbon_3:  zinc-rib  78.0     1.1 2.3E-05   24.8   0.7   22   74-96      3-24  (26)
  9 PF13240 zinc_ribbon_2:  zinc-r  74.7     1.3 2.8E-05   24.2   0.5   20   75-95      1-20  (23)
 10 PF14634 zf-RING_5:  zinc-RING   72.9     0.9   2E-05   27.2  -0.4   20   87-106    21-44  (44)
 11 TIGR00570 cdk7 CDK-activating   70.9     1.7 3.7E-05   37.1   0.6   36   75-110     5-55  (309)
 12 KOG1813|consensus               60.8     4.1 8.8E-05   35.1   1.0   36   75-110   243-287 (313)
 13 PF13920 zf-C3HC4_3:  Zinc fing  60.6     1.7 3.8E-05   26.3  -0.9   25   87-111    21-50  (50)
 14 PRK12496 hypothetical protein;  55.5     5.3 0.00012   30.5   0.7   22   88-109   127-154 (164)
 15 smart00504 Ubox Modified RING   55.3     4.7  0.0001   24.6   0.4   23   87-109    20-46  (63)
 16 PF10764 Gin:  Inhibitor of sig  52.1     7.7 0.00017   24.4   1.0   25   13-37     12-36  (46)
 17 PF07191 zinc-ribbons_6:  zinc-  51.9     3.7   8E-05   28.4  -0.6   36   75-110     3-42  (70)
 18 KOG2272|consensus               47.6      11 0.00024   32.5   1.5   52   55-109   148-206 (332)
 19 TIGR00599 rad18 DNA repair pro  47.3       8 0.00017   33.9   0.7   36   74-109    27-71  (397)
 20 PF10571 UPF0547:  Uncharacteri  45.8     9.8 0.00021   21.4   0.6   22   75-97      2-23  (26)
 21 PF06906 DUF1272:  Protein of u  45.2     8.6 0.00019   25.8   0.4   36   74-109     6-52  (57)
 22 PF03660 PHF5:  PHF5-like prote  41.9     6.4 0.00014   29.3  -0.7   27   69-95     51-77  (106)
 23 cd00162 RING RING-finger (Real  41.4      11 0.00024   20.5   0.4   21   87-107    19-44  (45)
 24 PRK11595 DNA utilization prote  40.9      14 0.00031   28.8   1.1   33   75-107     7-43  (227)
 25 smart00132 LIM Zinc-binding do  39.8      22 0.00048   19.1   1.5    9  100-108    29-37  (39)
 26 PF14471 DUF4428:  Domain of un  39.7      14 0.00031   23.4   0.8   16  100-115     1-16  (51)
 27 cd04476 RPA1_DBD_C RPA1_DBD_C:  39.0      12 0.00025   27.6   0.3   22   73-94     34-57  (166)
 28 KOG3799|consensus               38.2      15 0.00031   29.1   0.8   36   73-110    65-101 (169)
 29 PF01258 zf-dskA_traR:  Prokary  36.3      15 0.00033   21.2   0.4   12   99-110     4-15  (36)
 30 PF13923 zf-C3HC4_2:  Zinc fing  35.8     5.4 0.00012   23.0  -1.5   10   87-96     18-27  (39)
 31 PF14446 Prok-RING_1:  Prokaryo  35.2      18 0.00038   23.9   0.7   14   96-109     3-16  (54)
 32 PF13894 zf-C2H2_4:  C2H2-type   34.6     9.8 0.00021   18.6  -0.5   15  100-114     2-16  (24)
 33 PLN03208 E3 ubiquitin-protein   34.0      14 0.00031   29.7   0.1   36   75-110    20-80  (193)
 34 PF05715 zf-piccolo:  Piccolo Z  33.8      16 0.00034   24.9   0.3   10   98-107    30-39  (61)
 35 TIGR00375 conserved hypothetic  33.2      19 0.00041   31.3   0.8   38   65-109   230-269 (374)
 36 KOG0320|consensus               32.9      11 0.00024   30.4  -0.6   36   74-109   132-178 (187)
 37 PRK00420 hypothetical protein;  26.7      30 0.00064   25.6   0.7   22   73-94     23-46  (112)
 38 TIGR02420 dksA RNA polymerase-  26.4      27 0.00059   24.7   0.5   11   99-109    81-91  (110)
 39 PHA02929 N1R/p28-like protein;  26.3      28  0.0006   28.6   0.6   40   73-112   174-230 (238)
 40 COG0266 Nei Formamidopyrimidin  24.7      30 0.00064   29.1   0.5   33   63-95    235-272 (273)
 41 smart00746 TRASH metallochaper  24.6      36 0.00077   16.9   0.6    9  101-109     1-9   (39)
 42 KOG4458|consensus               24.5      28  0.0006   24.5   0.2   33   63-102     4-36  (78)
 43 PF06827 zf-FPG_IleRS:  Zinc fi  24.3      20 0.00042   19.9  -0.5   21   75-95      3-28  (30)
 44 PRK14810 formamidopyrimidine-D  24.2      33 0.00073   27.8   0.7   30   65-94    236-270 (272)
 45 PRK01103 formamidopyrimidine/5  24.2      31 0.00067   27.9   0.5   30   66-95    238-272 (274)
 46 PF10367 Vps39_2:  Vacuolar sor  24.1      18  0.0004   23.9  -0.7   23   14-36     73-98  (109)
 47 PF10621 FpoO:  F420H2 dehydrog  24.1      34 0.00073   26.0   0.6   35   68-108    29-70  (119)
 48 PHA03096 p28-like protein; Pro  23.4      22 0.00047   29.8  -0.6   25   92-116   135-160 (284)
 49 PF11571 Med27:  Mediator compl  22.8      45 0.00098   22.9   1.0   23   18-40     53-76  (90)
 50 PF09706 Cas_CXXC_CXXC:  CRISPR  22.3      46 0.00099   22.1   0.9   11   97-107     4-14  (69)
 51 TIGR03826 YvyF flagellar opero  21.9      38 0.00082   25.7   0.5   24   71-96     79-102 (137)
 52 PRK05580 primosome assembly pr  21.8      51  0.0011   30.2   1.4   22   88-109   408-432 (679)
 53 COG1996 RPC10 DNA-directed RNA  21.7      37 0.00081   21.9   0.4   28   75-109     8-35  (49)
 54 KOG1734|consensus               21.5      31 0.00067   30.0  -0.0   16   97-112   223-238 (328)
 55 COG1645 Uncharacterized Zn-fin  21.4      38 0.00081   25.9   0.4   24   74-97     29-53  (131)
 56 PRK14811 formamidopyrimidine-D  21.1      40 0.00086   27.4   0.6   33   65-97    227-264 (269)
 57 PHA02565 49 recombination endo  21.1      44 0.00096   26.3   0.8   14   96-109    18-31  (157)

No 1  
>KOG3476|consensus
Probab=100.00  E-value=2.5e-56  Score=319.83  Aligned_cols=100  Identities=68%  Similarity=1.234  Sum_probs=97.8

Q ss_pred             cchhHHHhhhccccCCCCCCCCCCccccCCCeecccccchhhhhhccCCCcccCccchhhhhhcccCCCccCcccccccc
Q psy8320          20 MVCSKCEKKLGKVITPDNWKSGSRNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKG   99 (119)
Q Consensus        20 MVC~KCEKKL~klatPD~~k~Gs~~~~~~g~rki~eNKlLs~~k~r~~Py~~~~~~C~iCK~~vhq~g~~YCq~CAYkkG   99 (119)
                      |||+||||||++|++|||||+|+||++++|+|+|+|||.|.+.++||+||+..+.+|+|||+.|||+|+||||.|||+||
T Consensus         1 MVC~kCEkKLskvi~pd~wr~garn~~~sGgrkinenkaL~s~k~r~~p~gt~~~kC~iCk~~vHQ~GshYC~tCAY~Kg   80 (100)
T KOG3476|consen    1 MVCEKCEKKLSKVIGPDPWRDGARNTTESGGRKINENKALISKKKRATPYGTALAKCRICKQLVHQPGSHYCQTCAYKKG   80 (100)
T ss_pred             CchhHHHHHhccccccCcccccccccCCCCCeecchhhhhhhhhhhcCccccccchhHHHHHHhcCCcchhHhHhhhhhh
Confidence            99999999999999999999999999999999999999888878999999999999999999999999999999999999


Q ss_pred             cccccCcccccccccccccC
Q psy8320         100 ICAMCGKKLLDVKNYKQSAA  119 (119)
Q Consensus       100 iCamCGKki~Dt~~ykqS~~  119 (119)
                      |||||||+|+||++|+||++
T Consensus        81 iCAMCGKki~nTK~ykQsst  100 (100)
T KOG3476|consen   81 ICAMCGKKILNTKNYKQSST  100 (100)
T ss_pred             HHHHhhhHhhccccccccCC
Confidence            99999999999999999986


No 2  
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=100.00  E-value=5.7e-48  Score=273.56  Aligned_cols=88  Identities=66%  Similarity=1.194  Sum_probs=83.9

Q ss_pred             ccccCCCCCCCCC--CccccCCCeecccccchhhhhhccCCCcccCccchhhhhhcccCCCccCcccccccccccccCcc
Q psy8320          30 GKVITPDNWKSGS--RNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICAMCGKK  107 (119)
Q Consensus        30 ~klatPD~~k~Gs--~~~~~~g~rki~eNKlLs~~k~r~~Py~~~~~~C~iCK~~vhq~g~~YCq~CAYkkGiCamCGKk  107 (119)
                      ++||||||||+|+  +++.++|+|+||||||||+. ++ |||++++++|++||++|||+|+||||.|||++||||||||+
T Consensus         1 tklatPd~~k~~~~~~~~~~~g~r~i~eNKlLs~~-~~-nPy~~~~~~C~~CK~~v~q~g~~YCq~CAYkkGiCamCGKk   78 (90)
T PF10235_consen    1 TKLATPDPWKKGAMYRNTAESGGRKIGENKLLSKK-KK-NPYAPYSSKCKICKTKVHQPGAKYCQTCAYKKGICAMCGKK   78 (90)
T ss_pred             CccccCCccccCcccccccCCCCccccceeeeccc-cc-CcccccCccccccccccccCCCccChhhhcccCcccccCCe
Confidence            4799999999999  99999999999999999873 44 99999999999999999999999999999999999999999


Q ss_pred             cccccccccccC
Q psy8320         108 LLDVKNYKQSAA  119 (119)
Q Consensus       108 i~Dt~~ykqS~~  119 (119)
                      |+||++|+||+|
T Consensus        79 i~dtk~ykqs~v   90 (90)
T PF10235_consen   79 ILDTKNYKQSSV   90 (90)
T ss_pred             ecccccccccCC
Confidence            999999999987


No 3  
>PF10217 DUF2039:  Uncharacterized conserved protein (DUF2039);  InterPro: IPR019351  This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. 
Probab=94.91  E-value=0.0032  Score=45.29  Aligned_cols=41  Identities=37%  Similarity=0.808  Sum_probs=33.4

Q ss_pred             cCCCcccCccchhhhh-hcccCCCccCcccccccccccccCcc
Q psy8320          66 FNPYTQKFESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKK  107 (119)
Q Consensus        66 ~~Py~~~~~~C~iCK~-~vhq~g~~YCq~CAYkkGiCamCGKk  107 (119)
                      |-|..+ .++|-.|.+ .|.+.=|..|+.||-..++||.||++
T Consensus        49 YKpLt~-p~kC~~C~qktVk~AYh~iC~~Ca~~~~vCaKC~k~   90 (92)
T PF10217_consen   49 YKPLTQ-PKKCNKCQQKTVKHAYHVICDPCAKELKVCAKCGKP   90 (92)
T ss_pred             cccCCC-CccccccccchHHHHHHHHHHHHHHhhccCcccCCC
Confidence            334433 469999996 67777788999999999999999986


No 4  
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=91.27  E-value=0.052  Score=44.94  Aligned_cols=34  Identities=41%  Similarity=1.117  Sum_probs=27.9

Q ss_pred             cchhhhhhc-----ccCCCccCcccc---cccc-cccccCccc
Q psy8320          75 SCKICRQKV-----HQVGSHYCQACA---YKKG-ICAMCGKKL  108 (119)
Q Consensus        75 ~C~iCK~~v-----hq~g~~YCq~CA---YkkG-iCamCGKki  108 (119)
                      .|.|||...     ..-||++|..||   |++| .|-.||+..
T Consensus       198 ~C~iCKkdy~spvvt~CGH~FC~~Cai~~y~kg~~C~~Cgk~t  240 (259)
T COG5152         198 LCGICKKDYESPVVTECGHSFCSLCAIRKYQKGDECGVCGKAT  240 (259)
T ss_pred             eehhchhhccchhhhhcchhHHHHHHHHHhccCCcceecchhh
Confidence            899999753     344999999999   6776 799999864


No 5  
>PF12773 DZR:  Double zinc ribbon
Probab=90.29  E-value=0.19  Score=30.56  Aligned_cols=33  Identities=24%  Similarity=0.673  Sum_probs=19.4

Q ss_pred             chhhhhhcccCCCccCcccccccc-------cccccCcccc
Q psy8320          76 CKICRQKVHQVGSHYCQACAYKKG-------ICAMCGKKLL  109 (119)
Q Consensus        76 C~iCK~~vhq~g~~YCq~CAYkkG-------iCamCGKki~  109 (119)
                      |..|.+.+.. ++.||..|-..-.       +|.-||..+.
T Consensus         1 Cp~Cg~~~~~-~~~fC~~CG~~l~~~~~~~~~C~~Cg~~~~   40 (50)
T PF12773_consen    1 CPHCGTPNPD-DAKFCPHCGTPLPPPDQSKKICPNCGAENP   40 (50)
T ss_pred             CCCcCCcCCc-cccCChhhcCChhhccCCCCCCcCCcCCCc
Confidence            4455555555 4666666655444       5777776654


No 6  
>KOG3241|consensus
Probab=90.09  E-value=0.025  Score=46.06  Aligned_cols=46  Identities=28%  Similarity=0.755  Sum_probs=37.2

Q ss_pred             ccCCCcccCccchhhhh-hcccCCCccCcccccccccccccCcccccc
Q psy8320          65 RFNPYTQKFESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLDV  111 (119)
Q Consensus        65 r~~Py~~~~~~C~iCK~-~vhq~g~~YCq~CAYkkGiCamCGKki~Dt  111 (119)
                      +|-|.+. ..+|..|+. .|.|.-|..|..||-...+||-|+|.+.++
T Consensus        60 KYKpLt~-akkC~kC~~r~Vk~aYH~~Cr~CA~e~~vCAKC~ks~~~i  106 (227)
T KOG3241|consen   60 KYKPLTE-AKKCQKCTKRNVKQAYHKLCRGCAKEQKVCAKCCKSVDQI  106 (227)
T ss_pred             cccccch-hHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHhccHHHh
Confidence            3455544 459999987 788888899999999999999999976543


No 7  
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=81.03  E-value=0.9  Score=41.77  Aligned_cols=35  Identities=23%  Similarity=0.651  Sum_probs=28.1

Q ss_pred             ccchhhhhhcccCCCccCccccccc--ccccccCcccc
Q psy8320          74 ESCKICRQKVHQVGSHYCQACAYKK--GICAMCGKKLL  109 (119)
Q Consensus        74 ~~C~iCK~~vhq~g~~YCq~CAYkk--GiCamCGKki~  109 (119)
                      ..|..|...+.. +++||+.|-.+-  ..|+-||..+.
T Consensus         2 ~~Cp~Cg~~n~~-~akFC~~CG~~l~~~~Cp~CG~~~~   38 (645)
T PRK14559          2 LICPQCQFENPN-NNRFCQKCGTSLTHKPCPQCGTEVP   38 (645)
T ss_pred             CcCCCCCCcCCC-CCccccccCCCCCCCcCCCCCCCCC
Confidence            378899988876 889999998774  36888888765


No 8  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=78.05  E-value=1.1  Score=24.77  Aligned_cols=22  Identities=18%  Similarity=0.694  Sum_probs=16.4

Q ss_pred             ccchhhhhhcccCCCccCccccc
Q psy8320          74 ESCKICRQKVHQVGSHYCQACAY   96 (119)
Q Consensus        74 ~~C~iCK~~vhq~g~~YCq~CAY   96 (119)
                      ..|..|...+.. +++||+.|-.
T Consensus         3 ~~Cp~Cg~~~~~-~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDP-DAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCc-ccccChhhCC
Confidence            478899996655 7898887643


No 9  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=74.72  E-value=1.3  Score=24.19  Aligned_cols=20  Identities=20%  Similarity=0.866  Sum_probs=14.7

Q ss_pred             cchhhhhhcccCCCccCcccc
Q psy8320          75 SCKICRQKVHQVGSHYCQACA   95 (119)
Q Consensus        75 ~C~iCK~~vhq~g~~YCq~CA   95 (119)
                      .|..|..++.. ++++|+.|-
T Consensus         1 ~Cp~CG~~~~~-~~~fC~~CG   20 (23)
T PF13240_consen    1 YCPNCGAEIED-DAKFCPNCG   20 (23)
T ss_pred             CCcccCCCCCC-cCcchhhhC
Confidence            37788888876 778776654


No 10 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=72.88  E-value=0.9  Score=27.16  Aligned_cols=20  Identities=35%  Similarity=0.936  Sum_probs=16.7

Q ss_pred             CCccCcccccccc----cccccCc
Q psy8320          87 GSHYCQACAYKKG----ICAMCGK  106 (119)
Q Consensus        87 g~~YCq~CAYkkG----iCamCGK  106 (119)
                      ||.+|+.|+.+.-    .|..|++
T Consensus        21 gH~~C~~C~~~~~~~~~~CP~C~k   44 (44)
T PF14634_consen   21 GHIFCEKCLKKLKGKSVKCPICRK   44 (44)
T ss_pred             CCHHHHHHHHhhcCCCCCCcCCCC
Confidence            7889999988776    8888875


No 11 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=70.90  E-value=1.7  Score=37.06  Aligned_cols=36  Identities=28%  Similarity=0.755  Sum_probs=25.6

Q ss_pred             cchhhhhh----------cccCCCccCcccccc-----cccccccCccccc
Q psy8320          75 SCKICRQK----------VHQVGSHYCQACAYK-----KGICAMCGKKLLD  110 (119)
Q Consensus        75 ~C~iCK~~----------vhq~g~~YCq~CAYk-----kGiCamCGKki~D  110 (119)
                      .|.+|++.          |+.=||.+|.+|.-.     .+.|+.|++.+..
T Consensus         5 ~CP~Ck~~~y~np~~kl~i~~CGH~~C~sCv~~l~~~~~~~CP~C~~~lrk   55 (309)
T TIGR00570         5 GCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGSGSCPECDTPLRK   55 (309)
T ss_pred             CCCcCCCCCccCcccccccCCCCCcccHHHHHHHhcCCCCCCCCCCCccch
Confidence            57777772          233489999999743     3489999987753


No 12 
>KOG1813|consensus
Probab=60.77  E-value=4.1  Score=35.14  Aligned_cols=36  Identities=33%  Similarity=0.907  Sum_probs=29.2

Q ss_pred             cchhhhhhc-----ccCCCccCcccc---ccc-ccccccCccccc
Q psy8320          75 SCKICRQKV-----HQVGSHYCQACA---YKK-GICAMCGKKLLD  110 (119)
Q Consensus        75 ~C~iCK~~v-----hq~g~~YCq~CA---Ykk-GiCamCGKki~D  110 (119)
                      +|-||+..-     ..-||++|-.||   |++ -.|-.|++++.-
T Consensus       243 ~c~icr~~f~~pVvt~c~h~fc~~ca~~~~qk~~~c~vC~~~t~g  287 (313)
T KOG1813|consen  243 KCFICRKYFYRPVVTKCGHYFCEVCALKPYQKGEKCYVCSQQTHG  287 (313)
T ss_pred             cccccccccccchhhcCCceeehhhhccccccCCcceeccccccc
Confidence            899999853     344899999999   777 589999998763


No 13 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=60.55  E-value=1.7  Score=26.28  Aligned_cols=25  Identities=28%  Similarity=0.813  Sum_probs=19.1

Q ss_pred             CCc-cCccccccc----ccccccCcccccc
Q psy8320          87 GSH-YCQACAYKK----GICAMCGKKLLDV  111 (119)
Q Consensus        87 g~~-YCq~CAYkk----GiCamCGKki~Dt  111 (119)
                      ||. +|..|+.+-    ..|.+|-..|.++
T Consensus        21 gH~~~C~~C~~~~~~~~~~CP~Cr~~i~~V   50 (50)
T PF13920_consen   21 GHLCFCEECAERLLKRKKKCPICRQPIESV   50 (50)
T ss_dssp             CEEEEEHHHHHHHHHTTSBBTTTTBB-SEE
T ss_pred             CChHHHHHHhHHhcccCCCCCcCChhhcCC
Confidence            566 788888766    8999999988753


No 14 
>PRK12496 hypothetical protein; Provisional
Probab=55.46  E-value=5.3  Score=30.49  Aligned_cols=22  Identities=27%  Similarity=1.001  Sum_probs=16.7

Q ss_pred             CccCcccc--c----ccccccccCcccc
Q psy8320          88 SHYCQACA--Y----KKGICAMCGKKLL  109 (119)
Q Consensus        88 ~~YCq~CA--Y----kkGiCamCGKki~  109 (119)
                      .++|++|-  |    ..+.|..||-++.
T Consensus       127 ~~~C~gC~~~~~~~~~~~~C~~CG~~~~  154 (164)
T PRK12496        127 RKVCKGCKKKYPEDYPDDVCEICGSPVK  154 (164)
T ss_pred             eEECCCCCccccCCCCCCcCCCCCChhh
Confidence            35688887  5    4567999998875


No 15 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=55.25  E-value=4.7  Score=24.64  Aligned_cols=23  Identities=22%  Similarity=0.353  Sum_probs=17.8

Q ss_pred             CCccCccccc----ccccccccCcccc
Q psy8320          87 GSHYCQACAY----KKGICAMCGKKLL  109 (119)
Q Consensus        87 g~~YCq~CAY----kkGiCamCGKki~  109 (119)
                      |+.||..|..    ..+.|.+||+.+.
T Consensus        20 G~v~~~~~i~~~~~~~~~cP~~~~~~~   46 (63)
T smart00504       20 GQTYERRAIEKWLLSHGTDPVTGQPLT   46 (63)
T ss_pred             CCEEeHHHHHHHHHHCCCCCCCcCCCC
Confidence            7788887764    3578999998873


No 16 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=52.08  E-value=7.7  Score=24.42  Aligned_cols=25  Identities=36%  Similarity=0.591  Sum_probs=20.4

Q ss_pred             hhhhhhccchhHHHhhhccccCCCC
Q psy8320          13 AEEIYFIMVCSKCEKKLGKVITPDN   37 (119)
Q Consensus        13 ~~~~~~~MVC~KCEKKL~klatPD~   37 (119)
                      -+.|.....|..||++|-.+-+-||
T Consensus        12 GI~I~~~fIC~~CE~~iv~~~~~d~   36 (46)
T PF10764_consen   12 GIHIYGKFICSDCEKEIVNTETDDP   36 (46)
T ss_pred             CEEEECeEehHHHHHHhccCCCCCC
Confidence            3456678899999999998877776


No 17 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=51.94  E-value=3.7  Score=28.35  Aligned_cols=36  Identities=33%  Similarity=0.778  Sum_probs=21.7

Q ss_pred             cchhhhhhcccCC-CccCcccc---cccccccccCccccc
Q psy8320          75 SCKICRQKVHQVG-SHYCQACA---YKKGICAMCGKKLLD  110 (119)
Q Consensus        75 ~C~iCK~~vhq~g-~~YCq~CA---YkkGiCamCGKki~D  110 (119)
                      .|..|.+.+...+ ..+|..|.   -+.+.|+-||..+--
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~   42 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEV   42 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EE
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccHHHH
Confidence            6888888886555 66788876   356789999887753


No 18 
>KOG2272|consensus
Probab=47.58  E-value=11  Score=32.50  Aligned_cols=52  Identities=31%  Similarity=0.709  Sum_probs=38.5

Q ss_pred             cccchhhhhhccCCCcccCccchhhhhhccc-----CCCccCcccccccc--cccccCcccc
Q psy8320          55 ENKALTASKARFNPYTQKFESCKICRQKVHQ-----VGSHYCQACAYKKG--ICAMCGKKLL  109 (119)
Q Consensus        55 eNKlLs~~k~r~~Py~~~~~~C~iCK~~vhq-----~g~~YCq~CAYkkG--iCamCGKki~  109 (119)
                      .|-+|.-   |-|||-+|.-+|..|+..+..     .|.-||..|--+-|  ||.-|-+.|-
T Consensus       148 D~~~l~f---r~d~yH~yHFkCt~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe  206 (332)
T KOG2272|consen  148 DEQPLTF---RGDPYHPYHFKCTTCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE  206 (332)
T ss_pred             ccccccc---cCCCCCccceecccccccccchhhhhccceeccccccccCCcccccccCchH
Confidence            3477743   668888888899999987753     36789999987665  6766666664


No 19 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.30  E-value=8  Score=33.92  Aligned_cols=36  Identities=19%  Similarity=0.606  Sum_probs=27.4

Q ss_pred             ccchhhhhhcccC-----CCccCccccc----ccccccccCcccc
Q psy8320          74 ESCKICRQKVHQV-----GSHYCQACAY----KKGICAMCGKKLL  109 (119)
Q Consensus        74 ~~C~iCK~~vhq~-----g~~YCq~CAY----kkGiCamCGKki~  109 (119)
                      -.|.||..-+..+     ||.||..|..    ..+.|..|...+.
T Consensus        27 l~C~IC~d~~~~PvitpCgH~FCs~CI~~~l~~~~~CP~Cr~~~~   71 (397)
T TIGR00599        27 LRCHICKDFFDVPVLTSCSHTFCSLCIRRCLSNQPKCPLCRAEDQ   71 (397)
T ss_pred             cCCCcCchhhhCccCCCCCCchhHHHHHHHHhCCCCCCCCCCccc
Confidence            3788887655433     9999999986    3468999998765


No 20 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=45.84  E-value=9.8  Score=21.36  Aligned_cols=22  Identities=27%  Similarity=0.957  Sum_probs=16.8

Q ss_pred             cchhhhhhcccCCCccCcccccc
Q psy8320          75 SCKICRQKVHQVGSHYCQACAYK   97 (119)
Q Consensus        75 ~C~iCK~~vhq~g~~YCq~CAYk   97 (119)
                      .|..|.+.|.. .++.|..|-|.
T Consensus         2 ~CP~C~~~V~~-~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEVPE-SAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCchh-hcCcCCCCCCC
Confidence            68889998877 57877777663


No 21 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=45.15  E-value=8.6  Score=25.81  Aligned_cols=36  Identities=28%  Similarity=0.854  Sum_probs=26.6

Q ss_pred             ccchhhhhhcccCC---------CccCccccccc--ccccccCcccc
Q psy8320          74 ESCKICRQKVHQVG---------SHYCQACAYKK--GICAMCGKKLL  109 (119)
Q Consensus        74 ~~C~iCK~~vhq~g---------~~YCq~CAYkk--GiCamCGKki~  109 (119)
                      ..|..|.+.+.++.         -.||..||-..  |+|.-||=-+.
T Consensus         6 pnCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CPNCgGelv   52 (57)
T PF06906_consen    6 PNCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCPNCGGELV   52 (57)
T ss_pred             CCccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCcCCCCccc
Confidence            46788888887743         25788888665  99999996543


No 22 
>PF03660 PHF5:  PHF5-like protein;  InterPro: IPR005345 Phf5 is a member of a novel murine multigene family that is highly conserved during evolution and belongs to the superfamily of PHD-finger proteins. At least one example, from Mus musculus (Mouse), may act as a chromatin-associated protein []. The Schizosaccharomyces pombe (Fission yeast) ini1 gene is essential, required for splicing []. It is localised in the nucleus, but not detected in the nucleolus and can be complemented by human ini1 []. The proteins of this family contain five CXXC motifs.; PDB: 2K0A_A.
Probab=41.85  E-value=6.4  Score=29.27  Aligned_cols=27  Identities=22%  Similarity=0.532  Sum_probs=15.6

Q ss_pred             CcccCccchhhhhhcccCCCccCcccc
Q psy8320          69 YTQKFESCKICRQKVHQVGSHYCQACA   95 (119)
Q Consensus        69 y~~~~~~C~iCK~~vhq~g~~YCq~CA   95 (119)
                      |+.+..+|.+|........+.||..|-
T Consensus        51 ~G~~~~rCIiCg~~~g~sdAYYC~eC~   77 (106)
T PF03660_consen   51 FGSLQGRCIICGSGPGVSDAYYCWECV   77 (106)
T ss_dssp             TSSTTSB-TTTSSSB--EE-EE-HHHH
T ss_pred             CCCcCceEEEecCCCCcccceehhhhH
Confidence            334567999999555444689999983


No 23 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=41.36  E-value=11  Score=20.47  Aligned_cols=21  Identities=29%  Similarity=0.920  Sum_probs=14.4

Q ss_pred             CCccCccccc-----ccccccccCcc
Q psy8320          87 GSHYCQACAY-----KKGICAMCGKK  107 (119)
Q Consensus        87 g~~YCq~CAY-----kkGiCamCGKk  107 (119)
                      ||.||..|..     ....|.+|...
T Consensus        19 ~H~~c~~C~~~~~~~~~~~Cp~C~~~   44 (45)
T cd00162          19 GHVFCRSCIDKWLKSGKNTCPLCRTP   44 (45)
T ss_pred             CChhcHHHHHHHHHhCcCCCCCCCCc
Confidence            6777777764     24568888764


No 24 
>PRK11595 DNA utilization protein GntX; Provisional
Probab=40.88  E-value=14  Score=28.78  Aligned_cols=33  Identities=27%  Similarity=0.650  Sum_probs=14.2

Q ss_pred             cchhhhhhcccCCCccCcccccc----cccccccCcc
Q psy8320          75 SCKICRQKVHQVGSHYCQACAYK----KGICAMCGKK  107 (119)
Q Consensus        75 ~C~iCK~~vhq~g~~YCq~CAYk----kGiCamCGKk  107 (119)
                      .|-.|...++......|..|.-+    ...|..||+.
T Consensus         7 ~C~~C~~~~~~~~~~lC~~C~~~l~~~~~~C~~Cg~~   43 (227)
T PRK11595          7 LCWLCRMPLALSHWGICSVCSRALRTLKTCCPQCGLP   43 (227)
T ss_pred             cCccCCCccCCCCCcccHHHHhhCCcccCcCccCCCc
Confidence            45555554433222345555311    2345555554


No 25 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=39.85  E-value=22  Score=19.09  Aligned_cols=9  Identities=56%  Similarity=1.250  Sum_probs=4.9

Q ss_pred             cccccCccc
Q psy8320         100 ICAMCGKKL  108 (119)
Q Consensus       100 iCamCGKki  108 (119)
                      .|+.||+.|
T Consensus        29 ~C~~C~~~L   37 (39)
T smart00132       29 KCSKCGKPL   37 (39)
T ss_pred             CCcccCCcC
Confidence            355566554


No 26 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=39.74  E-value=14  Score=23.45  Aligned_cols=16  Identities=50%  Similarity=0.939  Sum_probs=11.3

Q ss_pred             cccccCcccccccccc
Q psy8320         100 ICAMCGKKLLDVKNYK  115 (119)
Q Consensus       100 iCamCGKki~Dt~~yk  115 (119)
                      +|+.||+++--.+.++
T Consensus         1 ~C~iCg~kigl~~~~k   16 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFK   16 (51)
T ss_pred             CCCcccccccccccee
Confidence            5899999886555433


No 27 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=39.03  E-value=12  Score=27.58  Aligned_cols=22  Identities=32%  Similarity=0.881  Sum_probs=15.3

Q ss_pred             CccchhhhhhcccCC--CccCccc
Q psy8320          73 FESCKICRQKVHQVG--SHYCQAC   94 (119)
Q Consensus        73 ~~~C~iCK~~vhq~g--~~YCq~C   94 (119)
                      -..|..|+.+|.+.+  .-+|..|
T Consensus        34 Y~aC~~C~kkv~~~~~~~~~C~~C   57 (166)
T cd04476          34 YPACPGCNKKVVEEGNGTYRCEKC   57 (166)
T ss_pred             EccccccCcccEeCCCCcEECCCC
Confidence            459999999998753  3444443


No 28 
>KOG3799|consensus
Probab=38.20  E-value=15  Score=29.12  Aligned_cols=36  Identities=31%  Similarity=0.725  Sum_probs=24.5

Q ss_pred             Cccchhhhh-hcccCCCccCcccccccccccccCccccc
Q psy8320          73 FESCKICRQ-KVHQVGSHYCQACAYKKGICAMCGKKLLD  110 (119)
Q Consensus        73 ~~~C~iCK~-~vhq~g~~YCq~CAYkkGiCamCGKki~D  110 (119)
                      -..|-||-. +...--+|-|..|-.+  .||.||=++.-
T Consensus        65 datC~IC~KTKFADG~GH~C~YCq~r--~CARCGGrv~l  101 (169)
T KOG3799|consen   65 DATCGICHKTKFADGCGHNCSYCQTR--FCARCGGRVSL  101 (169)
T ss_pred             CcchhhhhhcccccccCcccchhhhh--HHHhcCCeeee
Confidence            458999954 5555345667666544  79999977653


No 29 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=36.26  E-value=15  Score=21.21  Aligned_cols=12  Identities=42%  Similarity=1.137  Sum_probs=9.1

Q ss_pred             ccccccCccccc
Q psy8320          99 GICAMCGKKLLD  110 (119)
Q Consensus        99 GiCamCGKki~D  110 (119)
                      |+|..||..|.+
T Consensus         4 g~C~~CGe~I~~   15 (36)
T PF01258_consen    4 GICEDCGEPIPE   15 (36)
T ss_dssp             SB-TTTSSBEEH
T ss_pred             CCccccCChHHH
Confidence            679999998874


No 30 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=35.79  E-value=5.4  Score=23.02  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=6.7

Q ss_pred             CCccCccccc
Q psy8320          87 GSHYCQACAY   96 (119)
Q Consensus        87 g~~YCq~CAY   96 (119)
                      ||.||..|+.
T Consensus        18 GH~fC~~C~~   27 (39)
T PF13923_consen   18 GHSFCKECIE   27 (39)
T ss_dssp             SEEEEHHHHH
T ss_pred             CCchhHHHHH
Confidence            6677777764


No 31 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=35.19  E-value=18  Score=23.88  Aligned_cols=14  Identities=43%  Similarity=0.990  Sum_probs=10.7

Q ss_pred             cccccccccCcccc
Q psy8320          96 YKKGICAMCGKKLL  109 (119)
Q Consensus        96 YkkGiCamCGKki~  109 (119)
                      |...+|..||+++.
T Consensus         3 ~~~~~C~~Cg~~~~   16 (54)
T PF14446_consen    3 YEGCKCPVCGKKFK   16 (54)
T ss_pred             ccCccChhhCCccc
Confidence            56678888888875


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=34.59  E-value=9.8  Score=18.56  Aligned_cols=15  Identities=27%  Similarity=0.742  Sum_probs=8.2

Q ss_pred             cccccCccccccccc
Q psy8320         100 ICAMCGKKLLDVKNY  114 (119)
Q Consensus       100 iCamCGKki~Dt~~y  114 (119)
                      .|.+||+...+-..+
T Consensus         2 ~C~~C~~~~~~~~~l   16 (24)
T PF13894_consen    2 QCPICGKSFRSKSEL   16 (24)
T ss_dssp             E-SSTS-EESSHHHH
T ss_pred             CCcCCCCcCCcHHHH
Confidence            477888876654443


No 33 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=34.04  E-value=14  Score=29.66  Aligned_cols=36  Identities=28%  Similarity=0.799  Sum_probs=27.0

Q ss_pred             cchhhhhhccc-----CCCccCcccccc--------------------cccccccCccccc
Q psy8320          75 SCKICRQKVHQ-----VGSHYCQACAYK--------------------KGICAMCGKKLLD  110 (119)
Q Consensus        75 ~C~iCK~~vhq-----~g~~YCq~CAYk--------------------kGiCamCGKki~D  110 (119)
                      .|.||...+..     =||.||..|.++                    ...|..|...|..
T Consensus        20 ~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         20 DCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             CCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            68888664432     389999999963                    3479999998864


No 34 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=33.76  E-value=16  Score=24.88  Aligned_cols=10  Identities=30%  Similarity=1.059  Sum_probs=6.1

Q ss_pred             cccccccCcc
Q psy8320          98 KGICAMCGKK  107 (119)
Q Consensus        98 kGiCamCGKk  107 (119)
                      .-+|.+||-.
T Consensus        30 ~~VCnlCGFN   39 (61)
T PF05715_consen   30 SQVCNLCGFN   39 (61)
T ss_pred             hhhhcccCCC
Confidence            3467777753


No 35 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=33.19  E-value=19  Score=31.26  Aligned_cols=38  Identities=16%  Similarity=0.477  Sum_probs=23.5

Q ss_pred             ccCCCc-cc-CccchhhhhhcccCCCccCcccccccccccccCcccc
Q psy8320          65 RFNPYT-QK-FESCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  109 (119)
Q Consensus        65 r~~Py~-~~-~~~C~iCK~~vhq~g~~YCq~CAYkkGiCamCGKki~  109 (119)
                      -|+|-- .| ...|+.|...+....+.     ++ .++|+ ||++|.
T Consensus       230 g~~P~~GKYh~~~c~~C~~~~~~~~~~-----~~-~~~Cp-CG~~i~  269 (374)
T TIGR00375       230 GLDPLLGKYHQTACEACGEPAVSEDAE-----TA-CANCP-CGGRIK  269 (374)
T ss_pred             eECcCCCccchhhhcccCCcCCchhhh-----hc-CCCCC-CCCcce
Confidence            356643 22 56788887766542211     23 58999 999964


No 36 
>KOG0320|consensus
Probab=32.93  E-value=11  Score=30.42  Aligned_cols=36  Identities=33%  Similarity=0.843  Sum_probs=27.0

Q ss_pred             ccchhhhhhccc-------CCCccCcccc---ccc-ccccccCcccc
Q psy8320          74 ESCKICRQKVHQ-------VGSHYCQACA---YKK-GICAMCGKKLL  109 (119)
Q Consensus        74 ~~C~iCK~~vhq-------~g~~YCq~CA---Ykk-GiCamCGKki~  109 (119)
                      -+|.||--.+.+       =||-||..|+   .++ ..|..|+|+|.
T Consensus       132 ~~CPiCl~~~sek~~vsTkCGHvFC~~Cik~alk~~~~CP~C~kkIt  178 (187)
T KOG0320|consen  132 YKCPICLDSVSEKVPVSTKCGHVFCSQCIKDALKNTNKCPTCRKKIT  178 (187)
T ss_pred             cCCCceecchhhccccccccchhHHHHHHHHHHHhCCCCCCcccccc
Confidence            489999654432       3788999997   333 48999999886


No 37 
>PRK00420 hypothetical protein; Validated
Probab=26.72  E-value=30  Score=25.58  Aligned_cols=22  Identities=18%  Similarity=0.528  Sum_probs=15.5

Q ss_pred             Cccchhhhhhccc--CCCccCccc
Q psy8320          73 FESCKICRQKVHQ--VGSHYCQAC   94 (119)
Q Consensus        73 ~~~C~iCK~~vhq--~g~~YCq~C   94 (119)
                      ...|..|...+-.  .|..||+.|
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~C   46 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVH   46 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCC
Confidence            4689999997753  466666654


No 38 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=26.43  E-value=27  Score=24.66  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=9.0

Q ss_pred             ccccccCcccc
Q psy8320          99 GICAMCGKKLL  109 (119)
Q Consensus        99 GiCamCGKki~  109 (119)
                      |+|-.||..|-
T Consensus        81 G~C~~Cge~I~   91 (110)
T TIGR02420        81 GYCEECGEEIG   91 (110)
T ss_pred             CchhccCCccc
Confidence            68999998874


No 39 
>PHA02929 N1R/p28-like protein; Provisional
Probab=26.33  E-value=28  Score=28.60  Aligned_cols=40  Identities=28%  Similarity=0.697  Sum_probs=29.7

Q ss_pred             Cccchhhhhhcc-------------cCCCccCccccc----ccccccccCccccccc
Q psy8320          73 FESCKICRQKVH-------------QVGSHYCQACAY----KKGICAMCGKKLLDVK  112 (119)
Q Consensus        73 ~~~C~iCK~~vh-------------q~g~~YCq~CAY----kkGiCamCGKki~Dt~  112 (119)
                      ...|.||-..+.             .=+|.||..|--    .+..|++|-..+.-+.
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~~~~tCPlCR~~~~~v~  230 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKKEKNTCPVCRTPFISVI  230 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHhcCCCCCCCCCEeeEEe
Confidence            358999987643             237889999972    5679999998877543


No 40 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=24.66  E-value=30  Score=29.11  Aligned_cols=33  Identities=21%  Similarity=0.627  Sum_probs=25.3

Q ss_pred             hhccCCCcccCccchhhhhhc-----ccCCCccCcccc
Q psy8320          63 KARFNPYTQKFESCKICRQKV-----HQVGSHYCQACA   95 (119)
Q Consensus        63 k~r~~Py~~~~~~C~iCK~~v-----hq~g~~YCq~CA   95 (119)
                      ..++.-|+.....|+.|.+.+     .+-+.+||..|-
T Consensus       235 q~~l~VYgR~GepC~~CGt~I~k~~~~gR~t~~CP~CQ  272 (273)
T COG0266         235 QQELKVYGRAGEPCRRCGTPIEKIKLGGRSTFYCPVCQ  272 (273)
T ss_pred             ceeEEEecCCCCCCCccCCEeEEEEEcCCcCEeCCCCC
Confidence            346677887788999997654     566889999983


No 41 
>smart00746 TRASH metallochaperone-like domain.
Probab=24.61  E-value=36  Score=16.91  Aligned_cols=9  Identities=44%  Similarity=1.435  Sum_probs=7.6

Q ss_pred             ccccCcccc
Q psy8320         101 CAMCGKKLL  109 (119)
Q Consensus       101 CamCGKki~  109 (119)
                      |+.||..|.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            788999886


No 42 
>KOG4458|consensus
Probab=24.52  E-value=28  Score=24.47  Aligned_cols=33  Identities=30%  Similarity=0.634  Sum_probs=21.6

Q ss_pred             hhccCCCcccCccchhhhhhcccCCCccCccccccccccc
Q psy8320          63 KARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGICA  102 (119)
Q Consensus        63 k~r~~Py~~~~~~C~iCK~~vhq~g~~YCq~CAYkkGiCa  102 (119)
                      |.+++||.-...-=-.|+-.+|...       ||+.|||-
T Consensus         4 k~k~~pydii~dd~~d~riplhne~-------a~qhgi~f   36 (78)
T KOG4458|consen    4 KKKHGPYDIIADDGHDCRIPLHNED-------AFQHGICF   36 (78)
T ss_pred             ccccCCcceeecccccceeeccchh-------hhhccceE
Confidence            4577888632222335666888754       89999994


No 43 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=24.34  E-value=20  Score=19.86  Aligned_cols=21  Identities=19%  Similarity=0.654  Sum_probs=7.8

Q ss_pred             cchhhhhhccc-----CCCccCcccc
Q psy8320          75 SCKICRQKVHQ-----VGSHYCQACA   95 (119)
Q Consensus        75 ~C~iCK~~vhq-----~g~~YCq~CA   95 (119)
                      +|..|...+..     ....||..|.
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq   28 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQ   28 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCc
Confidence            56666554422     2235555553


No 44 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=24.21  E-value=33  Score=27.84  Aligned_cols=30  Identities=30%  Similarity=0.730  Sum_probs=21.1

Q ss_pred             ccCCCcccCccchhhhhhcc-----cCCCccCccc
Q psy8320          65 RFNPYTQKFESCKICRQKVH-----QVGSHYCQAC   94 (119)
Q Consensus        65 r~~Py~~~~~~C~iCK~~vh-----q~g~~YCq~C   94 (119)
                      ++.-|+.....|..|.+.|.     +-...||..|
T Consensus       236 ~~~Vy~R~g~pCprCG~~I~~~~~~gR~t~~CP~C  270 (272)
T PRK14810        236 SHRVYQRTGEPCLNCKTPIRRVVVAGRSSHYCPHC  270 (272)
T ss_pred             hEeecCCCCCcCCCCCCeeEEEEECCCccEECcCC
Confidence            45567655778999987664     3356788877


No 45 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=24.21  E-value=31  Score=27.89  Aligned_cols=30  Identities=20%  Similarity=0.669  Sum_probs=19.8

Q ss_pred             cCCCcccCccchhhhhhcc-----cCCCccCcccc
Q psy8320          66 FNPYTQKFESCKICRQKVH-----QVGSHYCQACA   95 (119)
Q Consensus        66 ~~Py~~~~~~C~iCK~~vh-----q~g~~YCq~CA   95 (119)
                      +.-|+.....|..|.+.|.     .-+..||+.|-
T Consensus       238 l~Vy~R~g~pC~~Cg~~I~~~~~~gR~t~~CP~CQ  272 (274)
T PRK01103        238 LQVYGREGEPCRRCGTPIEKIKQGGRSTFFCPRCQ  272 (274)
T ss_pred             eEEcCCCCCCCCCCCCeeEEEEECCCCcEECcCCC
Confidence            4456545668999987664     22567888873


No 46 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=24.15  E-value=18  Score=23.90  Aligned_cols=23  Identities=39%  Similarity=0.518  Sum_probs=17.5

Q ss_pred             hhhhhccchhHHHhhhcc---ccCCC
Q psy8320          14 EEIYFIMVCSKCEKKLGK---VITPD   36 (119)
Q Consensus        14 ~~~~~~MVC~KCEKKL~k---latPD   36 (119)
                      .+|+....|+-|.|.|+.   ++-||
T Consensus        73 v~i~~~~~C~vC~k~l~~~~f~~~p~   98 (109)
T PF10367_consen   73 VVITESTKCSVCGKPLGNSVFVVFPC   98 (109)
T ss_pred             EEECCCCCccCcCCcCCCceEEEeCC
Confidence            356688999999999985   45554


No 47 
>PF10621 FpoO:  F420H2 dehydrogenase subunit FpoO ;  InterPro: IPR018288 This entry represents the FpoO subunit of membrane-bound multi-subunit F420H2 dehydrogenase, which oxidises the reduced coenzyme F420H2 to coenzyme F420 and feeds the electrons via an FeS cluster into an energy-conserving electron transport chain [, ]. This enzyme plays a role in the methanogenic pathway in methanogenic archaea. Reduced coenzyme F420H2 is the major cytoplasmic electron carrier of methanogens and a reversible hydride donor, much like NADH []. F420H2 + COB-S-S-CoM = F420 + CoM-SH + CoB-SH  Where CoB-S-S-CoM (the heterosulphide of 2-mercaptoethanesulphonate and 7-mercaptoheptanoylthreonine phosphate) is the terminal electron acceptor of the methanogenic pathway, and is reduced with the concomitant generation of a transmembrane proton potential and ATP synthesis.  The FpoO subunit of F420H2 dehydrogenase probably participates in the reduction of methanophenazine, where it acts as a special mechanism for the reduction of the methanogenic cofactor []. 
Probab=24.09  E-value=34  Score=25.96  Aligned_cols=35  Identities=29%  Similarity=0.622  Sum_probs=23.0

Q ss_pred             CCcccCccchhhhh-------hcccCCCccCcccccccccccccCccc
Q psy8320          68 PYTQKFESCKICRQ-------KVHQVGSHYCQACAYKKGICAMCGKKL  108 (119)
Q Consensus        68 Py~~~~~~C~iCK~-------~vhq~g~~YCq~CAYkkGiCamCGKki  108 (119)
                      |-|.+..-|.+|-.       .+.++ ..     +-+.|.|.|||++-
T Consensus        29 PeGvwKGLC~~CL~sa~~ty~e~~~~-~~-----s~~~gKC~LCG~kt   70 (119)
T PF10621_consen   29 PEGVWKGLCETCLDSAEKTYQEVNEN-ES-----SCRSGKCDLCGKKT   70 (119)
T ss_pred             cchHHHhhHHHHHHHHHHHHHHHhcc-cc-----cccccceeccCCcc
Confidence            66666677777743       34442 23     23889999999974


No 48 
>PHA03096 p28-like protein; Provisional
Probab=23.36  E-value=22  Score=29.82  Aligned_cols=25  Identities=44%  Similarity=0.897  Sum_probs=19.7

Q ss_pred             cccccccc-cccccCccccccccccc
Q psy8320          92 QACAYKKG-ICAMCGKKLLDVKNYKQ  116 (119)
Q Consensus        92 q~CAYkkG-iCamCGKki~Dt~~ykq  116 (119)
                      ..|.|-.| +|.|||+..++...+.|
T Consensus       135 ~~c~~lHg~lC~~C~k~~Lhp~d~eq  160 (284)
T PHA03096        135 KYCEYLHGDICDICEKYLLHPTDIKQ  160 (284)
T ss_pred             cCcHHHHHHHHHhhcchhcCCcCHHH
Confidence            45777666 69999999998877655


No 49 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=22.77  E-value=45  Score=22.94  Aligned_cols=23  Identities=35%  Similarity=0.624  Sum_probs=18.8

Q ss_pred             hccchhHHHhhhc-cccCCCCCCC
Q psy8320          18 FIMVCSKCEKKLG-KVITPDNWKS   40 (119)
Q Consensus        18 ~~MVC~KCEKKL~-klatPD~~k~   40 (119)
                      +.=+|.+|.|-|+ ..--|-+||+
T Consensus        53 fs~pC~~C~klL~~~~~LPP~~r~   76 (90)
T PF11571_consen   53 FSTPCKKCGKLLSSKAFLPPVRRP   76 (90)
T ss_pred             ccchhhHHHhHhhhcccCCCeeec
Confidence            5568999999996 5778888884


No 50 
>PF09706 Cas_CXXC_CXXC:  CRISPR-associated protein (Cas_CXXC_CXXC);  InterPro: IPR019121 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a conserved domain of about 65 amino acids found in otherwise highly divergent proteins encoded in CRISPR-associated regions. This domain features two CXXC motifs. 
Probab=22.27  E-value=46  Score=22.15  Aligned_cols=11  Identities=45%  Similarity=1.026  Sum_probs=8.4

Q ss_pred             ccccccccCcc
Q psy8320          97 KKGICAMCGKK  107 (119)
Q Consensus        97 kkGiCamCGKk  107 (119)
                      .+++|..||.+
T Consensus         4 ~~~~C~~Cg~r   14 (69)
T PF09706_consen    4 KKYNCIFCGER   14 (69)
T ss_pred             CCCcCcCCCCc
Confidence            46789999944


No 51 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=21.89  E-value=38  Score=25.69  Aligned_cols=24  Identities=25%  Similarity=0.667  Sum_probs=19.9

Q ss_pred             ccCccchhhhhhcccCCCccCccccc
Q psy8320          71 QKFESCKICRQKVHQVGSHYCQACAY   96 (119)
Q Consensus        71 ~~~~~C~iCK~~vhq~g~~YCq~CAY   96 (119)
                      ...-.|..|.+.+.. | .||..|+-
T Consensus        79 nl~~~CE~CG~~I~~-G-r~C~~C~~  102 (137)
T TIGR03826        79 NLGYPCERCGTSIRE-G-RLCDSCAG  102 (137)
T ss_pred             CCcCcccccCCcCCC-C-CccHHHHH
Confidence            345699999999998 5 99999973


No 52 
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.77  E-value=51  Score=30.18  Aligned_cols=22  Identities=32%  Similarity=0.851  Sum_probs=17.2

Q ss_pred             CccCcccccccc---cccccCcccc
Q psy8320          88 SHYCQACAYKKG---ICAMCGKKLL  109 (119)
Q Consensus        88 ~~YCq~CAYkkG---iCamCGKki~  109 (119)
                      .-.|+.|.|...   .|.-||...+
T Consensus       408 ~l~Ch~Cg~~~~~~~~Cp~Cg~~~l  432 (679)
T PRK05580        408 RLRCHHCGYQEPIPKACPECGSTDL  432 (679)
T ss_pred             eEECCCCcCCCCCCCCCCCCcCCee
Confidence            346999999865   7999988754


No 53 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=21.68  E-value=37  Score=21.93  Aligned_cols=28  Identities=25%  Similarity=0.624  Sum_probs=17.9

Q ss_pred             cchhhhhhcccCCCccCcccccccccccccCcccc
Q psy8320          75 SCKICRQKVHQVGSHYCQACAYKKGICAMCGKKLL  109 (119)
Q Consensus        75 ~C~iCK~~vhq~g~~YCq~CAYkkGiCamCGKki~  109 (119)
                      +|..|...+....       ++.--.|.-||-+|+
T Consensus         8 ~C~~Cg~~~~~~~-------~~~~irCp~Cg~rIl   35 (49)
T COG1996           8 KCARCGREVELDQ-------ETRGIRCPYCGSRIL   35 (49)
T ss_pred             EhhhcCCeeehhh-------ccCceeCCCCCcEEE
Confidence            7888888876432       344456666666665


No 54 
>KOG1734|consensus
Probab=21.47  E-value=31  Score=29.96  Aligned_cols=16  Identities=25%  Similarity=0.706  Sum_probs=12.8

Q ss_pred             ccccccccCccccccc
Q psy8320          97 KKGICAMCGKKLLDVK  112 (119)
Q Consensus        97 kkGiCamCGKki~Dt~  112 (119)
                      ..++||.||+++.++-
T Consensus       223 ~d~vCaVCg~~~~~s~  238 (328)
T KOG1734|consen  223 SDSVCAVCGQQIDVSV  238 (328)
T ss_pred             CcchhHhhcchheeec
Confidence            4469999999998653


No 55 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=21.36  E-value=38  Score=25.88  Aligned_cols=24  Identities=25%  Similarity=0.885  Sum_probs=16.9

Q ss_pred             ccchhhhhhcc-cCCCccCcccccc
Q psy8320          74 ESCKICRQKVH-QVGSHYCQACAYK   97 (119)
Q Consensus        74 ~~C~iCK~~vh-q~g~~YCq~CAYk   97 (119)
                      ..|..|++.+- -+|.-||+.|-|.
T Consensus        29 ~hCp~Cg~PLF~KdG~v~CPvC~~~   53 (131)
T COG1645          29 KHCPKCGTPLFRKDGEVFCPVCGYR   53 (131)
T ss_pred             hhCcccCCcceeeCCeEECCCCCce
Confidence            48999999773 3377777766553


No 56 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=21.15  E-value=40  Score=27.42  Aligned_cols=33  Identities=21%  Similarity=0.615  Sum_probs=22.6

Q ss_pred             ccCCCcccCccchhhhhhcc-----cCCCccCcccccc
Q psy8320          65 RFNPYTQKFESCKICRQKVH-----QVGSHYCQACAYK   97 (119)
Q Consensus        65 r~~Py~~~~~~C~iCK~~vh-----q~g~~YCq~CAYk   97 (119)
                      ++.-|+.....|..|.+.|.     +-+..||..|--.
T Consensus       227 ~~~Vy~R~g~pC~~Cg~~I~~~~~~gR~ty~Cp~CQ~~  264 (269)
T PRK14811        227 QHAVYGREGQPCPRCGTPIEKIVVGGRGTHFCPQCQPL  264 (269)
T ss_pred             eEEecCCCcCCCCcCCCeeEEEEECCCCcEECCCCcCC
Confidence            34567655678999988664     3367889888543


No 57 
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=21.08  E-value=44  Score=26.31  Aligned_cols=14  Identities=36%  Similarity=0.942  Sum_probs=11.1

Q ss_pred             cccccccccCcccc
Q psy8320          96 YKKGICAMCGKKLL  109 (119)
Q Consensus        96 YkkGiCamCGKki~  109 (119)
                      -+.|.|++||..+.
T Consensus        18 ~Q~G~CaiC~~~l~   31 (157)
T PHA02565         18 AQNGICPLCKRELD   31 (157)
T ss_pred             HhCCcCCCCCCccC
Confidence            45679999999865


Done!