RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8342
         (225 letters)



>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural
           precursor cell-expressed, developmentally down-regulated
           4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42).  Nedd4 and
           Nedd4-2 are two of the nine members of the Human Nedd4
           family.  All vertebrates appear to have both Nedd4 and
           Nedd4-2 genes. They are thought to participate in the
           regulation of epithelial Na+ channel (ENaC) activity.
           They also have identical specificity for ubiquitin
           conjugating enzymes (E2).  Nedd4 and Nedd4-2 are
           composed of a C2 domain, 2-4 WW domains, and a ubiquitin
           ligase Hect domain. Their WW domains can bind PPxY (PY)
           or LPSY motifs, and in vitro studies suggest that WW3
           and WW4 of both proteins bind PY motifs in the key
           substrates, with WW3 generally exhibiting higher
           affinity. Most Nedd4 family members, especially Nedd4-2,
           also have multiple splice variants, which might play
           different roles in regulating their substrates. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 133

 Score =  160 bits (407), Expect = 1e-50
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 7/115 (6%)

Query: 117 IRLRIIAGHSLAKKDIFGA-----RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +R++++AG  LAKKDIFGA     +I L   +G+  IDS  TKT KKTLNP WNEEF FR
Sbjct: 2   LRVKVLAGIDLAKKDIFGASDPYVKISLYDPDGNGEIDSVQTKTIKKTLNPKWNEEFFFR 61

Query: 172 VKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDG--CVIHNKKYILRPR 224
           V P EH+L+F+VFD NRLTRDDFLG VE+ L NLP E+ G       K Y+LRPR
Sbjct: 62  VNPREHRLLFEVFDENRLTRDDFLGQVEVPLNNLPTETPGNERRYTFKDYLLRPR 116



 Score = 29.6 bits (67), Expect = 0.59
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 1   ARSKVKGFLELYHAYL 16
           ++S+VKG L LY AYL
Sbjct: 118 SKSRVKGHLRLYMAYL 133


>gnl|CDD|215765 pfam00168, C2, C2 domain. 
          Length = 85

 Score = 80.4 bits (199), Expect = 6e-20
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 10/89 (11%)

Query: 117 IRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +R+ +I+  +L  KD+ G      ++ L    G Q  D+  TK  K TLNPVWNE F F 
Sbjct: 1   LRVTVISAKNLPPKDLNGKSDPYVKVSL----GGQKKDTKKTKVVKNTLNPVWNETFTFE 56

Query: 172 V-KPSEHKLVFQVFDMNRLTRDDFLGMVE 199
           V  P   +L  +V+D +R  +DDF+G V 
Sbjct: 57  VTLPELAELRIEVYDYDRFGKDDFIGEVT 85


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
           Ca2+-binding motif present in phospholipases, protein
           kinases C, and synaptotagmins (among others). Some do
           not appear to contain Ca2+-binding sites. Particular C2s
           appear to bind phospholipids, inositol polyphosphates,
           and intracellular proteins. Unusual occurrence in
           perforin. Synaptotagmin and PLC C2s are permuted in
           sequence with respect to N- and C-terminal beta strands.
           SMART detects C2 domains using one or both of two
           profiles.
          Length = 101

 Score = 75.2 bits (185), Expect = 7e-18
 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 116 QIRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIF 170
            + ++II+  +L  KD  G      ++ L         +   TK  K TLNPVWNE F F
Sbjct: 1   TLTVKIISARNLPPKDKGGKSDPYVKVSL----DGDPKEKKKTKVVKNTLNPVWNETFEF 56

Query: 171 RVKPSEHK-LVFQVFDMNRLTRDDFLGMVELSLLNLPRE 208
            V P E   L  +V+D +R  RDDF+G V + L +L   
Sbjct: 57  EVPPPELAELEIEVYDKDRFGRDDFIGQVTIPLSDLLLG 95


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in PKC.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 102

 Score = 71.3 bits (175), Expect = 3e-16
 Identities = 36/99 (36%), Positives = 51/99 (51%), Gaps = 12/99 (12%)

Query: 117 IRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +R+ +I   +L  KD+ G      ++   ++ G Q      TK  K TLNPVWNE F F 
Sbjct: 1   LRVTVIEARNLPAKDLNGKSDPYVKV---SLGGKQK---FKTKVVKNTLNPVWNETFEFP 54

Query: 172 V-KPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRES 209
           V  P    L  +V+D +R ++DDFLG VE+ L  L    
Sbjct: 55  VLDPESDTLTVEVWDKDRFSKDDFLGEVEIPLSELLDSG 93


>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
           alpha and gamma.  A single C2 domain is found in PKC
           alpha and gamma. The PKC family of serine/threonine
           kinases regulates apoptosis, proliferation, migration,
           motility, chemo-resistance, and differentiation.  There
           are 3 groups: group 1(alpha, betaI, beta II, gamma)
           which require phospholipids and calcium, group 2 (delta,
           epsilon, theta, eta) which do not require calcium for
           activation, and group 3 (xi, iota/lambda) which are
           atypical and can be activated in the absence of
           diacylglycerol and calcium. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 131

 Score = 63.4 bits (155), Expect = 6e-13
 Identities = 26/46 (56%), Positives = 34/46 (73%), Gaps = 2/46 (4%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHK--LVFQVFDMNRLTRDDFLG 196
           TKT KKTLNPVWNE F F +KP++    L  +V+D +R TR+DF+G
Sbjct: 54  TKTIKKTLNPVWNETFTFDLKPADKDRRLSIEVWDWDRTTRNDFMG 99


>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad
           ubiquitination-related factor (Smurf)-like proteins.  A
           single C2 domain is found in Smurf proteins,
           C2-WW-HECT-domain E3s, which play an important role in
           the downregulation of the TGF-beta signaling pathway.
           Smurf proteins also regulate cell shape, motility, and
           polarity by degrading small guanosine triphosphatases
           (GTPases). C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  Members here have type-II
           topology.
          Length = 123

 Score = 62.7 bits (153), Expect = 7e-13
 Identities = 36/89 (40%), Positives = 46/89 (51%), Gaps = 14/89 (15%)

Query: 117 IRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +RL ++    LAK+D+F      A I   TV+G QT     T   KKTL+P WNE F   
Sbjct: 2   VRLTVLCADGLAKRDLFRLPDPFAVI---TVDGGQTHS---TDVAKKTLDPKWNEHFDLT 55

Query: 172 VKPSEHKLVFQVFDMNRLTRDD--FLGMV 198
           V PS   +  QVFD  +  + D  FLG V
Sbjct: 56  VGPSS-IITIQVFDQKKFKKKDQGFLGCV 83


>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat
           present in Synaptotagmins 1, 5, 6, 9, and 10.
           Synaptotagmin is a membrane-trafficking protein
           characterized by a N-terminal transmembrane region, a
           linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a
           member of class 1 synaptotagmins, is located in the
           brain and endocranium and localized to the synaptic
           vesicles and secretory granules.  It functions as a Ca2+
           sensor for fast exocytosis as do synaptotagmins 5, 6,
           and 10. It is distinguished from the other
           synaptotagmins by having an N-glycosylated N-terminus.
           Synaptotagmins 5, 6, and 10, members of class 3
           synaptotagmins, are located primarily in the brain and
           localized to the active zone and plasma membrane.  They
           is distinguished from the other synaptotagmins by having
           disulfide bonds at its N-terminus.  Synaptotagmin 6 also
           regulates the acrosome reaction, a unique Ca2+-regulated
           exocytosis, in sperm. Synaptotagmin 9, a class 5
           synaptotagmins, is located in the brain and localized to
           the synaptic vesicles.  It is thought to be a
           Ca2+-sensor for dense-core vesicle exocytosis.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 62.3 bits (152), Expect = 1e-12
 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSLL 203
           TK  +KTLNPV+NE F F+V  SE     LVF V+D +R ++ D +G V + LL
Sbjct: 55  TKVHRKTLNPVFNETFTFKVPYSELGNKTLVFSVYDFDRFSKHDLIGEVRVPLL 108


>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues.  Also
          known as the WWP or rsp5 domain. Binds proline-rich
          polypeptides.
          Length = 33

 Score = 57.6 bits (140), Expect = 8e-12
 Identities = 20/31 (64%), Positives = 23/31 (74%)

Query: 68 LPPGWEERTDANGRTYYVNHIARCTQWERPT 98
          LPPGWEER D +GR YY NH  + TQWE+P 
Sbjct: 2  LPPGWEERKDPDGRPYYYNHETKETQWEKPR 32


>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the
          WWP or rsp5 domain; around 40 amino acids; functions as
          an interaction module in a diverse set of signalling
          proteins; binds specific proline-rich sequences but at
          low affinities compared to other peptide recognition
          proteins such as antibodies and receptors; WW domains
          have a single groove formed by a conserved Trp and Tyr
          which recognizes a pair of residues of the sequence
          X-Pro; variable loops and neighboring domains confer
          specificity in this domain; there are five distinct
          groups based on binding: 1) PPXY motifs 2) the PPLP
          motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR
          motifs.
          Length = 31

 Score = 56.8 bits (138), Expect = 2e-11
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 69 PPGWEERTDANGRTYYVNHIARCTQWERPT 98
          PPGWEER D +GR YY NH  + TQWE P 
Sbjct: 1  PPGWEERWDPDGRVYYYNHNTKETQWEDPR 30


>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
           Proteins (GAP).  ArfGAP is a GTPase activating protein
           which regulates the ADP ribosylation factor Arf, a
           member of the Ras superfamily of GTP-binding proteins.
           The GTP-bound form of Arf is involved in Golgi
           morphology and is involved in recruiting coat proteins. 
           ArfGAP is responsible for the GDP-bound form of Arf
           which is necessary for uncoating the membrane and
           allowing the Golgi to fuse with an acceptor compartment.
            These proteins contain an N-terminal ArfGAP domain
           containing the characteristic zinc finger motif
           (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2 domain.
           C2 domains were first identified in Protein Kinase C
           (PKC). C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.
          Length = 145

 Score = 59.3 bits (144), Expect = 2e-11
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 117 IRLRIIAGHSLAKKDIFGARIDLNTV--NGDQTIDSALTKTRKKTLNPVWNEEFIFRVKP 174
           +++R++ G +LA +D   +  D   V   G+Q +    T+  KK LNPVWNEE    V  
Sbjct: 4   LKVRVVRGTNLAVRDFTSS--DPYVVLTLGNQKVK---TRVIKKNLNPVWNEELTLSVPN 58

Query: 175 SEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
               L  +VFD +  ++DD +G  E+ L  L
Sbjct: 59  PMAPLKLEVFDKDTFSKDDSMGEAEIDLEPL 89


>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 59.0 bits (143), Expect = 2e-11
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 11/120 (9%)

Query: 113 PTE-QIRLRIIAGHSLAKKDIFGAR---IDLNTVNGDQTIDSALTKTRKKTLNPVWNEEF 168
           PT  +I + II   +L   DI G     + +  +  D+ ++   T  +K+TLNPV+NE F
Sbjct: 12  PTANRITVNIIKARNLKAMDINGTSDPYVKVWLMYKDKRVEKKKTVIKKRTLNPVFNESF 71

Query: 169 IFRV---KPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPRR 225
           IF +   +  E  L+  V D +RL+R+D +G + L   +   E    + H K  + +PR+
Sbjct: 72  IFNIPLERLRETTLIITVMDKDRLSRNDLIGKIYLGWKSGGLE----LKHWKDMLSKPRQ 127


>gnl|CDD|215899 pfam00397, WW, WW domain.  The WW domain is a protein module with
          two highly conserved tryptophans that binds
          proline-rich peptide motifs in vitro.
          Length = 30

 Score = 56.0 bits (136), Expect = 3e-11
 Identities = 22/30 (73%), Positives = 23/30 (76%)

Query: 68 LPPGWEERTDANGRTYYVNHIARCTQWERP 97
          LPPGWEERTD +GR YY NH    TQWERP
Sbjct: 1  LPPGWEERTDTDGRPYYYNHNTGETQWERP 30


>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fifth C2
           repeat, C2E, and has a type-II topology.
          Length = 115

 Score = 56.8 bits (138), Expect = 1e-10
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEH--KLVFQVFDMNRLTRDDFLGMVELSL 202
           TKT KKTLNPVWNE F   V PS     L  +V+D +R  +DD LG   + L
Sbjct: 36  TKTIKKTLNPVWNESFEVPV-PSRVRAVLKVEVYDWDRGGKDDLLGSAYIDL 86


>gnl|CDD|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1
           and RasA4.  Rasal1 and RasA4 are both members of GAP1
           (GTPase activating protein 1).  Rasal1 responds to
           repetitive Ca2+ signals by associating with the plasma
           membrane and deactivating Ras. RasA4 suppresses Ras
           function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras. In this way it can control cellular proliferation
           and differentiation.  Both of these proteins contains
           two C2 domains, a Ras-GAP domain, a plextrin homology
           (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK)
           zinc binding domain. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 121

 Score = 55.6 bits (134), Expect = 3e-10
 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 119 LRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHK 178
           +RI+ G +L  KDI G+      V  D  +    T T  KTLNP W EE+   + P  H 
Sbjct: 4   IRIVEGKNLPAKDITGSSDPYCIVKVDNEV-IIRTATVWKTLNPFWGEEYTVHLPPGFHT 62

Query: 179 LVFQVFDMNRLTRDDFLGMVELS 201
           + F V D + L+RDD +G V L+
Sbjct: 63  VSFYVLDEDTLSRDDVIGKVSLT 85


>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 133

 Score = 55.3 bits (134), Expect = 5e-10
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHK-----LVFQVFDMNRLTRDDFLGMVELSLLNLPR 207
           T+ +KKTL P+++E F F V P +       L+F V D + L  +DF G   L L ++P 
Sbjct: 59  TQVKKKTLFPLFDESFEFNVPPEQCSVEGALLLFTVKDYDLLGSNDFEGEAFLPLNDIPG 118

Query: 208 ESDGCVIHNK 217
             D       
Sbjct: 119 VEDTSSAQGF 128


>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 121

 Score = 55.0 bits (133), Expect = 6e-10
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query: 116 QIRLRIIAGHSLAKKDIFGA-------RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEF 168
           Q+ + +  G +LA +D  G        +    TV   +TI         K LNPVW+E+F
Sbjct: 1   QLDIHLKEGRNLAARDRGGTSDPYVKFKYGGKTVYKSKTI--------YKNLNPVWDEKF 52

Query: 169 IFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
              ++     L  +VFD +R   DDF+G   + L  L
Sbjct: 53  TLPIEDVTQPLYIKVFDYDRGLTDDFMGSAFVDLSTL 89


>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 54.6 bits (132), Expect = 7e-10
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE----HKLVFQVFDMNRLTRDDFLGMVELSL 202
           TK ++K LNP WNE F+F   P E      L  QV D +R +R+D +G V L L
Sbjct: 55  TKVKRKNLNPHWNETFLFEGFPYEKLQQRVLYLQVLDYDRFSRNDPIGEVSLPL 108


>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase
           activating proteins (GAPs).  RasGAPs suppress Ras
           function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  The proteins here all contain two
           tandem C2 domains,  a Ras-GAP domain, and a pleckstrin
           homology (PH)-like domain. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 137

 Score = 54.3 bits (131), Expect = 1e-09
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 29/129 (22%)

Query: 117 IRLRIIAGHSLAKK-----DIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           + +R++    LA K     D F AR+   T+N     D+  TK +KKT NP ++E F F 
Sbjct: 1   LSVRVLECRDLALKSNGTCDPF-ARV---TLNYSSKTDTKRTKVKKKTNNPRFDEAFYFE 56

Query: 172 VKPSEHK----------------LVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIH 215
           +                      L  +++  + ++ DDFLG V + L  L         H
Sbjct: 57  LTIGFSYEKKSFKVEEEDLEKSELRVELWHASMVSGDDFLGEVRIPLQGL----QQAGSH 112

Query: 216 NKKYILRPR 224
              Y L+PR
Sbjct: 113 QAWYFLQPR 121


>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in
           Synaptotagmin.  Synaptotagmin is a membrane-trafficking
           protein characterized by a N-terminal transmembrane
           region, a linker, and 2 C-terminal C2 domains. There are
           several classes of Synaptotagmins. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 134

 Score = 52.2 bits (126), Expect = 7e-09
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 12/119 (10%)

Query: 114 TEQIRLRIIAGHSLAKKDIFGA---RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIF 170
            E++ + ++   +L   D  G     + ++ + G + +    T  +K TLNPV+NE F F
Sbjct: 13  AERLTVVVLKARNLPPSDGKGLSDPYVKVSLLQGGKKLKKKKTSVKKGTLNPVFNEAFSF 72

Query: 171 RVKPSEH----KLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPRR 225
            V P+E      LV  V D + + R++ +G V L   +   E +    H  + +  PR+
Sbjct: 73  DV-PAEQLEEVSLVITVVDKDSVGRNEVIGQVVLGPDSGGEELE----HWNEMLASPRK 126


>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase
           activating proteins (GAPs).  RasGAPs suppress Ras
           function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  The proteins here all contain
           either a single C2 domain or two tandem C2 domains,  a
           Ras-GAP domain, and a pleckstrin homology (PH)-like
           domain. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions. Members here have a type-I topology.
          Length = 117

 Score = 51.9 bits (125), Expect = 7e-09
 Identities = 38/97 (39%), Positives = 49/97 (50%), Gaps = 8/97 (8%)

Query: 118 RLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSE- 176
           RLRI+   +L  K   G R    TV+ DQ ++ A TKT +K LNP W EEF+F   P + 
Sbjct: 3   RLRILEAKNLPSK---GTRDPYCTVSLDQ-VEVARTKTVEK-LNPFWGEEFVFDDPPPDV 57

Query: 177 --HKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDG 211
               L F   D     RD  +G V LS L+L +  D 
Sbjct: 58  TFFTLSFYNKDKRSKDRDIVIGKVALSKLDLGQGKDE 94


>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
           repeat in Synaptotagmin-like proteins.  Synaptotagmin is
           a membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains either the
           first or third repeat in Synaptotagmin-like proteins
           with a type-I topology.
          Length = 121

 Score = 51.5 bits (124), Expect = 9e-09
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 12/94 (12%)

Query: 117 IRLRIIAGHSLAKKDIFGARIDLNTVN-------GDQTIDSALTKTRKKTLNPVWNEEFI 169
           +R+ +I    L  KD F   +     +       G QT     +K  K+ LNP WNE + 
Sbjct: 3   LRIHVIEAQDLVAKDKFVGGLVKGKSDPYVIVRVGAQTFK---SKVIKENLNPKWNEVYE 59

Query: 170 FRVKPSE-HKLVFQVFDMNRLTRDDFLGMVELSL 202
             V      +L  ++FD +   +DDFLG + + L
Sbjct: 60  AVVDEVPGQELEIELFDEDP-DKDDFLGRLSIDL 92


>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fifth C2
           repeat, C2E, and has a type-II topology.
          Length = 124

 Score = 51.4 bits (124), Expect = 1e-08
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 117 IRLRIIAGHSLAKKDIFGARID--LNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVK- 173
           +R+ ++   +L  KD  G + D  L    G + I+         TLNPV+ + F      
Sbjct: 2   VRVYVVRARNLQPKDPNG-KSDPYLKIKLGKKKINDR-DNYIPNTLNPVFGKMFELEATL 59

Query: 174 PSEHKLVFQVFDMNRLTRDDFLG 196
           P    L   V D + L  DD +G
Sbjct: 60  PGNSILKISVMDYDLLGSDDLIG 82


>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins.  A
           single C2 domain is found in calpains (EC 3.4.22.52, EC
           3.4.22.53), calcium-dependent, non-lysosomal cysteine
           proteases.  Caplains are classified as belonging to Clan
           CA by MEROPS and include six families: C1, C2, C10, C12,
           C28, and C47.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 126

 Score = 51.5 bits (124), Expect = 1e-08
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 149 DSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELS 201
           +S  +  +K TL+P ++ + IF  K     +  QV++ N L  D+FLG   LS
Sbjct: 35  ESVRSPVQKDTLSPEFDTQAIFYRKKPRSPIKIQVWNSNLL-CDEFLGQATLS 86


>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 133

 Score = 51.6 bits (124), Expect = 1e-08
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T+ +KKTLNP +NEEF + +K S+     L   V+D +    +D++G ++L +
Sbjct: 54  TQVKKKTLNPEFNEEFFYDIKHSDLAKKTLEITVWDKDIGKSNDYIGGLQLGI 106


>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in
           Synaptotagmin 17.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 17 is located in
           the brain, kidney, and prostate and is thought to be a
           peripheral membrane protein. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 135

 Score = 50.7 bits (121), Expect = 3e-08
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 121 IIAGHSLAKKDIFGAR---IDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSE- 176
           II    L + D+       + +  V+G + I +  T   + T++P +NE F F+V   E 
Sbjct: 20  IIRAKQLLQTDMSQGSDPFVKIQLVHGLKLIKTKKTSCMRGTIDPFYNESFSFKVPQEEL 79

Query: 177 --HKLVFQVFDMNRLTRDDFLGMV 198
               LVF V+  N  + +DF+G +
Sbjct: 80  ENVSLVFTVYGHNVKSSNDFIGRI 103


>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  MCTP is
           composed of a variable N-terminal sequence, three C2
           domains, two transmembrane regions (TMRs), and a short
           C-terminal sequence.  It is one of four protein classes
           that are anchored to membranes via a transmembrane
           region; the others being synaptotagmins, extended
           synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 116

 Score = 49.9 bits (120), Expect = 3e-08
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE-HKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDG 211
           +K   KTLNP W E+F   +   +   L  +V+D +   +D+F+G  E+ L  LPRE   
Sbjct: 36  SKVCSKTLNPQWLEQFDLHLFDDQSQILEIEVWDKDTGKKDEFIGRCEIDLSALPREQTH 95

Query: 212 CVIHN 216
            +   
Sbjct: 96  SLELE 100


>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin
           ligase.  E3 ubiquitin ligase is part of the
           ubiquitylation mechanism responsible for controlling
           surface expression of membrane proteins.  The sequential
           action of several enzymes are involved:
           ubiquitin-activating enzyme E1, ubiquitin-conjugating
           enzyme E2, and ubiquitin-protein ligase E3 which is
           responsible for substrate recognition and promoting the
           transfer of ubiquitin to the target protein.  E3
           ubiquitin ligase is composed of an N-terminal C2 domain,
           4 WW domains, and a HECTc domain.  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 125

 Score = 50.0 bits (120), Expect = 4e-08
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDG 211
           T+  KKT NP WNE F   V P    L F+V+  + L  D  LG   L L ++ +  +G
Sbjct: 38  TEVSKKTSNPKWNEHFTVLVTPQST-LEFKVWSHHTLKADVLLGEASLDLSDILKNHNG 95


>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine
           decarboxylase (PSD).  PSD is involved in the
           biosynthesis of aminophospholipid by converting
           phosphatidylserine (PtdSer) to phosphatidylethanolamine
           (PtdEtn). There is a single C2 domain present and it is
           thought to confer PtdSer binding motif that is common to
           PKC and synaptotagmin. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 108

 Score = 48.8 bits (117), Expect = 7e-08
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE--HKLVFQVFDMNRLTRDDFLGMVELSLLNLPRES 209
           T  R+ TLNPV+NE   F V P E    + F+V D ++ + +D++    LS+  L   +
Sbjct: 41  TSWRRHTLNPVFNERLAFEVYPHEKNFDIQFKVLDKDKFSFNDYVATGSLSVQELLNAA 99


>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2
           and RasA3.  RasA2 and RasA3 are GAP1s (GTPase activating
           protein 1s ), Ras-specific GAP members, which suppresses
           Ras function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras. In this way it can control cellular proliferation
           and differentiation.  RasA2 and RasA3 are both inositol
           1,3,4,5-tetrakisphosphate-binding proteins and contain
           an N-terminal C2 domain, a Ras-GAP domain, a
           pleckstrin-homology (PH) domain which localizes it to
           the plasma membrane, and Bruton's Tyrosine Kinase (BTK)
           a zinc binding domain. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 121

 Score = 49.0 bits (117), Expect = 1e-07
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 141 TVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVEL 200
           TVN DQ  +   TKT +K+L P + E+F F +  +   L F ++D + L RD  +G V +
Sbjct: 27  TVNLDQE-EVFRTKTVEKSLCPFFGEDFYFEIPRTFRHLSFYIYDRDVLRRDSVIGKVAI 85

Query: 201 SLLNLPRESDGCVIHNKK--YILRP 223
                 ++ D    + K   + L+P
Sbjct: 86  ------KKEDLHKYYGKDTWFPLQP 104


>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in
           Synaptotagmin-like proteins 1-4.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the second
           C2 repeat, C2B, and has a type-I topology.
          Length = 162

 Score = 49.6 bits (119), Expect = 1e-07
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 6/55 (10%)

Query: 154 KTR--KKTLNPVWNEEFIFR-VKPSEHK---LVFQVFDMNRLTRDDFLGMVELSL 202
           KT   KK++NPVWN  F++  V P +     L   V+D ++L+ +DFLG V L L
Sbjct: 67  KTPVVKKSVNPVWNHTFVYDGVSPEDLSQACLELTVWDHDKLSSNDFLGGVRLGL 121


>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group.  C2
           domains were first identified in Protein Kinase C (PKC).
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 111

 Score = 48.4 bits (116), Expect = 1e-07
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHK----LVFQVFDMNRLTRDDFLGMVELSL 202
           T+  +K LNPVW E +   V P E K    L  +++D +R T DD LG VE+ L
Sbjct: 41  TRIIRKDLNPVWEETWFVLVTPDEVKAGERLSCRLWDSDRFTADDRLGRVEIDL 94


>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 153

 Score = 49.3 bits (118), Expect = 1e-07
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 5/57 (8%)

Query: 151 ALTKTRKKTLNPVWNEEFIFRVKP-SEHKLVFQVFDMNRLTRDDFLGMVELSLLNLP 206
            +T+ + +TLNPVWNE F F V+  S  +L   ++D +    DDFLG V + L +LP
Sbjct: 91  KVTEVKPQTLNPVWNETFRFEVEDVSNDQLHLDIWDHD----DDFLGCVNIPLKDLP 143


>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in
           Synaptotagmin-like proteins.  All Slp members basically
           share an N-terminal Slp homology domain (SHD) and
           C-terminal tandem C2 domains (named the C2A domain and
           the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. Slp5 mRNA has been shown
           to be restricted to human placenta and liver suggesting
           a role in Rab27A-dependent membrane trafficking in
           specific tissues. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the first
           C2 repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 48.4 bits (116), Expect = 1e-07
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T  +K T NPV+NE   + +  S+     L   V+  +R  R+ FLG VE+ L
Sbjct: 56  TSVKKNTTNPVFNETLKYHISKSQLETRTLQLSVWHHDRFGRNTFLGEVEIPL 108


>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in
           Synaptotagmin 8.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 48.2 bits (115), Expect = 1e-07
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE-HKLVFQV--FDMNRLTRDDFLGMVELSLLNL 205
           +K  KKTLNP ++E F+F V P E  K   +V  +D ++ +RD+ +G+VEL L  +
Sbjct: 55  SKIHKKTLNPEFDESFVFEVPPQELPKRTLEVLLYDFDQFSRDECIGVVELPLAEV 110


>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in
           Multiple C2 domain and Transmembrane region Proteins
           (MCTP); plant subset.  MCTPs are involved in Ca2+
           signaling at the membrane.  Plant-MCTPs are composed of
           a variable N-terminal sequence, four C2 domains, two
           transmembrane regions (TMRs), and a short C-terminal
           sequence.  It is one of four protein classes that are
           anchored to membranes via a transmembrane region; the
           others being synaptotagmins, extended synaptotagmins,
           and ferlins. MCTPs are the only membrane-bound C2 domain
           proteins that contain two functional TMRs. MCTPs are
           unique in that they bind Ca2+ but not phospholipids. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 127

 Score = 47.7 bits (114), Expect = 2e-07
 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 153 TKTRKKTLNPVWNEEFIFRV-KPSEHK---LVFQVFDMNRLTR-DDFLGMVELSLLNLPR 207
           T+T+ K LNPVWNE+ +F V  PS      L   V++  R  R   FLG V +S  +   
Sbjct: 36  TRTKPKDLNPVWNEKLVFNVSDPSRLSNLVLEVYVYNDRRSGRRRSFLGRVRISGTSFVP 95

Query: 208 ESDGCVIH 215
            S+  V  
Sbjct: 96  PSEAVVQR 103


>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome
           21 open reading frame 25 (C21orf25) protein.  The
           members in this cd are named after the Human C21orf25
           which contains a single C2 domain.  Several other
           members contain a C1 domain downstream of the C2 domain.
            No other information on this protein is currently
           known. The C2 domain was first identified in PKC. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 126

 Score = 47.7 bits (114), Expect = 2e-07
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMV 198
           + T+K T NP W+E F+F + P+  +L+F+V+D  + +   FLG+ 
Sbjct: 35  SSTQKNTSNPFWDEHFLFELSPNSKELLFEVYDNGKKSDSKFLGLA 80


>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin.  Ferlins
           are involved in vesicle fusion events.  Ferlins and
           other proteins, such as Synaptotagmins, are implicated
           in facilitating the fusion process when cell membranes
           fuse together.  There are six known human Ferlins:
           Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
           (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
           genes can lead to a wide range of diseases including
           muscular dystrophy (dysferlin), deafness (otoferlin),
           and infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 111

 Score = 47.2 bits (113), Expect = 3e-07
 Identities = 29/114 (25%), Positives = 45/114 (39%), Gaps = 17/114 (14%)

Query: 116 QIRLRIIAGHSLAKKDIFGARID-LNTVN-GDQTIDSALTKTRKKTLNPVWNEEFIFRVK 173
           Q+R+R+I    L      G  ID +  V  G Q      T  +K T  P +NE F F   
Sbjct: 5   QVRVRVIEARQLV-----GGNIDPVVKVEVGGQKKY---TSVKKGTNCPFYNEYFFFNFH 56

Query: 174 PSEH-----KLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILR 222
            S        +   V+D   L  D  +G  +L +  +  + D   +   K++L 
Sbjct: 57  ESPDELFDKIIKISVYDSRSLRSDTLIGSFKLDVGTVYDQPDHAFLR--KWLLL 108


>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 124

 Score = 47.5 bits (114), Expect = 3e-07
 Identities = 19/50 (38%), Positives = 23/50 (46%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSL 202
           TK +K T NPVWNE     V      L   V+D N   +D  +G  E  L
Sbjct: 41  TKVKKDTSNPVWNETKYILVNSLTEPLNLTVYDFNDKRKDKLIGTAEFDL 90


>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family
           interacting proteins (FIP) class I.  Rab GTPases recruit
           various effector proteins to organelles and vesicles.
           Rab11-family interacting proteins (FIPs) are involved in
           mediating the role of Rab11. FIPs can be divided into
           three classes: class I FIPs (Rip11a, Rip11b, RCP, and
           FIP2) which contain a C2 domain after N-terminus of the
           protein, class II FIPs (FIP3 and FIP4) which contain two
           EF-hands and a proline rich region, and class III FIPs
           (FIP1) which exhibits no homology to known protein
           domains. All FIP proteins contain a highly conserved,
           20-amino acid motif at the C-terminus of the protein,
           known as Rab11/25 binding domain (RBD).  Class I FIPs
           are thought to bind to endocytic membranes via their C2
           domain, which interacts directly with phospholipids.
           Class II FIPs do not have any membrane binding domains
           leaving much to speculate about the mechanism involving
           FIP3 and FIP4 interactions with endocytic membranes. The
           members in this CD are class I FIPs.  The exact function
           of the Rab11 and FIP interaction is unknown, but there
           is speculation that it involves the role of forming a
           targeting complex that recruits a group of proteins
           involved in membrane transport to organelles. The C2
           domain was first identified in PKC. C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins. Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain. C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 126

 Score = 47.4 bits (113), Expect = 3e-07
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 6/60 (10%)

Query: 152 LTKTRKKTLNPVWNEEFIFRV------KPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
            T  ++KT +PVW EE  F +        +   L   V   N L  D FLG V + L +L
Sbjct: 34  STSVKEKTTSPVWKEECSFELPGLLSGNGNRATLQLTVMHRNLLGLDKFLGQVSIPLNDL 93


>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2
            domain [General function prediction only].
          Length = 1227

 Score = 49.8 bits (119), Expect = 4e-07
 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 153  TKTRKKTLNPVWNEEFIFRVKPSEHK--LVFQVFDMNRLTRDDFLGMVELSLLNLPRESD 210
            TK  KKTLNPVWNEEF   V  +  K  L   V D +   ++D LG  E+ L  L     
Sbjct: 1077 TKVVKKTLNPVWNEEFTIEV-LNRVKDVLTINVNDWDSGEKNDLLGTAEIDLSKLEPGGT 1135



 Score = 42.1 bits (99), Expect = 2e-04
 Identities = 27/107 (25%), Positives = 41/107 (38%), Gaps = 4/107 (3%)

Query: 117 IRLRIIAGHSLAKKDIF-GARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPS 175
           + ++I +   L K D      +D              T+ +K TLNPVWNE F   +   
Sbjct: 438 VEVKIKSAEGLKKSDSTINGTVDPYITVTFSDRVIGKTRVKKNTLNPVWNETFYILLNSF 497

Query: 176 EHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILR 222
              L   ++D N    D  +G  +L L  L +     V  N+ Y   
Sbjct: 498 TDPLNLSLYDFNSFKSDKVVGSTQLDLALLHQNP---VKKNELYEFL 541



 Score = 27.0 bits (60), Expect = 9.7
 Identities = 24/106 (22%), Positives = 43/106 (40%), Gaps = 11/106 (10%)

Query: 112 EPTEQIRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNE 166
            P   IR+ +   + L  +   G     A + +N +   +TI  +       TLNP+WNE
Sbjct: 708 TPIGAIRVSVRKANDLRNEIPGGKSDPYATVLVNNLVKYRTIYGS------STLNPIWNE 761

Query: 167 EFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGC 212
                V     +L  +  D      D  LG V +++ N+ ++ +  
Sbjct: 762 ILYVPVTSKNQRLTLECMDYEESGDDRNLGEVNINVSNVSKKDEDS 807


>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2
           domain and Transmembrane region Proteins (MCTP).  MCTPs
           are involved in Ca2+ signaling at the membrane.  The cds
           in this family contain multiple C2 domains as well as a
           C-terminal PRT domain.  It is one of four protein
           classes that are anchored to membranes via a
           transmembrane region; the others being synaptotagmins,
           extended synaptotagmins, and ferlins. MCTPs are the only
           membrane-bound C2 domain proteins that contain two
           functional TMRs. MCTPs are unique in that they bind Ca2+
           but not phospholipids. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 119

 Score = 46.5 bits (111), Expect = 5e-07
 Identities = 21/53 (39%), Positives = 31/53 (58%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           T T  KTLNP WN+ F F +K     L   V+D ++  + +FLG V + LL++
Sbjct: 37  THTIYKTLNPEWNKIFTFPIKDIHDVLEVTVYDEDKDKKPEFLGKVAIPLLSI 89


>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1
           and RasA4.  RasA1 and RasA4 are GAP1s (GTPase activating
           protein 1s ), Ras-specific GAP members, which suppresses
           Ras function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  Both proteins contain two C2
           domains,  a Ras-GAP domain, a plextrin homology
           (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK)
           zinc binding domain. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 123

 Score = 46.7 bits (111), Expect = 5e-07
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 117 IRLRIIAGHSLAKKDIFGARIDLNTVN-GDQTIDSALTKTRKKTLNPVWNEEFIFRVKPS 175
           +R  ++    LA KD  G       V    QT++   T   KK+  P WNE F F +   
Sbjct: 2   LRCHVLEARDLAPKDRNGTSDPFVRVFYNGQTLE---TSVVKKSCYPRWNEVFEFELMEG 58

Query: 176 E-HKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
               L  +V+D + ++++DFLG V  S+  L
Sbjct: 59  ADSPLSVEVWDWDLVSKNDFLGKVVFSIQTL 89


>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 46.1 bits (110), Expect = 8e-07
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 153 TKTRKKTLNPVWNEEFIFR-VKPSE---HKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           TKT  KT NP +NE   +  +   +     L   V D +R   +DFLG   + L  L
Sbjct: 56  TKTVHKTRNPEFNETLTYYGITEEDIQRKTLRLLVLDEDRF-GNDFLGETRIPLKKL 111


>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in
           Synaptotagmin-like proteins 1 and 2.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike Slp3 and
           Slp4/granuphilin which are Ca2+ dependent.  It is
           thought that SHD (except for the Slp4-SHD) functions as
           a specific Rab27A/B-binding domain.  In addition to
           Slps, rabphilin, Noc2, and  Munc13-4 also function as
           Rab27-binding proteins.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 46.3 bits (110), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T  +KKTLNPV+NE   ++V+  E     L   V+  + L R+ FLG VE+ L
Sbjct: 57  TSVKKKTLNPVFNETLRYKVEREELPTRVLNLSVWHRDSLGRNSFLGEVEVDL 109


>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2
           (cPLA2).  A single copy of the C2 domain is present in
           cPLA2 which releases arachidonic acid from membranes
           initiating the biosynthesis of potent inflammatory
           mediators such as prostaglandins, leukotrienes, and
           platelet-activating factor.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members of this cd have a
           type-II topology.
          Length = 119

 Score = 45.7 bits (109), Expect = 1e-06
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPS-EHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRE 208
           TKT K ++NPVWNE F FR++   ++ L   V D + +  DD LG V   +  L   
Sbjct: 39  TKTIKNSINPVWNETFEFRIQSQVKNVLELTVMDEDYV-MDDHLGTVLFDVSKLKLG 94


>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in
           Synaptotagmin 4.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 45.9 bits (109), Expect = 1e-06
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 127 LAKKDIFGAR---IDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEH----KL 179
           L K D+ G     + +N   G + I    T  +K TLNPV+NE F+F + PSE      +
Sbjct: 27  LPKMDVSGLADPYVKVNLYYGKKRISKKKTHVKKCTLNPVFNESFVFDI-PSEELEDISV 85

Query: 180 VFQVFDMNRLTRDDFLGMVELS 201
            F V D +R+T+++ +G + L 
Sbjct: 86  EFLVLDSDRVTKNEVIGRLVLG 107


>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in
           Synaptotagmin 1.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 1, a member of the
           class 1 synaptotagmins, is located in the brain and
           endocranium and localized to the synaptic vesicles and
           secretory granules.  It functions as a Ca2+ sensor for
           fast exocytosis. It, like synaptotagmin-2, has an
           N-glycosylated N-terminus. Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 45.1 bits (107), Expect = 3e-06
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEH----KLVFQVFDMNRLTRDDFLGMVELSLLNLPRE 208
           T  +K+TLNP +NE F F V P E      L+  V D +R+ ++D +G V L        
Sbjct: 56  TTIKKRTLNPYYNESFSFEV-PFEQIQKVHLIVTVLDYDRIGKNDPIGKVVLG----CNA 110

Query: 209 SDGCVIHNKKYILRPRR 225
           +   + H    +  PRR
Sbjct: 111 TGAELRHWSDMLASPRR 127


>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 125

 Score = 44.5 bits (106), Expect = 3e-06
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE----HKLVFQVFDMNRLTRDDFLGMVELSL 202
           TKT KKTLNP WN+ F +     E      L   V+D +R   +DFLG V + L
Sbjct: 57  TKTVKKTLNPEWNQTFEYSNVRRETLKERTLEVTVWDYDRDGENDFLGEVVIDL 110


>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present
           in Synaptotagmins 15 and 17.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. It is thought to be involved in
           the trafficking and exocytosis of secretory vesicles in
           non-neuronal tissues and is Ca2+ independent. Human
           synaptotagmin 15 has 2 alternatively spliced forms that
           encode proteins with different C-termini.  The larger,
           SYT15a, contains a N-terminal TM region, a putative
           fatty-acylation site, and 2 tandem C terminal C2
           domains.  The smaller, SYT15b, lacks the C-terminal
           portion of the second C2 domain.  Unlike most other
           synaptotagmins it is nearly absent in the brain and
           rather is found in the heart, lungs, skeletal muscle,
           and testis. Synaptotagmin 17 is located in the brain,
           kidney, and prostate and is thought to be a peripheral
           membrane protein. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 43.8 bits (104), Expect = 6e-06
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           +K ++KT NP ++E F+F+V   E     L   V+D++R +R   +G V   L +L
Sbjct: 54  SKVKRKTQNPNFDETFVFQVSFKELQRRTLRLSVYDVDRFSRHCIIGHVLFPLKDL 109


>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in
           Phosphoinositide-specific phospholipases C (PLC).  PLCs
           are involved in the hydrolysis of
           phosphatidylinositol-4,5-bisphosphate (PIP2) to
           d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and
           sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are
           second messengers in eukaryotic signal transduction
           cascades. PLC is composed of a N-terminal PH domain
           followed by a series of EF hands, a catalytic TIM barrel
           and a C-terminal C2 domain. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-II
           topology.
          Length = 128

 Score = 43.3 bits (103), Expect = 1e-05
 Identities = 34/98 (34%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 117 IRLRIIAGHSLAKKDIFGARIDLNT-----VNGDQTIDSALTKTR---KKTLNPVWNEEF 168
           + ++II+G  L K       I ++      ++G    DSA  KT+       NPVWNE F
Sbjct: 4   LTIKIISGQQLPKPKGDKGSI-VDPYVEVEIHGLPADDSAKFKTKVVKNNGFNPVWNETF 62

Query: 169 IFRVK-PSEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
            F V  P    L F V+D +    DDFLG   L L +L
Sbjct: 63  EFDVTVPELAFLRFVVYDEDS-GDDDFLGQACLPLDSL 99


>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian
           uncoordinated) proteins.  C2-like domains are thought to
           be involved in phospholipid binding in a Ca2+
           independent manner in both Unc13 and Munc13.
           Caenorabditis elegans Unc13 has a central domain with
           sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 127

 Score = 43.3 bits (102), Expect = 1e-05
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 13/106 (12%)

Query: 116 QIRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPS 175
           +I + ++    L  KD  G      TV   +T     TKT  + LNPVWNE+F F    S
Sbjct: 2   KISITVVCAQGLIAKDKTGTSDPYVTVQVGKT--KKRTKTIPQNLNPVWNEKFHFECHNS 59

Query: 176 EHKLVFQVFD---------MNRLTR--DDFLGMVELSLLNLPRESD 210
             ++  +V+D           + TR  DDFLG   + +  L  E D
Sbjct: 60  SDRIKVRVWDEDDDIKSRLKQKFTRESDDFLGQTIIEVRTLSGEMD 105


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in
           the putative elicitor-responsive gene.  In plants
           elicitor-responsive proteins are triggered in response
           to specific elicitor molecules such as glycolproteins,
           peptides, carbohydrates and lipids. A host of defensive
           responses are also triggered resulting in localized cell
           death.  Antimicrobial secondary metabolites, such as
           phytoalexins, or defense-related proteins, including
           pathogenesis-related (PR) proteins  are also produced.
           There is a single C2 domain present here.  C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members have a type-II
           topology.
          Length = 124

 Score = 42.3 bits (100), Expect = 2e-05
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 10/54 (18%)

Query: 153 TKTRKKTL------NPVWNEEFIFRVKPSE----HKLVFQVFDMNRLTRDDFLG 196
           T+ RK  +      NP WNE+F F V+        KL+ ++ D +  + DDF+G
Sbjct: 32  TQERKSKVAKGDGRNPEWNEKFKFTVEYPGWGGDTKLILRIMDKDNFSDDDFIG 85


>gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 146

 Score = 42.8 bits (101), Expect = 2e-05
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 144 GDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVF-DMNRLTRDDFLGMVELSL 202
           G + I    TK  +KTL+P++ ++ +F V P+   L   V+ D  R+ +  F+G+ ++ L
Sbjct: 62  GKKCIAKKKTKIARKTLDPLYQQQLVFDVSPTGKTLQVIVWGDYGRMDKKVFMGVAQILL 121

Query: 203 LNL 205
            +L
Sbjct: 122 DDL 124


>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in
           Synaptotagmin-like proteins.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 42.4 bits (100), Expect = 2e-05
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 117 IRLRIIAGHSLAKKDIFGA-----RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +R+ ++    LA KD  G         L+   G Q      T+T   TLNP WN    F 
Sbjct: 3   LRVHVVEAKDLAAKDRSGKGKSDPYAILSV--GAQRFK---TQTIPNTLNPKWNYWCEFP 57

Query: 172 VKPSEHKLV-FQVFDMNRLTRDDFLGMVELSL 202
           +  ++++L+   ++D +R    D+LG  +++L
Sbjct: 58  IFSAQNQLLKLILWDKDRFAGKDYLGEFDIAL 89


>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 151

 Score = 41.8 bits (99), Expect = 4e-05
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 153 TKTRKKTLNPVWNEEFIFRVK-PSE-HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T  +K + NP WNE+ +F    P    ++  Q+ D +R+  DD +G   + L
Sbjct: 50  TSVKKNSYNPEWNEQIVFPEMFPPLCERIKIQIRDWDRVGNDDVIGTHFIDL 101


>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine.  There are 2
           copies of the C2 domain present in copine, a protein
           involved in membrane trafficking, protein-protein
           interactions, and perhaps even cell division and growth.
            C2 domains fold into an 8-standed beta-sandwich that
           can adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 120

 Score = 41.4 bits (98), Expect = 4e-05
 Identities = 25/98 (25%), Positives = 40/98 (40%), Gaps = 11/98 (11%)

Query: 115 EQIRLRIIAGHSLAKKDIFG-----ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFI 169
            ++ L I +  +L  KD+         + + T    Q ++   T+  K  LNP +   F 
Sbjct: 1   PKVELSI-SCRNLLDKDVLSKSDPFVVVYVKTGGSGQWVEIGRTEVIKNNLNPDFVTTFT 59

Query: 170 FRVK-PSEHKLVFQVFD----MNRLTRDDFLGMVELSL 202
                    KL F+V+D       L+  DFLG  E +L
Sbjct: 60  VDYYFEEVQKLRFEVYDVDSKSKDLSDHDFLGEAECTL 97


>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21
           protein activator 3 (RasA3).  RasA3 are members of
           GTPase activating protein 1 (GAP1), a Ras-specific GAP,
           which suppresses Ras function by enhancing the GTPase
           activity of Ras proteins resulting in the inactive
           GDP-bound form of Ras.  In this way it can control
           cellular proliferation and differentiation.  RasA3
           contains an N-terminal C2 domain,  a Ras-GAP domain, a
           plextrin homology (PH)-like domain, and a Bruton's
           Tyrosine Kinase (BTK) zinc binding domain. C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 148

 Score = 41.6 bits (98), Expect = 6e-05
 Identities = 37/130 (28%), Positives = 53/130 (40%), Gaps = 28/130 (21%)

Query: 116 QIRLRIIAGHSLAKK----DIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           ++ +R+I    LA K    D + A + L   N  Q  D+  TK +KKT NP ++E F F 
Sbjct: 1   KLSVRVIECSDLALKNGTCDPY-ASVTLIYSNKKQ--DTKRTKVKKKTNNPQFDEAFYFD 57

Query: 172 VKPSEHKLVFQVFDM-----------------NRLTRDDFLGMVELSLLNLPRESDGCVI 214
           V         Q F+M                 +    D FLG V + L  L  ++     
Sbjct: 58  VTIDSSPEKKQ-FEMPEEDAEKLELRVDLWHASMGGGDVFLGEVRIPLRGLDLQA---GS 113

Query: 215 HNKKYILRPR 224
           H   Y L+PR
Sbjct: 114 HQAWYFLQPR 123


>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC)
           epsilon.  A single C2 domain is found in PKC epsilon.
           The PKC family of serine/threonine kinases regulates
           apoptosis, proliferation, migration, motility,
           chemo-resistance, and differentiation.  There are 3
           groups: group 1 (alpha, betaI, beta II, gamma) which
           require phospholipids and calcium, group 2 (delta,
           epsilon, theta, eta) which do not require calcium for
           activation, and group 3 (xi, iota/lambda) which are
           atypical and can be activated in the absence of
           diacylglycerol and calcium. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  Members here have a type-II
           topology.
          Length = 132

 Score = 39.9 bits (94), Expect = 2e-04
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 141 TVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVEL 200
           +++ D T     T T+ KT +PVWNEEF   V  +   L   VF    +  DDF+    +
Sbjct: 40  SIDVDDTH-IGKTSTKPKTNSPVWNEEFTTEVH-NGRNLELTVFHDAAIGPDDFVANCTI 97

Query: 201 SL 202
           S 
Sbjct: 98  SF 99


>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin.  A
           single instance of the C2 domain is located C terminally
           in the intersectin protein.  Intersectin functions as a
           scaffolding protein, providing a link between the actin
           cytoskeleton and the components of endocytosis and plays
           a role in signal transduction.   In addition to C2,
           intersectin contains several additional domains
           including: Eps15 homology domains, SH3 domains, a RhoGEF
           domain, and a PH domain.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. The members here have topology
           I.
          Length = 136

 Score = 39.7 bits (93), Expect = 2e-04
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHK-LVFQVFDMNRLTRDDFLGMVELSLLNLPRES 209
           TK    TLNP WN    F VK  E   L   VFD +  + DDFLG  E+ + ++ +E+
Sbjct: 51  TKVVSDTLNPKWNSSMQFFVKDLEQDVLCITVFDRDFFSPDDFLGRTEIRVADILKET 108


>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in
           Synaptotagmins 4 and 11.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4
           synaptotagmins, are located in the brain.  Their
           functions are unknown. They are distinguished from the
           other synaptotagmins by having and Asp to Ser
           substitution in their C2A domains. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 39.3 bits (92), Expect = 3e-04
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 154 KTR--KKTLNPVWNEEFIF----RVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPR 207
           KTR  +KT NPV++E F F      +  +  L F V   +R +RDD +G V   L     
Sbjct: 55  KTRVLRKTRNPVYDETFTFYGIPYNQLQDLSLHFAVLSFDRYSRDDVIGEVVCPLAGADL 114

Query: 208 ESDGCVIHNKK 218
            ++G ++ +++
Sbjct: 115 LNEGELLVSRE 125


>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 127

 Score = 39.2 bits (92), Expect = 3e-04
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 154 KTRKKT--LNPVWNEEFIFRVK----PSEHKLVFQVFDMNRLTRDDFLGMVELSL 202
           KTR     LNPVWNE F + +     P E  L   V D  ++ R+  +G   +SL
Sbjct: 29  KTRVLENELNPVWNETFEWPLAGSPDPDE-SLEIVVKDYEKVGRNRLIGSATVSL 82


>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 120

 Score = 38.7 bits (91), Expect = 3e-04
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEH-KLVFQVFDMNRLTRDDFLGMVELSLLNLPRESD 210
           T T   TLNPVW+E     V  S + K+  +V D  ++ +D  LG VE+++ +L ++++
Sbjct: 38  TVTISNTLNPVWDEVLYVPVT-SPNQKITLEVMDYEKVGKDRSLGSVEINVSDLIKKNE 95


>gnl|CDD|176020 cd08374, C2F_Ferlin, C2 domain sixth repeat in Ferlin.  Ferlins are
           involved in vesicle fusion events.  Ferlins and other
           proteins, such as Synaptotagmins, are implicated in
           facilitating the fusion process when cell membranes fuse
           together.  There are six known human Ferlins: Dysferlin
           (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3),
           Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can
           lead to a wide range of diseases including muscular
           dystrophy (dysferlin), deafness (otoferlin), and
           infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the sixth C2
           repeat, C2E, and has a type-II topology.
          Length = 133

 Score = 38.8 bits (91), Expect = 4e-04
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 3/42 (7%)

Query: 166 EEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPR 207
           +E  +++ P   KL  QV+D ++ + DDFLG +EL L  LPR
Sbjct: 85  DETEYKIPP---KLTLQVWDNDKFSPDDFLGSLELDLSILPR 123


>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in
           Multiple C2 domain and Transmembrane region Proteins
           (MCTP); plant subset.  MCTPs are involved in Ca2+
           signaling at the membrane.  Plant-MCTPs are composed of
           a variable N-terminal sequence, four C2 domains, two
           transmembrane regions (TMRs), and a short C-terminal
           sequence.  It is one of four protein classes that are
           anchored to membranes via a transmembrane region; the
           others being synaptotagmins, extended synaptotagmins,
           and ferlins. MCTPs are the only membrane-bound C2 domain
           proteins that contain two functional TMRs. MCTPs are
           unique in that they bind Ca2+ but not phospholipids. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 150

 Score = 38.8 bits (91), Expect = 5e-04
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 154 KTR---KKTLNPVWNEEFIFRV-KPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRES 209
           +TR    +  NP WNEE +F   +P E  L+  V D     +D+ LG   + L ++ R  
Sbjct: 35  RTRPSQTRNGNPSWNEELMFVAAEPFEDHLILSVEDRVGPNKDEPLGRAVIPLNDIERRV 94

Query: 210 DGCVIHNKKYILRP 223
           D   + ++ + L  
Sbjct: 95  DDRPVPSRWFSLER 108


>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian
           uncoordinated) proteins; fungal group.  C2-like domains
           are thought to be involved in phospholipid binding in a
           Ca2+ independent manner in both Unc13 and Munc13.
           Caenorabditis elegans Unc13 has a central domain with
           sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 126

 Score = 38.4 bits (90), Expect = 5e-04
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 119 LRIIAGHSLAKKDIFGAR---IDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPS 175
           +RI+   +L      G     + L   NG + I  A T+T   TLNP W+EEF   V   
Sbjct: 5   IRIVRAENLKADSSNGLSDPYVTLVDTNGKRRI--AKTRTIYDTLNPRWDEEFELEVPAG 62

Query: 176 EHK-LVFQVFDMNRLTRDDFLG 196
           E   +   V+D + + + D  G
Sbjct: 63  EPLWISATVWDRSFVGKHDLCG 84


>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528
           cDNA clone.  The members of this CD are named after the
           Human KIAA0528 cDNA clone.  All members here contain a
           single C2 repeat.  No other information on this protein
           is currently known. The C2 domain was first identified
           in PKC.  C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.
          Length = 110

 Score = 38.1 bits (89), Expect = 6e-04
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 153 TKTRKKTLNPVWN-EEFIFRVKP---SEHKLVFQVFDMNRLTRDDFLGMVELSL 202
           T   KK+LNPVWN E F F V      +  L  +V D +  + +D +G V + L
Sbjct: 36  TDVVKKSLNPVWNSEWFRFEVDDEELQDEPLQIRVMDHDTYSANDAIGKVYIDL 89


>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat
           present in Synaptotagmins 3, 5, 6, 9, and 10.
           Synaptotagmin is a membrane-trafficking protein
           characterized by a N-terminal transmembrane region, a
           linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a
           member of class 3 synaptotagmins, is located in the
           brain and localized to the active zone and plasma
           membrane.  It functions as a Ca2+ sensor for fast
           exocytosis. It, along with synaptotagmins 5,6, and 10,
           has disulfide bonds at its N-terminus. Synaptotagmin 9,
           a class 5 synaptotagmins, is located in the brain and
           localized to the synaptic vesicles.  It is thought to be
           a Ca2+-sensor for dense-core vesicle exocytosis.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 134

 Score = 37.5 bits (87), Expect = 0.001
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 119 LRIIAGHSLAKKDIFGAR---IDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPS 175
           L II   +L   DI G     + ++ +   + +    T  +K TLNP +NE  +F V P 
Sbjct: 18  LTIIKARNLKAMDITGFSDPYVKVSLMCEGRRLKKKKTSVKKNTLNPTYNEALVFDVPPE 77

Query: 176 --EH-KLVFQVFDMNRLTRDDFLGMVEL 200
             ++  L+  V D +R+  ++ +G+  +
Sbjct: 78  NVDNVSLIIAVVDYDRVGHNELIGVCRV 105


>gnl|CDD|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase.
          Length = 644

 Score = 39.1 bits (91), Expect = 0.001
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 8/104 (7%)

Query: 103 MSSNNSAPEEPTEQIRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNP 162
             S  +   E    I L  + G  +  KD + A +      G+QT     T+T   T  P
Sbjct: 41  SVSQRAVSAEDFSGIALLTLVGAEMKFKDKWLACVSF----GEQTFR---TETSDSTDKP 93

Query: 163 VWNEEFIFRV-KPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           VWN E    + K   H     VF+ NRL+++  +G  EL L + 
Sbjct: 94  VWNSEKKLLLEKNGPHLARISVFETNRLSKNTLVGYCELDLFDF 137


>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in
           Synaptotagmin-like proteins.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 105

 Score = 36.4 bits (85), Expect = 0.002
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 153 TKTRKKTLNPVWNEEFIFRV-KPSEHKLVFQVFD 185
           +K +++T NPVW E F F V  P   +L  +V D
Sbjct: 36  SKVKERTNNPVWEEGFTFLVRNPENQELEIEVKD 69


>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in
           uncharacterized human KIAA1228-like proteins.  KIAA
           proteins are uncharacterized human proteins. They were
           compiled by the Kazusa mammalian cDNA project which
           identified more than 2000 human genes. They are
           identified by 4 digit codes that precede the KIAA
           designation.  Many KIAA genes are still functionally
           uncharacterized including KIAA1228. C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 127

 Score = 36.1 bits (84), Expect = 0.004
 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 9/57 (15%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSEHKLVF-------QVFDMNRLTRDDFLGMVELSL 202
           T  +K  LNPV++E F F V   E K              ++R      LG V + L
Sbjct: 57  TSVKKDNLNPVFDETFEFPVSLEELKRRTLDVAVKNSKSFLSR--EKKLLGQVLIDL 111


>gnl|CDD|227354 COG5021, HUL4, Ubiquitin-protein ligase [Posttranslational
           modification, protein turnover, chaperones].
          Length = 872

 Score = 37.4 bits (87), Expect = 0.004
 Identities = 16/63 (25%), Positives = 26/63 (41%), Gaps = 3/63 (4%)

Query: 64  QQGALPPGWEERTDANGRTYYVNHIARCTQWERPTVHHTMS---SNNSAPEEPTEQIRLR 120
               L   +  R D+ GRTYY++H    TQ+ RP +  T+    S      + +  I+  
Sbjct: 295 SLLRLNSLFSTRADSFGRTYYLDHDRILTQYSRPLLEETLGESTSFLVVNNDDSSSIKDL 354

Query: 121 IIA 123
              
Sbjct: 355 PHQ 357



 Score = 27.8 bits (62), Expect = 6.2
 Identities = 19/97 (19%), Positives = 30/97 (30%), Gaps = 10/97 (10%)

Query: 25  LEVSRHRES----ADPDSWIIVDASTESIVETPAQPLFIGGVEQQGALPPGWEERTDANG 80
              S    S     D     +   S ES     A  +      ++G L  GW+ R +   
Sbjct: 402 FLFSDFLTSSSTYEDLRREQLGRESDESFYV--ASNVQQQRASREGPLLSGWKTRLNNLY 459

Query: 81  RTYYVNHIARCTQWERPTVHHTMSSNNSAPEEPTEQI 117
           R Y+V H  +            + S  S  +    +I
Sbjct: 460 RFYFVEHRKKTLTKNDS----RLGSFISLNKLDIRRI 492


>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine.  There are
           2 copies of the C2 domain present in copine, a protein
           involved in membrane trafficking, protein-protein
           interactions, and perhaps even cell division and growth.
            C2 domains fold into an 8-standed beta-sandwich that
           can adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 110

 Score = 35.6 bits (83), Expect = 0.004
 Identities = 25/100 (25%), Positives = 38/100 (38%), Gaps = 24/100 (24%)

Query: 122 IAGHSLAKKDIFG--------ARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVK 173
            +G  L KKD FG        +R           +    T+  K TLNPVW     F + 
Sbjct: 7   FSGKKLDKKDFFGKSDPFLEISRQS----EDGTWVLVYRTEVIKNTLNPVWKP---FTI- 58

Query: 174 PSEH--------KLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           P +          +  +V+D +   + D +G  E +L  L
Sbjct: 59  PLQKLCNGDYDRPIKIEVYDYDSSGKHDLIGEFETTLDEL 98


>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in
           Tricalbin-like proteins.  5 to 6 copies of the C2 domain
           are present in Tricalbin, a yeast homolog of
           Synaptotagmin, which is involved in membrane trafficking
           and sorting.  C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 111

 Score = 35.3 bits (82), Expect = 0.006
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 153 TKTRKKTLNPVWNE--EFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSL 202
           T+ +KKT NP WN   EF+   +  + ++   V D +R   D  LG V +SL
Sbjct: 29  TRVKKKTNNPSWNASTEFLVTDR-RKSRVTVVVKD-DRDRHDPVLGSVSISL 78


>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in
           Synaptotagmin-like proteins 4 and 5.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length. SHD of
           Slp (except for the Slp4-SHD) function as a specific
           Rab27A/B-binding domain.  In addition to Slp, rabphilin,
           Noc2, and  Munc13-4 also function as Rab27-binding
           proteins. It has been demonstrated that Slp4/granuphilin
           promotes dense-core vesicle exocytosis. The C2A domain
           of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to
           be restricted to human placenta and liver suggesting a
           role in Rab27A-dependent membrane trafficking in
           specific tissues. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 34.7 bits (80), Expect = 0.009
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T  ++ T NPV+NE   + +  S+     L   V+  +R  R+ FLG VE+ L
Sbjct: 57  TSIKRNTTNPVYNETLKYSISHSQLETRTLQLSVWHYDRFGRNTFLGEVEIPL 109


>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin.  Ferlins
           are involved in vesicle fusion events.  Ferlins and
           other proteins, such as Synaptotagmins, are implicated
           in facilitating the fusion process when cell membranes
           fuse together.  There are six known human Ferlins:
           Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
           (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
           genes can lead to a wide range of diseases including
           muscular dystrophy (dysferlin), deafness (otoferlin),
           and infertility (fer-1, fertilization factor-1).
           Structurally they have 6 tandem C2 domains, designated
           as (C2A-C2F) and a single C-terminal transmembrane
           domain, though there is a new study that disputes this
           and claims that there are actually 7 tandem C2 domains
           with another C2 domain inserted between C2D and C2E. 
           In a subset of them (Dysferlin, Myoferlin, and Fer1)
           there is an additional conserved domain called DysF. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the fourth C2
           repeat, C2D, and has a type-II topology.
          Length = 135

 Score = 34.4 bits (80), Expect = 0.016
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 150 SALTKTRKKTLNPVWNEEFIFR----------VKPSEHKLVFQVFDMNRLTRDDFLG 196
           S  T+  K+TL+P W++  IF           +  +   +V ++FD + + +D+FLG
Sbjct: 34  SQETEVIKETLSPTWDQTLIFDEVELYGSPEEIAQNPPLVVVELFDQDSVGKDEFLG 90


>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in
           class II phosphatidylinositol 3-kinases (PI3Ks).  There
           are 3 classes of PI3Ks based on structure, regulation,
           and specificity.  All classes contain a N-terminal C2
           domain, a PIK domain, and a kinase catalytic domain.
           Unlike class I and class III, class II PI3Ks have
           additionally a PX domain and a C-terminal C2 domain
           containing a nuclear localization signal both of which
           bind phospholipids though in a slightly different
           fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns)
           3-kinases) regulate cell processes such as cell growth,
           differentiation, proliferation, and motility. PI3Ks work
           on phosphorylation of phosphatidylinositol,
           phosphatidylinositide (4)P (PtdIns (4)P),2 or
           PtdIns(4,5)P2. Specifically they phosphorylate the D3
           hydroxyl group of phosphoinositol lipids on the inositol
           ring. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins. Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions. This cd contains the second C2 repeat, C2B, and
           has a type-I topology.
          Length = 122

 Score = 34.2 bits (79), Expect = 0.016
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKP----SEHKLVFQVFDMNRLTRDDFLGMV--ELSLLNLP 206
           TK  +KT NP +NE  ++   P     +  L   V+  + L  ++FLG V   L  L+L 
Sbjct: 53  TKVVRKTRNPTFNEMLVYDGLPVEDLQQRVLQVSVWSHDSLVENEFLGGVCIPLKKLDLS 112

Query: 207 RESDG 211
           +E++ 
Sbjct: 113 QETEK 117


>gnl|CDD|175998 cd04032, C2_Perforin, C2 domain of Perforin.  Perforin contains a
           single copy of a C2 domain in its C-terminus and plays a
           role in lymphocyte-mediated cytotoxicity.  Mutations in
           perforin leads to familial hemophagocytic
           lymphohistiocytosis type 2.  The function of perforin is
           calcium dependent and the C2 domain is thought to confer
           this binding to target cell membranes.  C2 domains fold
           into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 127

 Score = 33.4 bits (77), Expect = 0.033
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%)

Query: 161 NPVWNEEFIF-RVKPSE-HKLVFQVFDMNRLTRDDFLGMVELSL 202
           NP WN  F F  V+ S   KL F+V+D +    DD LG   +  
Sbjct: 71  NPRWNATFDFGSVELSPGGKLRFEVWDRDNGWDDDLLGTCSVVP 114


>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in
           Multiple C2 domain and Transmembrane region Proteins
           (MCTP); plant subset.  MCTPs are involved in Ca2+
           signaling at the membrane.  Plant-MCTPs are composed of
           a variable N-terminal sequence, four C2 domains, two
           transmembrane regions (TMRs), and a short C-terminal
           sequence.  It is one of four protein classes that are
           anchored to membranes via a transmembrane region; the
           others being synaptotagmins, extended synaptotagmins,
           and ferlins. MCTPs are the only membrane-bound C2 domain
           proteins that contain two functional TMRs. MCTPs are
           unique in that they bind Ca2+ but not phospholipids. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 121

 Score = 32.3 bits (74), Expect = 0.067
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 150 SALTKTRKKTLNPVWNEEFIF-RVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPR 207
              TK  ++T NP WN+ F F + +     L   V+D ++   DDFLG V   L  +P 
Sbjct: 29  KGSTKAIERTSNPEWNQVFAFSKDRLQGSTLEVSVWDKDKAK-DDFLGGVCFDLSEVPT 86


>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein
           activator 1 (RasA1).  RasA1 is a GAP1 (GTPase activating
           protein 1), a Ras-specific GAP member, which suppresses
           Ras function by enhancing the GTPase activity of Ras
           proteins resulting in the inactive GDP-bound form of
           Ras.  In this way it can control cellular proliferation
           and differentiation.  RasA1 contains a C2 domain,  a
           Ras-GAP domain, a pleckstrin homology (PH)-like domain,
           a SH3 domain, and 2 SH2 domains. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 126

 Score = 32.3 bits (74), Expect = 0.074
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 117 IRLRIIAGHSLAKKDIFGA--RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKP 174
           ++L ++  H L  K +      I LN V        A TK R+   NPVW+EEF+F   P
Sbjct: 6   LQLNVLEAHKLPVKHVPHPYCVISLNEVK------VARTKVRE-GPNPVWSEEFVFDDLP 58

Query: 175 SE 176
            +
Sbjct: 59  PD 60


>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present
           in Synaptotagmins 14 and 16.  Synaptotagmin 14 and 16
           are membrane-trafficking proteins in specific tissues
           outside the brain.   Both of these contain C-terminal
           tandem C2 repeats, but only Synaptotagmin 14 has an
           N-terminal transmembrane domain and a putative
           fatty-acylation site. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium and
           this is indeed the case here.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 138

 Score = 32.3 bits (74), Expect = 0.084
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 137 IDLNTVNGD-QTIDSALTKTRKKTLNPVWNEEFIFRV---KPSEHKLVFQVFDMNRLTRD 192
           + L  +N D Q I  + T  R+   +P + E F+F+V   + SE  L+F V++  ++ R 
Sbjct: 40  VKLTLLNSDGQEISKSKTSIRRGQPDPEFKETFVFQVALFQLSEVTLMFSVYNKRKMKRK 99

Query: 193 DFLGMVELSL 202
           + +G   L L
Sbjct: 100 EMIGWFSLGL 109


>gnl|CDD|165867 PLN02223, PLN02223, phosphoinositide phospholipase C.
          Length = 537

 Score = 33.5 bits (76), Expect = 0.094
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 4/80 (5%)

Query: 127 LAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLV-FQVFD 185
           L+K D++  RI +  V  D+ I     K  +    P W EEF F +   +  L+ F+V+D
Sbjct: 432 LSKPDLY-VRISIAGVPHDEKIMKTTVKNNEWK--PTWGEEFTFPLTYPDLALISFEVYD 488

Query: 186 MNRLTRDDFLGMVELSLLNL 205
               T D F G   L +  L
Sbjct: 489 YEVSTADAFCGQTCLPVSEL 508


>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated
           by Cold 2 (SRC2)-like proteins.  SRC2 production is a
           response to pathogen infiltration.  The initial response
           of increased Ca2+ concentrations are coupled to
           downstream signal transduction pathways via calcium
           binding proteins.  SRC2 contains a single C2 domain
           which localizes to the plasma membrane and is involved
           in Ca2+ dependent protein binding. C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 125

 Score = 31.8 bits (73), Expect = 0.11
 Identities = 16/68 (23%), Positives = 24/68 (35%), Gaps = 6/68 (8%)

Query: 161 NPVWNEEFIFRVKPSEH-----KLVFQVFDMNRLTRDDFLGMVELSLLNLPRESD-GCVI 214
           NP WNE   F +           L  +V+       D  +G V + L +L   +     +
Sbjct: 46  NPTWNETLRFPLDERLLQQGRLALTIEVYCERPSLGDKLIGEVRVPLKDLLDGASPAGEL 105

Query: 215 HNKKYILR 222
               Y LR
Sbjct: 106 RFLSYQLR 113


>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present
           in Synaptotagmins 14 and 16.  Synaptotagmin 14 and 16
           are membrane-trafficking proteins in specific tissues
           outside the brain.   Both of these contain C-terminal
           tandem C2 repeats, but only Synaptotagmin 14 has an
           N-terminal transmembrane domain and a putative
           fatty-acylation site. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium and
           this is indeed the case here.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 30.7 bits (70), Expect = 0.22
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 7/59 (11%)

Query: 153 TKTRKKTLNPVWNEEFIF-RVKPSE---HKLVFQVFDMNRLTRDDFLG--MVELSLLNL 205
           TK ++   NPV+NE F F RV+P E     L F+++ + R+ ++  +G  +V LS LNL
Sbjct: 55  TKVQRGP-NPVFNETFTFSRVEPEELNNMALRFRLYGVERMRKERLIGEKVVPLSQLNL 112


>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and
          modification].
          Length = 590

 Score = 32.0 bits (72), Expect = 0.24
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 72 WEERTDANGRTYYVNHIARCTQWERP 97
          WEE    +GR YY N     + WE+P
Sbjct: 17 WEELKAPDGRIYYYNKRTGKSSWEKP 42



 Score = 31.6 bits (71), Expect = 0.32
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 71 GWEERTDANGRTYYVNHIARCTQWERP 97
           W+E   A+G+ YY N I R ++W+ P
Sbjct: 57 PWKECRTADGKVYYYNSITRESRWKIP 83


>gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C.
          Length = 599

 Score = 31.9 bits (72), Expect = 0.25
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 149 DSALTKTR--KKTLNPVWNEEFIFRVKPSEHKLV---FQVFDMNRLTRDDFLGMVELSLL 203
           D+A  KT+  +    P WNEEF F +   E  L+    + +DM+   +DDF G   L + 
Sbjct: 511 DNAKKKTKIIEDNWYPAWNEEFSFPLTVPELALLRIEVREYDMSE--KDDFGGQTCLPVS 568

Query: 204 NLPRESDGCVIHNKK 218
            L        +H+KK
Sbjct: 569 ELRPGIRSVPLHDKK 583


>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal Ingression
           1 (Inn1) proteins.  Saccharomyces cerevisiae Inn1
           associates with the contractile actomyosin ring at the
           end of mitosis and is needed for cytokinesis. The C2
           domain of Inn1, located at the N-terminus, is required
           for ingression of the plasma membrane. The C-terminus is
           relatively unstructured and contains eight PXXP motifs
           that are thought to mediate interaction of Inn1 with
           other proteins with SH3 domains in the cytokinesis
           proteins Hof1 (an F-BAR protein) and Cyk3 (whose
           overexpression can restore primary septum formation in
           Inn1Delta cells) as well as recruiting Inn1 to the
           bud-neck by binding to Cyk3. Inn1 and Cyk3 appear to
           cooperate in activating chitin synthase Chs2 for primary
           septum formation, which allows coordination of
           actomyosin ring contraction with ingression of the
           cleavage furrow. It is thought that the C2 domain of
           Inn1 helps to preserve the link between the actomyosin
           ring and the plasma membrane, contributing both to
           membrane ingression, as well as to stability of the
           contracting ring. Additionally, Inn1 might induce
           curvature of the plasma membrane adjacent to the
           contracting ring, thereby promoting ingression of the
           membrane. It has been shown that the C2 domain of human
           synaptotagmin induces curvature in target membranes and
           thereby contributes to fusion of these membranes with
           synaptic vesicles. The C2 domain was first identified in
           PKC. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins. Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain. C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.
          Length = 118

 Score = 30.3 bits (69), Expect = 0.30
 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 9/61 (14%)

Query: 152 LTKTRKKTL-------NPVWNEEFIFRVKPS-EHKLVFQVFDMNRLTRDDFLGMVELSLL 203
           +    KKT        +P W+EE  F +    +  L   VFD ++  + D +G  E+ L 
Sbjct: 30  IGGVTKKTKTDFRGGQHPEWDEELRFEITEDKKPILKVAVFDDDK-RKPDLIGDTEVDLS 88

Query: 204 N 204
            
Sbjct: 89  P 89


>gnl|CDD|177875 PLN02230, PLN02230, phosphoinositide phospholipase C 4.
          Length = 598

 Score = 31.6 bits (71), Expect = 0.35
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 148 IDSALTKTRKK--TLNPVWNEEFIFRVKPSEHKLV-FQVFDMNRLTRDDFLGMVELSLLN 204
           +D  + KT+ +  T  P+WN+EFIF +   E  L+  +V + +   +DDF G   L +  
Sbjct: 509 VDEVMEKTKIEYDTWTPIWNKEFIFPLAVPELALLRVEVHEHDINEKDDFGGQTCLPVSE 568

Query: 205 LPRESDGCVIHNKK 218
           + +      + N+K
Sbjct: 569 IRQGIHAVPLFNRK 582


>gnl|CDD|131102 TIGR02047, CadR-PbrR, Cd(II)/Pb(II)-responsive transcriptional
          regulator.  This model represents the cadmium(II)
          and/or lead(II) responsive transcriptional activator of
          the proteobacterial metal efflux system. This protein
          is a member of the MerR family of transcriptional
          activators (pfam00376) and contains a distinctive
          pattern of cysteine residues in its metal binding loop,
          Cys-X(6-9)-Cys, as well as a conserved and critical
          cysteine at the N-terminal end of the dimerization
          helix.
          Length = 127

 Score = 29.4 bits (66), Expect = 0.64
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 63 EQQGALPPGWEERTDANGRTYYVNHIARCT 92
          E+QG LPP    RTD N R Y V H+ R  
Sbjct: 21 EKQGLLPP--PARTDNNYRVYTVGHVERLA 48


>gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in
           Synaptotagmin-like protein 3.  All Slp members basically
           share an N-terminal Slp homology domain (SHD) and
           C-terminal tandem C2 domains (named the C2A domain and
           the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length. SHD of
           Slp (except for the Slp4-SHD) function as a specific
           Rab27A/B-binding domain.  In addition to Slp, rabphilin,
           Noc2, and  Munc13-4 also function as Rab27-binding
           proteins. Little is known about the expression or
           localization of Slp3.  The C2A domain of Slp3 is Ca2+
           dependent.  It has been demonstrated that Slp3 promotes
           dense-core vesicle exocytosis.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 29.4 bits (66), Expect = 0.69
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE---HKLVFQVFDMNRLTRDDFLGMVELSL 202
           T  +K T+NPV+NE   + V+       +L   V+    L R  FLG V + L
Sbjct: 57  TAVKKGTVNPVFNETLKYVVEADLLSSRQLQVSVWHSRTLKRRVFLGEVLIPL 109


>gnl|CDD|176068 cd08686, C2_ABR, C2 domain in the Active BCR (Breakpoint cluster
           region) Related protein.  The ABR protein is similar to
           the breakpoint cluster region protein.  It has homology
           to guanine nucleotide exchange proteins and
           GTPase-activating proteins (GAPs).  ABR is expressed
           primarily in the brain, but also includes non-neuronal
           tissues such as the heart.  It has been associated with
           human diseases such as Miller-Dieker syndrome in which
           mental retardation and malformations of the heart are
           present.  ABR contains a RhoGEF domain and a PH-like
           domain upstream of its C2 domain and a RhoGAP domain
           downstream of this domain.  A few members also contain a
           Bcr-Abl oncoprotein oligomerization domain at the very
           N-terminal end. Splice variants of ABR have been
           identified. ABR is found in a wide variety of organisms
           including chimpanzee, dog, mouse, rat, fruit fly, and
           mosquito. The C2 domain was first identified in PKC. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 118

 Score = 29.0 bits (65), Expect = 0.87
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 151 ALTKTRKKTLNPVWNEEFIFRVKPSE 176
           A T+  + T  P WNEEF   ++ S+
Sbjct: 33  AKTRVCRDTTEPNWNEEFEIELEGSQ 58


>gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in
           Synaptotagmin 13.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 13, a member of
           class 6 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmins 8 and 12,
           does not have any consensus Ca2+ binding sites.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 138

 Score = 28.4 bits (63), Expect = 1.7
 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%)

Query: 153 TKTRKKTLNPVWNEEFIFRVKPSE 176
           TK  K  +NPVWNE  +F + PSE
Sbjct: 58  TKRAKHKINPVWNEMIMFEL-PSE 80


>gnl|CDD|133378 cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of
          MerR-like transcription regulators.  Helix-turn-helix
          (HTH) MerR-like transcription regulator, N-terminal
          domain. The MerR family transcription regulators have
          been shown to mediate responses to stress including
          exposure to heavy metals, drugs, or oxygen radicals in
          eubacterial and some archaeal species. They regulate
          transcription of multidrug/metal ion transporter genes
          and oxidative stress regulons by reconfiguring the
          spacer between the -35 and -10 promoter elements.  A
          typical MerR regulator is comprised of two distinct
          domains that harbor the regulatory (effector-binding)
          site and the active (DNA-binding) site. Their
          N-terminal domains are homologous and contain a
          DNA-binding winged HTH motif, while the C-terminal
          domains are often dissimilar and bind specific
          coactivator molecules such as metal ions, drugs, and
          organic substrates.
          Length = 100

 Score = 27.6 bits (62), Expect = 1.9
 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 63 EQQGALPPGWEERTDANGRTYYVNHIAR 90
          E++G LPP   ER++   R Y    + R
Sbjct: 21 EEKGLLPP---ERSENGYRLYSEEDLER 45


>gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian
           uncoordinated) proteins.  C2-like domains are thought to
           be involved in phospholipid binding in a Ca2+
           independent manner in both Unc13 and Munc13.
           Caenorabditis elegans Unc13 has a central domain with
           sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins.C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.  This cd contains the third C2 repeat, C2C, and
           has a type-II topology.
          Length = 120

 Score = 27.7 bits (62), Expect = 2.1
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 153 TKTRKKTLNPVWNEEFIF----RVKPSEHKLVFQVFDMNRLTRDDFL-GMVELSLLNL 205
           TK++    +P +NE F F       P  ++L   V D     RDD L G+  L L ++
Sbjct: 42  TKSKNNNWSPKYNETFQFILGNEDDPESYELHICVKDYC-FARDDRLVGVTVLQLRDI 98


>gnl|CDD|176074 cd08692, C2B_Tac2-N, C2 domain second repeat found in Tac2-N
           (Tandem C2 protein in Nucleus).  Tac2-N contains two C2
           domains and a short C-terminus including a WHXL motif,
           which are key in stabilizing transport vesicles to the
           plasma membrane by binding to a plasma membrane.
           However unlike the usual carboxyl-terminal-type (C-type)
           tandem C2 proteins, it lacks a transmembrane domain, a
           Slp-homology domain, and a Munc13-1-interacting domain.
           Homology search analysis indicate that no known protein
           motifs are located in its N-terminus, making Tac2-N a
           novel class of Ca2+-independent, C-type tandem C2
           proteins. The C2 domain was first identified in PKC. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 135

 Score = 27.6 bits (61), Expect = 2.9
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 153 TKTRKKTLNPV-WNEEFIFRVKPSEHKLVFQV--FDMNRLTRDDFLGMVELSL 202
           T+  K +   V W E  IF V   EH + F +  +  + + R  FLG V +S 
Sbjct: 55  TRLVKSSNGQVKWGETMIFPVTQQEHGIQFLIKLYSRSSVRRKHFLGQVWISS 107


>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein
           Signaling (RGS) family.  This CD contains members of the
           regulator of G-protein signaling (RGS) family. RGS is a
           GTPase activating protein which inhibits G-protein
           mediated signal transduction. The protein is largely
           cytosolic, but G-protein activation leads to
           translocation of this protein to the plasma membrane. A
           nuclear form of this protein has also been described,
           but its sequence has not been identified. There are
           multiple alternatively spliced transcript variants in
           this family with some members having additional domains
           (ex. PDZ and RGS) downstream of the C2 domain. The C2
           domain was first identified in PKC. C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.
          Length = 119

 Score = 27.4 bits (61), Expect = 3.3
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 153 TKTRKKTLNPVWNEEFIFRV-KPSEHK-LVFQVFDMNRLTRDDFL 195
           T T   + NP+++E F F V +    K L+  V++    +RD  L
Sbjct: 52  TSTVPDSANPLFHETFSFDVNERDYQKRLLVTVWNKLSKSRDSGL 96


>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in
           Synaptotagmin 15.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. It is thought to be involved in
           the trafficking and exocytosis of secretory vesicles in
           non-neuronal tissues and is Ca2+ independent. Human
           synaptotagmin 15 has 2 alternatively spliced forms that
           encode proteins with different C-termini.  The larger,
           SYT15a, contains a N-terminal TM region, a putative
           fatty-acylation site, and 2 tandem C terminal C2
           domains.  The smaller, SYT15b, lacks the C-terminal
           portion of the second C2 domain.  Unlike most other
           synaptotagmins it is nearly absent in the brain and
           rather is found in the heart, lungs, skeletal muscle,
           and testis.  Previously all synaptotagmins were thought
           to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 137

 Score = 27.3 bits (61), Expect = 3.8
 Identities = 9/44 (20%), Positives = 17/44 (38%), Gaps = 3/44 (6%)

Query: 143 NGDQTIDSALTKTRKKTLNPVWNEEFIFRVKP---SEHKLVFQV 183
             ++ + +  T+      +P +NE F F+V         L   V
Sbjct: 45  IHNKVVKTKKTEVVDGAASPSFNESFSFKVTSRQLDTASLSLSV 88


>gnl|CDD|176059 cd08677, C2A_Synaptotagmin-13, C2 domain.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 13, a member of
           class 6 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmins 8 and 12,
           does not have any consensus Ca2+ binding sites.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This CD contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 118

 Score = 27.2 bits (60), Expect = 4.0
 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%)

Query: 151 ALTKTRKKTLNPVWNEEFIFRVKPSEH---KLVFQVFDMNRLTRDDFLGMVELSLLNL 205
           A T  +K  L+  W EE +F +   E     L   +   +R +R   LG + L L ++
Sbjct: 49  AQTALKKLALHTQWEEELVFPLPEEESLDGTLTLTLRCCDRFSRHSTLGELRLKLADV 106


>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian
           uncoordinated) proteins.  C2-like domains are thought to
           be involved in phospholipid binding in a Ca2+
           independent manner in both Unc13 and Munc13.
           Caenorabditis elegans Unc13 has a central domain with
           sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.  This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 127

 Score = 27.0 bits (60), Expect = 5.1
 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 162 PVWNEEFIFRVKPSEHKLVFQVFDMNR-LTRDDFLGMVELSL 202
           P W ++F+F +   +  LV ++   N+ L  D  +G V + L
Sbjct: 43  PCWEQDFMFEINRLDLGLVIEL--WNKGLIWDTLVGTVWIPL 82


>gnl|CDD|178712 PLN03168, PLN03168, chalcone synthase; Provisional.
          Length = 389

 Score = 27.3 bits (60), Expect = 7.0
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 146 QTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLG 196
           + I+  L + RK   +P WNE F + V P    ++ QV    +LT+D   G
Sbjct: 276 KNIEKFLNEARKCVGSPDWNEMF-WAVHPGGPAILDQVEAKLKLTKDKMQG 325


>gnl|CDD|179433 PRK02496, adk, adenylate kinase; Provisional.
          Length = 184

 Score = 27.0 bits (60), Expect = 7.0
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 131 DIFGARIDLNTVNGDQTIDSALTKTRKKTLNP 162
           D +  R  L T++G+Q+++ A+T   K  L P
Sbjct: 154 DYYRDRQKLLTIDGNQSVE-AVTTELKAALAP 184


>gnl|CDD|176073 cd08691, C2_NEDL1-like, C2 domain present in NEDL1 (NEDD4-like
           ubiquitin protein ligase-1).  NEDL1 (AKA  HECW1(HECT, C2
           and WW domain containing E3 ubiquitin protein ligase 1))
           is a newly identified HECT-type E3 ubiquitin protein
           ligase highly expressed in favorable neuroblastomas. In
           vertebrates it is found primarily in neuronal tissues,
           including the spinal cord. NEDL1 is thought to normally
           function in the quality control of cellular proteins by
           eliminating misfolded proteins.  This is thought to be
           accomplished via a mechanism analogous to that of
           ER-associated degradation by forming tight complexes and
           aggregating misfolded proteins that have escaped
           ubiquitin-mediated degradation.  NEDL1, is composed of a
           C2 domain, two WW domains, and a ubiquitin ligase Hect
           domain. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins.  Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions.
          Length = 137

 Score = 26.6 bits (59), Expect = 8.0
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 153 TKTRKKTLNPVW-NEEFIFRVKPSEHKLVFQV---FDMNRLTRDDFLG 196
           T   + T+NPVW  E+F+F   P++  L  +V   F  +R     FLG
Sbjct: 49  TSIVENTINPVWHREQFVFVGLPTD-VLEIEVKDKFAKSRPIIRRFLG 95


>gnl|CDD|235653 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II;
           Reviewed.
          Length = 381

 Score = 26.9 bits (60), Expect = 8.3
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 50  VETPAQPLFIGGVEQQGALPP 70
           VE P  PL + G +Q GAL  
Sbjct: 173 VEAPITPLTLAGFQQMGALAK 193


>gnl|CDD|222580 pfam14180, DOCK_C2, GTP-GDP exchange factor.  Dock proteins are
           atypical GTP-GDP exchange factors for the small GTPases
           Pac and Cdc42, and are implicated in biological roles
           related to cell-migration and phagocytosis.
          Length = 178

 Score = 26.6 bits (59), Expect = 8.9
 Identities = 15/68 (22%), Positives = 28/68 (41%), Gaps = 12/68 (17%)

Query: 161 NPVWNEEFIFRV---KPSEHKLVFQVFD----MNRLTRDDFLGMVELSLLNLPRESDGCV 213
           NP +N+EF  ++       H L+F  +       +   +  +G   L LL+      G  
Sbjct: 70  NPQFNDEFKLQLPLDLTPGHHLLFTFYHVSVKKKKKKVETPIGYAFLPLLD-----KGGF 124

Query: 214 IHNKKYIL 221
           I + ++ L
Sbjct: 125 IRDGEHTL 132


>gnl|CDD|131404 TIGR02351, thiH, thiazole biosynthesis protein ThiH.  Members this
           protein family are the ThiH protein of thiamine
           biosynthesis, a homolog of the BioB protein of biotin
           biosynthesis. Genes for the this protein generally are
           found in operons with other thiamin biosynthesis genes
           [Biosynthesis of cofactors, prosthetic groups, and
           carriers, Thiamine].
          Length = 366

 Score = 26.9 bits (60), Expect = 10.0
 Identities = 10/45 (22%), Positives = 20/45 (44%), Gaps = 5/45 (11%)

Query: 122 IAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNE 166
             G+S  KK +     +   ++ ++++       R K L PVW +
Sbjct: 323 PGGYSSEKKGL-----EQFEISDERSVAEVEEDLRSKGLQPVWKD 362


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0779    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 11,467,252
Number of extensions: 1044740
Number of successful extensions: 979
Number of sequences better than 10.0: 1
Number of HSP's gapped: 929
Number of HSP's successfully gapped: 116
Length of query: 225
Length of database: 10,937,602
Length adjustment: 93
Effective length of query: 132
Effective length of database: 6,812,680
Effective search space: 899273760
Effective search space used: 899273760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (25.6 bits)