Query         psy8352
Match_columns 69
No_of_seqs    47 out of 49
Neff          2.8 
Searched_HMMs 46136
Date          Sat Aug 17 01:31:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8352.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8352hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3175|consensus               76.9    0.52 1.1E-05   37.8  -1.0   37    3-42     75-111 (366)
  2 PF13221 DUF4029:  Protein of u  75.7     2.1 4.5E-05   28.8   1.8   31   20-50     49-79  (96)
  3 PF06371 Drf_GBD:  Diaphanous G  72.2     2.3   5E-05   27.7   1.3   39   11-49    147-185 (187)
  4 cd00020 ARM Armadillo/beta-cat  46.6       4 8.7E-05   23.5  -0.9   43   20-62     47-89  (120)
  5 PRK03692 putative UDP-N-acetyl  40.3      19 0.00041   26.4   1.6   24   24-50    212-235 (243)
  6 cd06533 Glyco_transf_WecG_TagA  37.7      16 0.00034   24.8   0.8   15   24-38    154-168 (171)
  7 PF03808 Glyco_tran_WecB:  Glyc  28.4      33 0.00072   23.1   1.2   14   24-37    156-169 (172)
  8 TIGR00696 wecB_tagA_cpsF bacte  28.3      31 0.00067   24.0   1.0   13   24-36    155-167 (177)
  9 PF00075 RNase_H:  RNase H;  In  27.1      38 0.00083   20.5   1.2   10    5-14      2-11  (132)
 10 smart00328 BPI1 BPI/LBP/CETP N  25.5 1.3E+02  0.0028   21.0   3.7   34   23-65    142-175 (225)
 11 PF08514 STAG:  STAG domain  ;   22.2      42 0.00091   22.0   0.7   16   22-37     46-61  (118)
 12 PF05991 NYN_YacP:  YacP-like N  21.7      33 0.00072   23.4   0.2   19    9-28      1-19  (166)
 13 PF11842 DUF3362:  Domain of un  21.3      70  0.0015   22.8   1.7   23   43-67     47-69  (150)
 14 COG1758 RpoZ DNA-directed RNA   20.7      81  0.0018   19.1   1.7   46   21-67      3-55  (74)
 15 PF04938 SIP1:  Survival motor   20.4      92   0.002   21.8   2.2   27   22-48    169-206 (233)
 16 PF03634 TCP:  TCP family trans  20.4      58  0.0013   21.4   1.1   17   14-30     38-54  (138)

No 1  
>KOG3175|consensus
Probab=76.94  E-value=0.52  Score=37.81  Aligned_cols=37  Identities=32%  Similarity=0.390  Sum_probs=31.5

Q ss_pred             ccceeeEEEecccccccCchhhhhHHHHhhcchhHHHHHH
Q psy8352           3 TLGQVMLYVDGMTGIMDHPPTVQWLYVLVASKFRLVIKTA   42 (69)
Q Consensus         3 Algqiml~VDGMngvi~h~~tvqwLY~L~~S~frlVvKta   42 (69)
                      +=.||.--+|||||+   +-|+||+..|+..++|.|-++=
T Consensus        75 ~k~~~~~~~~~~n~~---~~t~~~~~e~li~p~~nv~~~d  111 (366)
T KOG3175|consen   75 MKERILKIVTGFNGI---PFTIQRLCELLIDPRRNVTGTD  111 (366)
T ss_pred             HHHhhhhhhhhccCC---CHHHHHHHHHhcCcccccCcch
Confidence            345777889999997   7899999999999999987653


No 2  
>PF13221 DUF4029:  Protein of unknown function (DUF4029)
Probab=75.68  E-value=2.1  Score=28.77  Aligned_cols=31  Identities=16%  Similarity=0.324  Sum_probs=28.0

Q ss_pred             CchhhhhHHHHhhcchhHHHHHHHhhhhhee
Q psy8352          20 HPPTVQWLYVLVASKFRLVIKTALKLLLIFV   50 (69)
Q Consensus        20 h~~tvqwLY~L~~S~frlVvKtaLkLLLVfv   50 (69)
                      -||..||++++..-|+..++-.+.-.-.|||
T Consensus        49 lnelf~wi~sf~l~k~gnivlq~icayivfv   79 (96)
T PF13221_consen   49 LNELFQWIHSFELMKLGNIVLQVICAYIVFV   79 (96)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4789999999999999999999988888886


No 3  
>PF06371 Drf_GBD:  Diaphanous GTPase-binding Domain;  InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division []. Drf proteins are characterised by a variety of shared domains: an N-terminal GTPase-binding domain (GBD), formin-homology domains FH1, FH2 (IPR003104 from INTERPRO) and FH3 (IPR010472 from INTERPRO), and a C-terminal conserved Dia-autoregulatory domain (DAD) that binds the GBD. This entry represents the GBD, which is a bifunctional autoinhibitory domain that interacts with and is regulated by activated Rho family members. Mammalian Drf3 contains a CRIB-like motif within its GBD for binding to Cdc42, which is required for Cdc42 to activate and guide Drf3 towards the cell cortex where it remodels the actin skeleton [].; GO: 0003779 actin binding, 0017048 Rho GTPase binding, 0030036 actin cytoskeleton organization; PDB: 3OBV_A 2BNX_A 3EG5_D 2BAP_B 3O4X_B 1Z2C_B 2F31_A.
Probab=72.24  E-value=2.3  Score=27.72  Aligned_cols=39  Identities=23%  Similarity=0.336  Sum_probs=32.9

Q ss_pred             EecccccccCchhhhhHHHHhhcchhHHHHHHHhhhhhe
Q psy8352          11 VDGMTGIMDHPPTVQWLYVLVASKFRLVIKTALKLLLIF   49 (69)
Q Consensus        11 VDGMngvi~h~~tvqwLY~L~~S~frlVvKtaLkLLLVf   49 (69)
                      =.|+..+++|++.+..|-....|+.-.+-+.|+++|.++
T Consensus       147 ~~G~~~v~~~~~~v~~i~~~L~s~~~~~r~~~leiL~~l  185 (187)
T PF06371_consen  147 KYGLEAVLSHPDSVNLIALSLDSPNIKTRKLALEILAAL  185 (187)
T ss_dssp             HHHHHHHHCSSSHHHHHHHT--TTSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHcCcHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Confidence            368899999999999999999999888999999998764


No 4  
>cd00020 ARM Armadillo/beta-catenin-like repeats. An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model.
Probab=46.59  E-value=4  Score=23.52  Aligned_cols=43  Identities=23%  Similarity=0.179  Sum_probs=33.0

Q ss_pred             CchhhhhHHHHhhcchhHHHHHHHhhhhheeeeeccchHHHHH
Q psy8352          20 HPPTVQWLYVLVASKFRLVIKTALKLLLIFVEYVESNCFLLIQ   62 (69)
Q Consensus        20 h~~tvqwLY~L~~S~frlVvKtaLkLLLVfveY~EsN~~lli~   62 (69)
                      ..+.++.+-.+..++...+.+.|+..|--+.+..+.+...+++
T Consensus        47 ~~~~i~~l~~~l~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~   89 (120)
T cd00020          47 EAGGLPALVQLLKSEDEEVVKAALWALRNLAAGPEDNKLIVLE   89 (120)
T ss_pred             HCCChHHHHHHHhCCCHHHHHHHHHHHHHHccCcHHHHHHHHH
Confidence            3477888888888888889999999988888777665555443


No 5  
>PRK03692 putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional
Probab=40.27  E-value=19  Score=26.41  Aligned_cols=24  Identities=33%  Similarity=0.836  Sum_probs=18.1

Q ss_pred             hhhHHHHhhcchhHHHHHHHhhhhhee
Q psy8352          24 VQWLYVLVASKFRLVIKTALKLLLIFV   50 (69)
Q Consensus        24 vqwLY~L~~S~frlVvKtaLkLLLVfv   50 (69)
                      +.|||+|...|-|+  |.-+. +..|+
T Consensus       212 LEWlyRl~~EP~R~--~R~~~-~~~F~  235 (243)
T PRK03692        212 LEWLYRLLSQPSRI--RRQLR-LLRYL  235 (243)
T ss_pred             hHHHHHhHhCcHHH--HHHHH-HHHHH
Confidence            57999999999995  77665 34553


No 6  
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
Probab=37.75  E-value=16  Score=24.78  Aligned_cols=15  Identities=40%  Similarity=0.791  Sum_probs=12.8

Q ss_pred             hhhHHHHhhcchhHH
Q psy8352          24 VQWLYVLVASKFRLV   38 (69)
Q Consensus        24 vqwLY~L~~S~frlV   38 (69)
                      +.|||++...|.||.
T Consensus       154 lEWlyRl~~eP~Rl~  168 (171)
T cd06533         154 LEWLYRLLQEPRRLW  168 (171)
T ss_pred             chhHHhhhhCcchhh
Confidence            469999999999863


No 7  
>PF03808 Glyco_tran_WecB:  Glycosyl transferase WecB/TagA/CpsF family;  InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.; GO: 0009058 biosynthetic process
Probab=28.41  E-value=33  Score=23.14  Aligned_cols=14  Identities=43%  Similarity=0.907  Sum_probs=12.2

Q ss_pred             hhhHHHHhhcchhH
Q psy8352          24 VQWLYVLVASKFRL   37 (69)
Q Consensus        24 vqwLY~L~~S~frl   37 (69)
                      +.|||++...|.|+
T Consensus       156 lEWlyRl~~eP~Rl  169 (172)
T PF03808_consen  156 LEWLYRLLQEPKRL  169 (172)
T ss_pred             cHHHHHHHhChHhh
Confidence            57999999999886


No 8  
>TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway.
Probab=28.34  E-value=31  Score=24.02  Aligned_cols=13  Identities=38%  Similarity=0.940  Sum_probs=12.0

Q ss_pred             hhhHHHHhhcchh
Q psy8352          24 VQWLYVLVASKFR   36 (69)
Q Consensus        24 vqwLY~L~~S~fr   36 (69)
                      +.|||.|...|.|
T Consensus       155 LEWlyRl~~eP~R  167 (177)
T TIGR00696       155 LEWLYRLRMEPWR  167 (177)
T ss_pred             chHHHHhhhCcHH
Confidence            5799999999999


No 9  
>PF00075 RNase_H:  RNase H;  InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site. This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids.  The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....
Probab=27.08  E-value=38  Score=20.45  Aligned_cols=10  Identities=30%  Similarity=0.826  Sum_probs=7.5

Q ss_pred             ceeeEEEecc
Q psy8352           5 GQVMLYVDGM   14 (69)
Q Consensus         5 gqiml~VDGM   14 (69)
                      .++.+|+||=
T Consensus         2 ~~~~iytDgS   11 (132)
T PF00075_consen    2 KAIIIYTDGS   11 (132)
T ss_dssp             TSEEEEEEEE
T ss_pred             CcEEEEEeCC
Confidence            3678888886


No 10 
>smart00328 BPI1 BPI/LBP/CETP N-terminal domain. Bactericidal permeability-increasing protein (BPI) / Lipopolysaccharide-binding protein (LBP) / Cholesteryl ester transfer protein (CETP) N-terminal domain
Probab=25.48  E-value=1.3e+02  Score=20.96  Aligned_cols=34  Identities=21%  Similarity=0.366  Sum_probs=25.8

Q ss_pred             hhhhHHHHhhcchhHHHHHHHhhhhheeeeeccchHHHHHHHH
Q psy8352          23 TVQWLYVLVASKFRLVIKTALKLLLIFVEYVESNCFLLIQAVH   65 (69)
Q Consensus        23 tvqwLY~L~~S~frlVvKtaLkLLLVfveY~EsN~~lli~Av~   65 (69)
                      ...|||.+....+.--+|.+|+=.+         ||.+-+++.
T Consensus       142 ~~swl~n~f~~~i~~~i~~~l~~~I---------C~~i~~~i~  175 (225)
T smart00328      142 VLGWLINLFRKFIENTLRNVLEGQI---------CPVIDSAVS  175 (225)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHH
Confidence            6899999988777777777776544         777777764


No 11 
>PF08514 STAG:  STAG domain  ;  InterPro: IPR013721 STAG domain proteins are subunits of cohesin complex - a protein complex required for sister chromatid cohesion in eukaryotes. The STAG domain is present in Schizosaccharomyces pombe (Fission yeast) mitotic cohesin Psc3, and the meiosis specific cohesin Rec11. Many organisms express a meiosis-specific STAG protein, for example, mice and humans have a meiosis specific variant called STAG3, although budding yeast does not have a meiosis specific version []. 
Probab=22.19  E-value=42  Score=22.03  Aligned_cols=16  Identities=38%  Similarity=0.615  Sum_probs=12.9

Q ss_pred             hhhhhHHHHhhcchhH
Q psy8352          22 PTVQWLYVLVASKFRL   37 (69)
Q Consensus        22 ~tvqwLY~L~~S~frl   37 (69)
                      ..+.||-+|++|+.|-
T Consensus        46 ~l~~wl~~lS~S~~R~   61 (118)
T PF08514_consen   46 NLISWLTALSSSKVRP   61 (118)
T ss_pred             HHHHHHHHhccCCcee
Confidence            5789999999996543


No 12 
>PF05991 NYN_YacP:  YacP-like NYN domain;  InterPro: IPR010298 This family consists of several hypothetical bacterial proteins as well as some uncharacterised sequences from Arabidopsis thaliana. The function of this family is unknown.
Probab=21.73  E-value=33  Score=23.41  Aligned_cols=19  Identities=26%  Similarity=0.490  Sum_probs=13.0

Q ss_pred             EEEecccccccCchhhhhHH
Q psy8352           9 LYVDGMTGIMDHPPTVQWLY   28 (69)
Q Consensus         9 l~VDGMngvi~h~~tvqwLY   28 (69)
                      |.|||+| ||.+.+-+.++.
T Consensus         1 LlIDGYN-li~~~~~l~~~~   19 (166)
T PF05991_consen    1 LLIDGYN-LIHAWPELRSLA   19 (166)
T ss_pred             CeEcchh-hhCCCHHHHhhc
Confidence            5799999 455555566655


No 13 
>PF11842 DUF3362:  Domain of unknown function (DUF3362);  InterPro: IPR024560 This domain tends to occur to the C terminus of a radical SAM domain (PF04055 from PFAM) in members of the uncharacterised protein family UPF0313. Radical SAM proteins catalyse diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation. Evidence exists that these proteins generate a radical species by reductive cleavage of S:-adenosylmethionine (SAM) through an unusual Fe-S centre [, ].
Probab=21.31  E-value=70  Score=22.77  Aligned_cols=23  Identities=26%  Similarity=0.244  Sum_probs=18.4

Q ss_pred             HhhhhheeeeeccchHHHHHHHHhh
Q psy8352          43 LKLLLIFVEYVESNCFLLIQAVHAI   67 (69)
Q Consensus        43 LkLLLVfveY~EsN~~lli~Av~~v   67 (69)
                      =|.||-|  +...|++++.+|....
T Consensus        47 qkAll~Y--~~PeN~~lvreAL~~~   69 (150)
T PF11842_consen   47 QKALLRY--HDPENWPLVREALKKM   69 (150)
T ss_pred             HHHHHhh--cChhhHHHHHHHHHHh
Confidence            3567777  7889999999998753


No 14 
>COG1758 RpoZ DNA-directed RNA polymerase, subunit K/omega [Transcription]
Probab=20.68  E-value=81  Score=19.15  Aligned_cols=46  Identities=30%  Similarity=0.325  Sum_probs=28.1

Q ss_pred             chhhhhHHHHhhcchhHHH---HHHHhhhhhe---eeeeccc-hHHHHHHHHhh
Q psy8352          21 PPTVQWLYVLVASKFRLVI---KTALKLLLIF---VEYVESN-CFLLIQAVHAI   67 (69)
Q Consensus        21 ~~tvqwLY~L~~S~frlVv---KtaLkLLLVf---veY~EsN-~~lli~Av~~v   67 (69)
                      +.+++-+.....|+|++|+   |.|+.+----   ++ .+.| -..+..|.+.+
T Consensus         3 ~~~~~~l~~~~~~ryelv~~aa~RA~Ql~~ga~~~~~-~~~~~~kpv~iAl~Ei   55 (74)
T COG1758           3 RPTIEDLLDKVGNRYELVVVAAKRARQLAAGAPPLVD-DEENKDKPVVIALREI   55 (74)
T ss_pred             ccCHHHHHhhccCHHHHHHHHHHHHHHHHcCCCCccc-cccccCChHHHHHHHH
Confidence            3578889999999998875   6666664321   11 2233 44455565544


No 15 
>PF04938 SIP1:  Survival motor neuron (SMN) interacting protein 1 (SIP1); PDB: 3S6N_2.
Probab=20.42  E-value=92  Score=21.76  Aligned_cols=27  Identities=37%  Similarity=0.562  Sum_probs=21.3

Q ss_pred             hhhhhHHHHhh-----------cchhHHHHHHHhhhhh
Q psy8352          22 PTVQWLYVLVA-----------SKFRLVIKTALKLLLI   48 (69)
Q Consensus        22 ~tvqwLY~L~~-----------S~frlVvKtaLkLLLV   48 (69)
                      ..-||||.|..           |--|-++|...++---
T Consensus       169 ~~~~WlyaLLa~ld~pL~~d~~s~LR~LaR~C~~lR~~  206 (233)
T PF04938_consen  169 NLSQWLYALLARLDKPLDADTCSSLRSLARKCAKLRAK  206 (233)
T ss_dssp             HHHHHHHHHHHH--SS--HHHHHHHHHHHHHHHHHGGG
T ss_pred             HHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHh
Confidence            47899999974           5678889988887654


No 16 
>PF03634 TCP:  TCP family transcription factor;  InterPro: IPR005333 The TCP transcription factor family was named after: teosinte branched 1 (tb1, Zea mays (Maize)) [], cycloidea (cyc) (Antirrhinum majus) (Garden snapdragon) [] and PCF in rice (Oryza sativa) [, ]. The TCP proteins code for structurally related proteins implicated in the evolution of key morphological traits []. However, the biochemical function of CYC and TB1 proteins remains to be demonstrated. One of the conserved regions is predicted to form a non-canonical basic-Helix-Loop-Helix (bHLP) structure. This domain is also found in two rice DNA-binding proteins, PCF1 and PCF2, where it has been shown to be involved in DNA-binding and dimerization. This family of transcription factors are exclusive to higher plants. They can be divided into two groups, TCP-C and TCP-P, that appear to have separated following an early gene duplication event []. This duplication event may have led to functional divergence and it has been proposed that that the TCP-P subfamily are transcriptional repressors, while the TPC-C subfamily are transcription activators [].
Probab=20.40  E-value=58  Score=21.39  Aligned_cols=17  Identities=35%  Similarity=0.604  Sum_probs=14.4

Q ss_pred             ccccccCchhhhhHHHH
Q psy8352          14 MTGIMDHPPTVQWLYVL   30 (69)
Q Consensus        14 Mngvi~h~~tvqwLY~L   30 (69)
                      |-|.-.-..||.||.+-
T Consensus        38 mLGfDKaSKTveWLL~k   54 (138)
T PF03634_consen   38 MLGFDKASKTVEWLLTK   54 (138)
T ss_pred             HhcCCCCCchHHHHHHh
Confidence            67888889999999854


Done!