Diaphorina citri psyllid: psy8352


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------7
MRTLGQVMLYVDGMTGIMDHPPTVQWLYVLVASKFRLVIKTALKLLLIFVEYVESNCFLLIQAVHAILS
ccccHHHEEEECcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcc
*RTLGQVMLYVDGMTGIMDHPPTVQWLYVLVASKFRLVIKTALKLLLIFVEYVESNCFLLIQAVHAI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTLGQVMLYVDGMTGIMDHPPTVQWLYVLVASKFRLVIKTALKLLLIFVEYVESNCFLLIQAVHAILS

Function Prediction

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0030837 [BP]negative regulation of actin filament polymerizationprobableGO:0033043, GO:0051129, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0065008, GO:0031333, GO:0032970, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0009987, GO:0048523
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0051496 [BP]positive regulation of stress fiber assemblyprobableGO:0051130, GO:0032231, GO:0032233, GO:0033043, GO:0051493, GO:0051495, GO:0032970, GO:0010638, GO:0051492, GO:0050794, GO:0044087, GO:0065007, GO:0032956, GO:0048518, GO:0008150, GO:0051128, GO:0050789, GO:0048522
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DAD, chain A
Confidence level:very confident
Coverage over the Query: 1-68
View the alignment between query and template
View the model in PyMOL