Query         psy836
Match_columns 122
No_of_seqs    128 out of 296
Neff          3.4 
Searched_HMMs 46136
Date          Fri Aug 16 16:40:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy836.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/836hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0402|consensus              100.0 2.8E-46 6.1E-51  266.3   6.0   92    6-122     1-92  (92)
  2 PF01780 Ribosomal_L37ae:  Ribo 100.0 1.4E-45   3E-50  262.5   8.2   90    7-121     1-90  (90)
  3 PTZ00255 60S ribosomal protein 100.0   2E-45 4.3E-50  261.7   8.8   90    6-120     1-90  (90)
  4 TIGR00280 L37a ribosomal prote 100.0 4.8E-45   1E-49  260.2   9.3   91    6-122     1-91  (91)
  5 PRK03976 rpl37ae 50S ribosomal 100.0 1.5E-44 3.3E-49  257.2   8.7   89    6-119     1-89  (90)
  6 COG1997 RPL43A Ribosomal prote 100.0 2.6E-38 5.6E-43  225.2   7.4   88    6-119     1-88  (89)
  7 PRK03976 rpl37ae 50S ribosomal  97.2   4E-05 8.7E-10   55.1  -1.2   25   65-89     60-84  (90)
  8 TIGR00280 L37a ribosomal prote  97.2 3.6E-05 7.7E-10   55.5  -1.6   25   65-89     59-83  (91)
  9 PTZ00255 60S ribosomal protein  97.2 4.1E-05 8.9E-10   55.0  -1.5   25   65-89     60-84  (90)
 10 PF01780 Ribosomal_L37ae:  Ribo  97.2   3E-05 6.6E-10   55.7  -2.3   27   63-89     57-83  (90)
 11 KOG0402|consensus               96.8 0.00019 4.1E-09   52.0  -1.4   25   65-89     60-84  (92)
 12 PF12760 Zn_Tnp_IS1595:  Transp  95.8   0.007 1.5E-07   37.4   2.1   27   41-67     18-45  (46)
 13 TIGR03655 anti_R_Lar restricti  94.7   0.027 5.9E-07   35.7   2.3   25   43-67      3-34  (53)
 14 PRK00398 rpoP DNA-directed RNA  94.4   0.023 5.1E-07   34.9   1.4   29   40-68      2-30  (46)
 15 PF08271 TF_Zn_Ribbon:  TFIIB z  94.3   0.028 6.1E-07   34.1   1.6   33   42-74      1-34  (43)
 16 PRK00432 30S ribosomal protein  93.9   0.028   6E-07   36.1   1.1   26   42-68     21-46  (50)
 17 PHA00626 hypothetical protein   93.1   0.055 1.2E-06   36.6   1.5   33   43-75      2-39  (59)
 18 PF07282 OrfB_Zn_ribbon:  Putat  93.1   0.063 1.4E-06   34.6   1.8   28   41-68     28-55  (69)
 19 PRK00464 nrdR transcriptional   92.2   0.091   2E-06   40.5   1.9   24   42-69      1-38  (154)
 20 PF14354 Lar_restr_allev:  Rest  91.8   0.037   8E-07   35.1  -0.5   15   42-56      4-18  (61)
 21 PF08273 Prim_Zn_Ribbon:  Zinc-  91.7    0.12 2.7E-06   32.0   1.7   30   42-72      4-38  (40)
 22 COG4888 Uncharacterized Zn rib  91.5   0.073 1.6E-06   39.5   0.7   25   28-52      9-33  (104)
 23 COG1997 RPL43A Ribosomal prote  91.4   0.022 4.9E-07   41.2  -2.1   22   65-86     59-80  (89)
 24 PRK04023 DNA polymerase II lar  90.8    0.16 3.4E-06   49.6   2.4   67   39-119   624-697 (1121)
 25 smart00661 RPOL9 RNA polymeras  90.4    0.23   5E-06   30.2   2.1   32   43-74      2-35  (52)
 26 COG0675 Transposase and inacti  90.3    0.17 3.7E-06   38.9   1.7   22   42-68    310-331 (364)
 27 PRK09710 lar restriction allev  88.5    0.12 2.7E-06   35.3  -0.2   19   43-61      8-26  (64)
 28 COG1998 RPS31 Ribosomal protei  88.5    0.22 4.9E-06   32.9   1.0   30   39-68     17-46  (51)
 29 COG2956 Predicted N-acetylgluc  88.3    0.52 1.1E-05   41.6   3.4   37   26-67    340-376 (389)
 30 PF08646 Rep_fac-A_C:  Replicat  87.8    0.61 1.3E-05   34.0   3.1   33   43-76     20-54  (146)
 31 PF11781 RRN7:  RNA polymerase   87.8     0.3 6.4E-06   29.5   1.2   27   41-68      8-34  (36)
 32 PRK14892 putative transcriptio  87.5    0.17 3.7E-06   36.7  -0.0   34   33-67     13-50  (99)
 33 PRK14890 putative Zn-ribbon RN  87.2    0.34 7.4E-06   32.7   1.3   14   39-52     23-36  (59)
 34 PRK00423 tfb transcription ini  86.9     0.4 8.7E-06   39.6   1.9   39   34-72      4-43  (310)
 35 PF04981 NMD3:  NMD3 family ;    86.8    0.72 1.6E-05   36.7   3.2   53   44-102     1-53  (236)
 36 PRK14714 DNA polymerase II lar  86.6    0.52 1.1E-05   47.0   2.7   32   87-119   712-743 (1337)
 37 PF05129 Elf1:  Transcription e  85.7       1 2.3E-05   31.2   3.2   18   34-51     15-33  (81)
 38 smart00834 CxxC_CXXC_SSSS Puta  85.5    0.62 1.3E-05   27.0   1.7   27   41-67      5-34  (41)
 39 smart00531 TFIIE Transcription  85.4    0.45 9.8E-06   35.4   1.3   32   38-69     96-133 (147)
 40 PF03833 PolC_DP2:  DNA polymer  85.3    0.26 5.6E-06   47.3   0.0   66   39-118   653-725 (900)
 41 PRK11823 DNA repair protein Ra  84.5    0.42 9.1E-06   41.5   0.9   32   38-79      4-35  (446)
 42 PF05605 zf-Di19:  Drought indu  83.3    0.57 1.2E-05   29.4   0.9   12   41-53      2-13  (54)
 43 PF08772 NOB1_Zn_bind:  Nin one  83.3    0.75 1.6E-05   31.8   1.6   22   39-60     22-43  (73)
 44 TIGR00416 sms DNA repair prote  82.5    0.58 1.2E-05   40.8   1.0   32   38-79      4-35  (454)
 45 PRK12366 replication factor A;  82.4    0.86 1.9E-05   41.5   2.1   23   44-68    535-557 (637)
 46 PF07191 zinc-ribbons_6:  zinc-  82.2     1.5 3.3E-05   30.4   2.8   26   43-70      3-28  (70)
 47 PHA02942 putative transposase;  81.9    0.72 1.6E-05   39.6   1.3   26   42-68    326-351 (383)
 48 PF10571 UPF0547:  Uncharacteri  81.8     0.4 8.7E-06   27.2  -0.2   13   82-94     12-24  (26)
 49 cd04476 RPA1_DBD_C RPA1_DBD_C:  80.5     1.3 2.9E-05   32.7   2.1   33   43-76     36-68  (166)
 50 PF13465 zf-H2C2_2:  Zinc-finge  80.3       1 2.3E-05   24.7   1.2   15   36-50      9-23  (26)
 51 smart00659 RPOLCX RNA polymera  80.1     1.1 2.4E-05   28.0   1.4   27   41-69      2-29  (44)
 52 PF12773 DZR:  Double zinc ribb  79.2    0.47   1E-05   28.9  -0.5   27   42-69     13-39  (50)
 53 COG1405 SUA7 Transcription ini  79.1     1.7 3.7E-05   36.4   2.6   35   42-76      2-37  (285)
 54 COG1592 Rubrerythrin [Energy p  79.1    0.96 2.1E-05   35.6   1.1   23   26-50    121-143 (166)
 55 TIGR03831 YgiT_finger YgiT-typ  78.5     4.8  0.0001   23.4   3.8   43   44-95      1-43  (46)
 56 COG1645 Uncharacterized Zn-fin  78.3     1.5 3.3E-05   33.5   1.9   26   41-68     28-53  (131)
 57 KOG2462|consensus               77.1     1.2 2.6E-05   37.9   1.1   68   32-99    177-258 (279)
 58 cd01121 Sms Sms (bacterial rad  76.5     1.3 2.8E-05   37.9   1.2   28   42-79      1-28  (372)
 59 PF07754 DUF1610:  Domain of un  76.4     1.5 3.3E-05   24.8   1.1    9   40-48     15-23  (24)
 60 PF13453 zf-TFIIB:  Transcripti  76.2     3.6 7.8E-05   24.6   2.8   23   43-66      1-26  (41)
 61 PRK14890 putative Zn-ribbon RN  75.9       1 2.3E-05   30.4   0.4   31   38-68      4-34  (59)
 62 PF09855 DUF2082:  Nucleic-acid  75.4       7 0.00015   26.3   4.3   41   42-93      1-45  (64)
 63 COG2888 Predicted Zn-ribbon RN  75.3    0.78 1.7E-05   31.3  -0.3   13   39-51     25-37  (61)
 64 PRK04023 DNA polymerase II lar  74.8     1.7 3.6E-05   42.9   1.6   14   55-68    622-635 (1121)
 65 TIGR01384 TFS_arch transcripti  74.3     1.6 3.5E-05   30.2   1.0   27   43-71      2-28  (104)
 66 PF09986 DUF2225:  Uncharacteri  74.3     5.8 0.00013   31.4   4.3   60   40-103     4-67  (214)
 67 COG3677 Transposase and inacti  73.3    0.62 1.3E-05   34.7  -1.3   65   38-105    27-96  (129)
 68 PRK14714 DNA polymerase II lar  72.2     1.7 3.7E-05   43.6   1.0   39   41-97    667-705 (1337)
 69 cd00350 rubredoxin_like Rubred  72.2     1.5 3.3E-05   25.4   0.4   24   42-67      2-25  (33)
 70 smart00440 ZnF_C2C2 C2C2 Zinc   71.9     9.1  0.0002   23.1   3.8   12   42-53      1-12  (40)
 71 PF08792 A2L_zn_ribbon:  A2L zi  71.6       5 0.00011   23.7   2.6   28   41-68      3-30  (33)
 72 smart00778 Prim_Zn_Ribbon Zinc  70.8     2.9 6.2E-05   25.5   1.4   27   41-67      3-33  (37)
 73 PF03604 DNA_RNApol_7kD:  DNA d  70.0     1.1 2.3E-05   26.6  -0.6    9   42-50      1-9   (32)
 74 PF00641 zf-RanBP:  Zn-finger i  69.7     2.2 4.8E-05   23.9   0.7   23   58-91      3-25  (30)
 75 PRK00420 hypothetical protein;  69.5     6.4 0.00014   29.2   3.3   28   40-68     22-49  (112)
 76 TIGR02605 CxxC_CxxC_SSSS putat  68.9     3.5 7.5E-05   25.2   1.5   27   41-67      5-34  (52)
 77 PF13894 zf-C2H2_4:  C2H2-type   68.2     2.2 4.7E-05   21.2   0.4    9   42-50      1-9   (24)
 78 PF09538 FYDLN_acid:  Protein o  67.6     2.2 4.7E-05   31.2   0.5   26   40-68      8-35  (108)
 79 PF08790 zf-LYAR:  LYAR-type C2  67.1     5.2 0.00011   23.4   1.9   18   86-103     2-19  (28)
 80 PF13240 zinc_ribbon_2:  zinc-r  66.8     1.9 4.2E-05   23.6   0.1    7   44-50      2-8   (23)
 81 PF06044 DRP:  Dam-replacing fa  66.0     4.3 9.3E-05   34.2   2.0   54   35-100    25-82  (254)
 82 TIGR02098 MJ0042_CXXC MJ0042 f  66.0     3.5 7.6E-05   23.9   1.1    9   42-50      3-11  (38)
 83 PRK00464 nrdR transcriptional   65.3     4.3 9.3E-05   31.3   1.8   36   61-96      2-40  (154)
 84 PF14353 CpXC:  CpXC protein     65.2     4.9 0.00011   28.7   1.9    9   43-51      3-11  (128)
 85 PRK00241 nudC NADH pyrophospha  65.0     5.9 0.00013   32.2   2.6   29   40-68     98-126 (256)
 86 COG1996 RPC10 DNA-directed RNA  64.8     3.2 6.9E-05   27.0   0.8   29   40-68      5-33  (49)
 87 TIGR03830 CxxCG_CxxCG_HTH puta  64.8      15 0.00032   25.5   4.2   43   44-96      1-43  (127)
 88 COG1571 Predicted DNA-binding   64.5     2.3 5.1E-05   37.9   0.2   30   41-72    350-380 (421)
 89 PF09862 DUF2089:  Protein of u  64.2     7.2 0.00016   29.0   2.7   25   44-72      1-25  (113)
 90 PF09297 zf-NADH-PPase:  NADH p  63.9     4.9 0.00011   22.9   1.4   26   42-67      4-29  (32)
 91 PF00096 zf-C2H2:  Zinc finger,  63.6     2.4 5.2E-05   21.7   0.1    8   42-49      1-8   (23)
 92 PF11023 DUF2614:  Protein of u  63.1     2.6 5.6E-05   31.8   0.2   27   38-68     66-94  (114)
 93 PF13248 zf-ribbon_3:  zinc-rib  63.1     2.5 5.5E-05   23.3   0.1   22   42-67      3-24  (26)
 94 PF04216 FdhE:  Protein involve  62.8     3.5 7.6E-05   33.5   0.9   53   40-92    171-246 (290)
 95 PF09723 Zn-ribbon_8:  Zinc rib  62.7     5.2 0.00011   24.2   1.5   17   39-55     24-40  (42)
 96 PF11672 DUF3268:  Protein of u  62.5       7 0.00015   28.6   2.3   64   41-119     2-65  (102)
 97 KOG2593|consensus               62.4     6.4 0.00014   35.4   2.5   41   27-67    112-161 (436)
 98 TIGR02300 FYDLN_acid conserved  62.3     3.5 7.5E-05   31.7   0.7   26   40-68      8-35  (129)
 99 PHA00616 hypothetical protein   61.9     2.6 5.7E-05   26.8   0.0   11   41-51      1-11  (44)
100 COG1594 RPB9 DNA-directed RNA   61.4     6.7 0.00015   28.6   2.1   30   43-72      4-35  (113)
101 PF03119 DNA_ligase_ZBD:  NAD-d  61.0     3.9 8.4E-05   23.3   0.6   20   43-62      1-20  (28)
102 PRK12366 replication factor A;  60.8     5.3 0.00012   36.5   1.8   53   28-93    504-557 (637)
103 PF01599 Ribosomal_S27:  Riboso  60.2     7.8 0.00017   24.9   2.0   29   40-68     17-47  (47)
104 PRK14559 putative protein seri  60.2     3.4 7.4E-05   38.2   0.5   45   42-103    16-60  (645)
105 PF04606 Ogr_Delta:  Ogr/Delta-  60.1     6.4 0.00014   24.3   1.6   16   43-58      1-16  (47)
106 PF06689 zf-C4_ClpX:  ClpX C4-t  59.7       4 8.7E-05   24.8   0.6   25   41-65      1-30  (41)
107 PRK08402 replication factor A;  58.3     5.4 0.00012   34.4   1.3   26   42-67    213-238 (355)
108 COG3809 Uncharacterized protei  57.7     9.6 0.00021   27.6   2.3   29   43-71      3-33  (88)
109 PF14803 Nudix_N_2:  Nudix N-te  56.5     9.3  0.0002   22.8   1.8   26   43-68      2-31  (34)
110 TIGR00340 zpr1_rel ZPR1-relate  56.3      13 0.00027   28.9   2.9   25   44-68      1-37  (163)
111 PRK08665 ribonucleotide-diphos  55.6      12 0.00027   35.1   3.3   24   43-68    726-749 (752)
112 PF08274 PhnA_Zn_Ribbon:  PhnA   55.6     9.2  0.0002   22.4   1.6   25   43-68      4-28  (30)
113 PF02150 RNA_POL_M_15KD:  RNA p  55.3     8.6 0.00019   22.8   1.5   26   43-68      3-29  (35)
114 PF04423 Rad50_zn_hook:  Rad50   55.2     8.2 0.00018   24.1   1.5   11   40-50     19-29  (54)
115 PRK14559 putative protein seri  55.0     3.9 8.4E-05   37.9  -0.1   42   43-101     3-45  (645)
116 PF06677 Auto_anti-p27:  Sjogre  55.0     9.2  0.0002   23.7   1.6   24   42-66     18-41  (41)
117 PF01927 Mut7-C:  Mut7-C RNAse   54.1     9.6 0.00021   28.2   1.9    9   43-51     93-101 (147)
118 PF08646 Rep_fac-A_C:  Replicat  53.6     8.2 0.00018   28.0   1.4   33   61-101    20-54  (146)
119 PF03811 Zn_Tnp_IS1:  InsA N-te  53.1     7.7 0.00017   23.4   1.0   24   42-65      6-35  (36)
120 PRK06266 transcription initiat  52.8     4.2   9E-05   31.6  -0.2   30   87-119   139-168 (178)
121 COG1198 PriA Primosomal protei  52.6     8.8 0.00019   36.3   1.8   40   42-93    445-484 (730)
122 PF14319 Zn_Tnp_IS91:  Transpos  52.0     7.3 0.00016   28.1   1.0   41   27-67     23-68  (111)
123 smart00547 ZnF_RBZ Zinc finger  51.8     4.7  0.0001   21.6  -0.1   11   58-68      1-11  (26)
124 KOG3214|consensus               51.6       9  0.0002   28.7   1.4   54   36-108    18-71  (109)
125 PF01096 TFIIS_C:  Transcriptio  51.1      31 0.00067   20.6   3.5    9   43-51      2-10  (39)
126 PRK03681 hypA hydrogenase nick  50.4       7 0.00015   28.3   0.6   12   57-68     68-79  (114)
127 PRK07218 replication factor A;  50.2     6.9 0.00015   34.6   0.7   27   42-76    298-324 (423)
128 TIGR00595 priA primosomal prot  49.3      10 0.00022   33.5   1.6   38   43-92    224-261 (505)
129 PF04641 Rtf2:  Rtf2 RING-finge  48.8      18 0.00039   29.2   2.8   57   38-101   110-167 (260)
130 PRK08173 DNA topoisomerase III  48.5      17 0.00036   34.7   3.0   26   42-69    625-650 (862)
131 PF04438 zf-HIT:  HIT zinc fing  48.5     6.8 0.00015   22.7   0.3   12   39-50     11-22  (30)
132 PRK12495 hypothetical protein;  48.4      15 0.00033   30.5   2.4   30   40-71     41-70  (226)
133 PF03367 zf-ZPR1:  ZPR1 zinc-fi  48.1      19 0.00042   27.6   2.8   26   43-68      3-39  (161)
134 COG3478 Predicted nucleic-acid  47.3      16 0.00034   25.5   2.0   12   82-93     38-49  (68)
135 PF01807 zf-CHC2:  CHC2 zinc fi  47.0      16 0.00034   25.5   2.0   31   87-119    57-88  (97)
136 COG1592 Rubrerythrin [Energy p  46.7      12 0.00026   29.5   1.4   23   59-91    134-156 (166)
137 PRK11788 tetratricopeptide rep  46.4      21 0.00046   28.2   2.8   28   36-67    349-376 (389)
138 PF10263 SprT-like:  SprT-like   46.3      13 0.00028   26.8   1.5   19   18-36     79-97  (157)
139 PF02977 CarbpepA_inh:  Carboxy  46.2     4.4 9.6E-05   26.3  -0.8   34   46-79      7-42  (46)
140 TIGR01385 TFSII transcription   45.1      28  0.0006   29.5   3.5   20   37-56    254-273 (299)
141 TIGR01391 dnaG DNA primase, ca  45.0      10 0.00022   32.7   0.9   33   42-76     35-70  (415)
142 COG2051 RPS27A Ribosomal prote  44.9      26 0.00055   24.3   2.7   14   82-95     36-49  (67)
143 PF02945 Endonuclease_7:  Recom  44.2     8.2 0.00018   26.9   0.2   47   18-67      2-49  (81)
144 PF05766 NinG:  Bacteriophage L  43.7      19 0.00041   28.9   2.2   59   36-101    82-140 (189)
145 PRK04351 hypothetical protein;  43.6      17 0.00038   27.7   1.9   29   40-68    111-141 (149)
146 PLN03086 PRLI-interacting fact  43.5     5.9 0.00013   36.5  -0.8   28   43-70    435-464 (567)
147 TIGR00373 conserved hypothetic  43.5     7.8 0.00017   29.4  -0.0   12   39-50    107-118 (158)
148 COG3058 FdhE Uncharacterized p  42.3     6.1 0.00013   34.2  -0.8   59   33-91    173-259 (308)
149 PRK14873 primosome assembly pr  42.0      16 0.00034   33.9   1.7   39   42-93    393-431 (665)
150 PF13597 NRDD:  Anaerobic ribon  41.8      23  0.0005   31.9   2.7   39   25-68    467-513 (546)
151 PRK06450 threonine synthase; V  41.7     9.6 0.00021   31.9   0.3   25   41-68      3-27  (338)
152 PF03107 C1_2:  C1 domain;  Int  41.6      25 0.00055   19.8   1.9   21   43-66      2-22  (30)
153 PRK03824 hypA hydrogenase nick  41.6      20 0.00043   26.6   1.9   14   57-70     68-81  (135)
154 TIGR00310 ZPR1_znf ZPR1 zinc f  40.9      30 0.00066   27.5   3.0   26   43-68      2-39  (192)
155 smart00355 ZnF_C2H2 zinc finge  40.8      14  0.0003   18.0   0.7    9   42-50      1-9   (26)
156 smart00507 HNHc HNH nucleases.  40.5      22 0.00048   20.0   1.6   14   37-51      7-20  (52)
157 COG2158 Uncharacterized protei  40.4      18 0.00039   27.3   1.5   23   83-112    61-83  (112)
158 TIGR01562 FdhE formate dehydro  40.4      23  0.0005   30.1   2.3   31   61-92    226-260 (305)
159 PF09082 DUF1922:  Domain of un  40.1      17 0.00037   25.2   1.2   25   42-68      4-28  (68)
160 COG1779 C4-type Zn-finger prot  39.8      25 0.00053   28.8   2.3   30   40-69     13-53  (201)
161 PF01396 zf-C4_Topoisom:  Topoi  39.7      21 0.00046   21.4   1.5   14   43-56      3-16  (39)
162 PRK09678 DNA-binding transcrip  39.3      20 0.00043   24.7   1.5   15   42-56      2-16  (72)
163 PF10122 Mu-like_Com:  Mu-like   38.7      14  0.0003   24.4   0.6   13   41-53      4-16  (51)
164 PRK06386 replication factor A;  38.5      13 0.00028   32.3   0.6   20   42-67    237-256 (358)
165 PF14471 DUF4428:  Domain of un  38.5     4.2   9E-05   26.0  -1.8   26   43-69      1-30  (51)
166 COG1499 NMD3 NMD protein affec  38.4      14  0.0003   32.1   0.8   54   41-101     6-60  (355)
167 COG4640 Predicted membrane pro  38.2      14  0.0003   33.6   0.7   27   43-73      3-29  (465)
168 smart00400 ZnF_CHCC zinc finge  38.1      32  0.0007   21.3   2.2   26   42-67      3-31  (55)
169 TIGR00686 phnA alkylphosphonat  38.1      23 0.00049   26.6   1.7   30   43-73      4-33  (109)
170 TIGR00617 rpa1 replication fac  38.0      20 0.00044   32.7   1.8   13   26-38    436-448 (608)
171 PF14690 zf-ISL3:  zinc-finger   38.0      20 0.00043   21.2   1.2   14   41-54      2-15  (47)
172 PF00412 LIM:  LIM domain;  Int  38.0      19 0.00041   21.6   1.1   12   87-98     29-40  (58)
173 PRK03564 formate dehydrogenase  37.9      27 0.00058   29.9   2.4   52   40-92    186-260 (309)
174 PRK05667 dnaG DNA primase; Val  37.5      16 0.00036   33.1   1.1   33   42-76     37-72  (580)
175 PF14206 Cys_rich_CPCC:  Cystei  37.5      19  0.0004   25.2   1.1   21   41-61      1-21  (78)
176 PHA02768 hypothetical protein;  37.3      14 0.00029   24.5   0.4   16   41-56      5-20  (55)
177 PF07295 DUF1451:  Protein of u  37.1      18  0.0004   27.6   1.1   54   30-93     86-139 (146)
178 PRK07220 DNA topoisomerase I;   37.0      29 0.00064   32.4   2.6   27   41-67    635-665 (740)
179 PF06827 zf-FPG_IleRS:  Zinc fi  36.8      29 0.00063   19.2   1.7   23   43-65      3-27  (30)
180 smart00731 SprT SprT homologue  36.7      24 0.00051   25.9   1.7   16   22-37     80-95  (146)
181 PHA00732 hypothetical protein   36.5      17 0.00037   25.0   0.8   13  106-118    65-77  (79)
182 PF13912 zf-C2H2_6:  C2H2-type   36.5      13 0.00027   19.6   0.1    9   42-50      2-10  (27)
183 PF05741 zf-nanos:  Nanos RNA b  36.3      15 0.00032   24.3   0.4   12   39-50     31-42  (55)
184 TIGR01206 lysW lysine biosynth  36.3      26 0.00056   22.9   1.6   28   41-68      2-31  (54)
185 KOG1986|consensus               36.2      18 0.00039   34.6   1.1   35   34-68     46-84  (745)
186 PRK08270 anaerobic ribonucleos  36.0      27 0.00059   32.4   2.2   39   25-68    602-648 (656)
187 PRK01103 formamidopyrimidine/5  35.7      34 0.00073   27.8   2.6   27   40-67    244-273 (274)
188 TIGR00382 clpX endopeptidase C  35.5      13 0.00028   32.6   0.1   26   42-67      8-37  (413)
189 PF04071 zf-like:  Cysteine-ric  35.0      26 0.00056   25.0   1.6   19   72-91     40-58  (86)
190 PRK07111 anaerobic ribonucleos  34.7      17 0.00036   34.2   0.7   37   25-67    657-701 (735)
191 PRK10445 endonuclease VIII; Pr  34.4      27 0.00059   28.3   1.8   26   39-65    233-261 (263)
192 KOG4623|consensus               34.3      15 0.00033   34.2   0.4   43   24-66     10-54  (611)
193 TIGR02827 RNR_anaer_Bdell anae  34.2      28 0.00061   32.1   2.1   36   25-67    509-554 (586)
194 COG1066 Sms Predicted ATP-depe  34.2      17 0.00038   32.9   0.7   23   40-66      6-28  (456)
195 COG3091 SprT Zn-dependent meta  34.1      21 0.00045   28.3   1.0   48   19-68     96-149 (156)
196 PF06054 CoiA:  Competence prot  34.0      24 0.00052   30.2   1.5   24   39-62     28-52  (375)
197 PF09779 Ima1_N:  Ima1 N-termin  33.9      15 0.00033   27.2   0.2   25   43-67      2-28  (131)
198 PF02318 FYVE_2:  FYVE-type zin  33.8      41 0.00089   24.1   2.5   29   40-69     53-81  (118)
199 PF06676 DUF1178:  Protein of u  33.6      35 0.00076   26.4   2.2   22   35-56     26-47  (148)
200 COG4643 Uncharacterized protei  33.5      15 0.00033   32.4   0.2   29   38-66     29-61  (366)
201 PRK05580 primosome assembly pr  33.4      24 0.00053   32.3   1.5   40   42-93    391-430 (679)
202 PRK05452 anaerobic nitric oxid  33.3      16 0.00035   32.1   0.4   13   56-68    422-434 (479)
203 COG1656 Uncharacterized conser  33.2      18 0.00039   28.7   0.6   27   42-68     98-139 (165)
204 TIGR00311 aIF-2beta translatio  33.0      61  0.0013   24.4   3.4   40   28-68     83-127 (133)
205 PF05876 Terminase_GpA:  Phage   33.0      58  0.0013   29.3   3.8   73   41-115   200-289 (557)
206 PF13909 zf-H2C2_5:  C2H2-type   32.8      19 0.00041   18.7   0.4    8   42-49      1-8   (24)
207 PHA00733 hypothetical protein   32.6      12 0.00026   27.6  -0.5   12   39-50     71-82  (128)
208 PRK00564 hypA hydrogenase nick  32.3      14 0.00031   26.8  -0.1    7   42-48     72-78  (117)
209 PRK14811 formamidopyrimidine-D  32.1      30 0.00066   28.2   1.7   26   41-67    235-263 (269)
210 KOG1311|consensus               31.6      18 0.00039   29.2   0.3   24   40-67    112-135 (299)
211 KOG2463|consensus               31.3      35 0.00077   30.3   2.1   22   40-61    256-277 (376)
212 TIGR00354 polC DNA polymerase,  30.9      23  0.0005   35.2   1.0   17  102-118   656-672 (1095)
213 PF14447 Prok-RING_4:  Prokaryo  30.7      23  0.0005   23.6   0.7    7   44-50     42-48  (55)
214 PF13717 zinc_ribbon_4:  zinc-r  30.4      24 0.00051   20.9   0.6    8   87-94     28-35  (36)
215 PRK02935 hypothetical protein;  30.3      29 0.00063   26.1   1.2   29   36-68     65-95  (110)
216 PF14255 Cys_rich_CPXG:  Cystei  30.3      24 0.00052   22.9   0.7    9   42-50      1-9   (52)
217 PRK07591 threonine synthase; V  30.3      18 0.00039   31.1   0.2   25   41-68     18-42  (421)
218 KOG4198|consensus               30.2      22 0.00048   30.2   0.7   52   43-105   117-175 (280)
219 PRK13945 formamidopyrimidine-D  30.2      45 0.00097   27.3   2.4   26   40-66    253-281 (282)
220 PRK14810 formamidopyrimidine-D  29.7      36 0.00078   27.8   1.8   25   40-65    243-270 (272)
221 PF08996 zf-DNA_Pol:  DNA Polym  29.4      27 0.00059   26.9   1.0   11   41-51     18-28  (188)
222 PF13824 zf-Mss51:  Zinc-finger  29.3      27 0.00058   23.2   0.8   13   38-50     11-23  (55)
223 PF10058 DUF2296:  Predicted in  29.2      19  0.0004   23.4   0.0   15   35-49     38-52  (54)
224 PF13913 zf-C2HC_2:  zinc-finge  29.2      28  0.0006   19.1   0.7    8   43-50      4-11  (25)
225 TIGR02159 PA_CoA_Oxy4 phenylac  29.1      15 0.00032   28.0  -0.5   16   41-56    105-120 (146)
226 PF09180 ProRS-C_1:  Prolyl-tRN  28.9      37 0.00081   22.4   1.5   21   38-58     45-65  (68)
227 PF02891 zf-MIZ:  MIZ/SP-RING z  28.6      31 0.00067   21.6   1.0   10   40-49     40-49  (50)
228 TIGR03844 cysteate_syn cysteat  28.6      22 0.00048   30.6   0.4   23   41-66      2-24  (398)
229 PF12874 zf-met:  Zinc-finger o  28.4      43 0.00094   17.1   1.4    9   60-68      1-9   (25)
230 PRK03988 translation initiatio  28.3      75  0.0016   24.1   3.2   39   29-67     89-131 (138)
231 COG2995 PqiA Uncharacterized p  28.1      45 0.00098   30.1   2.2   26   87-112    41-67  (418)
232 PF13719 zinc_ribbon_5:  zinc-r  28.0      54  0.0012   19.3   1.9    8   43-50      4-11  (37)
233 PRK05978 hypothetical protein;  27.9      27 0.00058   27.0   0.7   19   36-54     28-46  (148)
234 PF00569 ZZ:  Zinc finger, ZZ t  27.9      45 0.00098   20.3   1.6   25   39-66      2-26  (46)
235 smart00132 LIM Zinc-binding do  27.5      37 0.00081   18.2   1.1    8   87-94     30-37  (39)
236 PF02892 zf-BED:  BED zinc fing  27.4      42 0.00091   19.6   1.4   25   73-97      3-29  (45)
237 PF01155 HypA:  Hydrogenase exp  27.3      42  0.0009   24.0   1.6   26   40-68     69-95  (113)
238 PRK08271 anaerobic ribonucleos  27.3      25 0.00053   32.7   0.5   38   25-67    543-588 (623)
239 TIGR00155 pqiA_fam integral me  27.0      35 0.00075   29.7   1.3   25   44-68     16-42  (403)
240 PRK14704 anaerobic ribonucleos  26.9      27 0.00059   32.2   0.7   39   25-68    536-581 (618)
241 cd06956 NR_DBD_RXR DNA-binding  26.9      35 0.00076   23.0   1.1   25   42-67      1-25  (77)
242 PHA02998 RNA polymerase subuni  26.8      65  0.0014   26.4   2.7   12   41-52    143-154 (195)
243 PF14205 Cys_rich_KTR:  Cystein  26.7      33 0.00072   23.0   0.9    9   42-50      5-13  (55)
244 PRK04860 hypothetical protein;  26.6      17 0.00037   28.0  -0.5   29   40-69    118-153 (160)
245 smart00709 Zpr1 Duplicated dom  26.4      66  0.0014   24.8   2.7   26   43-68      2-38  (160)
246 PF05191 ADK_lid:  Adenylate ki  26.4      45 0.00097   19.9   1.3    9   60-68      2-10  (36)
247 PRK05342 clpX ATP-dependent pr  26.0      22 0.00048   30.9  -0.0   27   40-66      8-38  (412)
248 PRK00415 rps27e 30S ribosomal   26.0      49  0.0011   22.3   1.6   13   82-94     28-40  (59)
249 PRK12380 hydrogenase nickel in  25.9      47   0.001   23.9   1.6   14   55-68     66-79  (113)
250 PF10588 NADH-G_4Fe-4S_3:  NADH  25.7      56  0.0012   19.7   1.7   22   28-50      1-22  (41)
251 PF01363 FYVE:  FYVE zinc finge  25.4      46 0.00099   21.1   1.4   26   40-69      8-35  (69)
252 cd00085 HNHc HNH nucleases; HN  25.3      50  0.0011   18.8   1.5   10   42-51     12-21  (57)
253 PF00301 Rubredoxin:  Rubredoxi  25.1      38 0.00082   21.4   0.9   13   39-51     32-44  (47)
254 PRK06260 threonine synthase; V  25.0      27 0.00058   29.6   0.3   25   41-67      3-27  (397)
255 PF09151 DUF1936:  Domain of un  25.0      32  0.0007   21.1   0.6   10   41-50      1-10  (36)
256 PF13901 DUF4206:  Domain of un  24.9      53  0.0011   25.8   1.9   57   28-92    139-197 (202)
257 cd00730 rubredoxin Rubredoxin;  24.8      36 0.00079   21.7   0.8   14   38-51     31-44  (50)
258 TIGR00577 fpg formamidopyrimid  24.8      49  0.0011   27.0   1.7   25   40-65    244-271 (272)
259 TIGR00100 hypA hydrogenase nic  24.5      50  0.0011   23.8   1.6   25   48-72     59-83  (115)
260 PRK13130 H/ACA RNA-protein com  24.1      42 0.00092   22.1   1.0   11   42-52      6-16  (56)
261 smart00714 LITAF Possible memb  23.7      38 0.00082   21.8   0.8   16   35-50     46-61  (67)
262 COG2260 Predicted Zn-ribbon RN  23.7      46 0.00099   22.6   1.1   21   42-68      6-26  (59)
263 PRK12336 translation initiatio  23.4   1E+02  0.0022   24.3   3.3   41   28-68     84-128 (201)
264 PF01667 Ribosomal_S27e:  Ribos  23.4      81  0.0017   20.8   2.3   15   81-95     23-37  (55)
265 PF09526 DUF2387:  Probable met  23.3 1.3E+02  0.0027   20.6   3.3   14   82-95     28-41  (71)
266 cd06968 NR_DBD_ROR DNA-binding  23.2      44 0.00094   23.6   1.0   27   40-67      4-30  (95)
267 cd03031 GRX_GRX_like Glutaredo  23.2 1.2E+02  0.0025   23.0   3.4   53   27-92     86-141 (147)
268 PRK00762 hypA hydrogenase nick  23.2      46   0.001   24.3   1.2   11   42-52     93-103 (124)
269 COG1379 PHP family phosphoeste  22.8      15 0.00033   32.7  -1.6   30   43-72    248-278 (403)
270 PHA02540 61 DNA primase; Provi  22.7      71  0.0015   27.6   2.4   34   41-76     27-70  (337)
271 PF12171 zf-C2H2_jaz:  Zinc-fin  22.5      44 0.00096   17.8   0.8    8   42-49      2-9   (27)
272 cd00729 rubredoxin_SM Rubredox  22.5      64  0.0014   18.8   1.5   14   59-72      2-15  (34)
273 PLN00209 ribosomal protein S27  22.4      91   0.002   22.5   2.5   14   81-94     52-65  (86)
274 PF00105 zf-C4:  Zinc finger, C  22.4      45 0.00098   21.5   0.9   24   43-67      2-25  (70)
275 smart00647 IBR In Between Ring  22.3 1.9E+02  0.0041   17.3   3.7   26   43-68     20-49  (64)
276 cd00065 FYVE FYVE domain; Zinc  22.1      30 0.00065   21.0   0.0   32   43-76      4-35  (57)
277 KOG4317|consensus               22.1      36 0.00079   30.2   0.5   11  109-119    68-78  (383)
278 PF01529 zf-DHHC:  DHHC palmito  22.1      37 0.00081   24.5   0.5   33   34-70     41-73  (174)
279 PF10601 zf-LITAF-like:  LITAF-  22.0      41 0.00089   22.0   0.7   14   37-50     54-67  (73)
280 PRK05638 threonine synthase; V  22.0      37  0.0008   29.2   0.5   24   41-68      1-24  (442)
281 smart00249 PHD PHD zinc finger  22.0      51  0.0011   18.2   1.0    7   44-50      2-8   (47)
282 PF08209 Sgf11:  Sgf11 (transcr  21.9      54  0.0012   19.5   1.1   16   86-101     6-21  (33)
283 PF01873 eIF-5_eIF-2B:  Domain   21.7      80  0.0017   23.5   2.2   39   28-67     79-122 (125)
284 cd01675 RNR_III Class III ribo  21.7      38 0.00082   30.5   0.6   40   25-68    495-541 (555)
285 TIGR02487 NrdD anaerobic ribon  21.4      35 0.00075   31.0   0.3   40   25-68    501-547 (579)
286 COG2075 RPL24A Ribosomal prote  21.3      37 0.00081   23.4   0.4   21   42-62      4-32  (66)
287 PF02591 DUF164:  Putative zinc  21.0      59  0.0013   20.3   1.2   11   39-49     44-54  (56)
288 COG1675 TFA1 Transcription ini  20.9      26 0.00057   27.8  -0.5   64   29-120   100-165 (176)
289 PF03884 DUF329:  Domain of unk  20.7      44 0.00095   22.2   0.6   25   41-67      2-26  (57)
290 PF05899 Cupin_3:  Protein of u  20.6 1.1E+02  0.0024   20.0   2.5   20   54-73      6-25  (74)
291 PRK11032 hypothetical protein;  20.3      54  0.0012   25.7   1.1   14   43-56    144-157 (160)
292 PF06397 Desulfoferrod_N:  Desu  20.3      65  0.0014   19.6   1.2   12   58-69      5-16  (36)
293 PTZ00083 40S ribosomal protein  20.1 1.1E+02  0.0024   22.1   2.5   14   81-94     51-64  (85)
294 PRK14724 DNA topoisomerase III  20.1      78  0.0017   30.9   2.3   21   41-64    755-776 (987)
295 COG1439 Predicted nucleic acid  20.0      73  0.0016   25.5   1.8   13   39-51    151-163 (177)

No 1  
>KOG0402|consensus
Probab=100.00  E-value=2.8e-46  Score=266.32  Aligned_cols=92  Identities=73%  Similarity=1.192  Sum_probs=89.8

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |+||||||||+|+||+|||+||||++++||++||++|+|+||||..|||.|||||.                        
T Consensus         1 m~krtKKVgI~gkyGtrYGaSLrk~vKkiei~Qhaky~CsfCGK~~vKR~AvGiW~------------------------   56 (92)
T KOG0402|consen    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIQQHAKYTCSFCGKKTVKRKAVGIWK------------------------   56 (92)
T ss_pred             CCcccceeeeeecccchhhHHHHHHHHHHHHHHhhhhhhhhcchhhhhhhceeEEe------------------------
Confidence            89999999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHhhhC
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL  122 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~~~~  122 (122)
                       |..|++++|||||+++|+++.+++++||||||+.|+
T Consensus        57 -C~~C~kv~agga~~~~t~aa~t~rs~irrlre~~e~   92 (92)
T KOG0402|consen   57 -CGSCKKVVAGGAYTVTTAAAATVRSTIRRLRELVEQ   92 (92)
T ss_pred             -cCCccceeccceEEeccchhHHHHHHHHHHHHHhcC
Confidence             788999999999999999999999999999999885


No 2  
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=100.00  E-value=1.4e-45  Score=262.48  Aligned_cols=90  Identities=70%  Similarity=1.163  Sum_probs=82.5

Q ss_pred             hhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeee
Q psy836            7 AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWS   86 (122)
Q Consensus         7 ~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s   86 (122)
                      ++|||||||+||||+|||++|||+|++||++||++|+|||||++.|+|.++|||+                         
T Consensus         1 a~rtkkvgi~GkyG~RYG~slRK~vkkie~~q~~ky~Cp~Cgk~~vkR~a~GIW~-------------------------   55 (90)
T PF01780_consen    1 AKRTKKVGIAGKYGTRYGASLRKRVKKIEISQHAKYTCPFCGKTSVKRVATGIWK-------------------------   55 (90)
T ss_dssp             -S-SSS-TTGGGGTTSSTHHHHHHHHHHHHHHHS-BEESSSSSSEEEEEETTEEE-------------------------
T ss_pred             CCCCceeeecCcCcCCcCHHHHHHHHHHHHHHhCCCcCCCCCCceeEEeeeEEee-------------------------
Confidence            5899999999999999999999999999999999999999999999999999999                         


Q ss_pred             ecCcCeEEeccccccCchHHHHHHHHHHHHHHhhh
Q psy836           87 CKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNE  121 (122)
Q Consensus        87 ~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~~~  121 (122)
                      |.+|+++||||||+|+||++.+++++|+||+|++|
T Consensus        56 C~~C~~~~AGGAy~~~T~~~~t~~~~i~rl~e~~e   90 (90)
T PF01780_consen   56 CKKCGKKFAGGAYTPSTPAAKTVKRAIRRLRELKE   90 (90)
T ss_dssp             ETTTTEEEE-BSSSSS-HHHHHHHHHHHHHHHHHH
T ss_pred             cCCCCCEEeCCCccccchHHHHHHHHHHHHHHhcC
Confidence            78999999999999999999999999999999987


No 3  
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=100.00  E-value=2e-45  Score=261.68  Aligned_cols=90  Identities=71%  Similarity=1.225  Sum_probs=87.5

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |++|||||||+||||+|||++|||+|++||++||++|+|||||++.|+|.++|||+                        
T Consensus         1 MakrtkkvG~~GrfG~RYG~slRK~v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~------------------------   56 (90)
T PTZ00255          1 MAKRTKKVGITGKYGTRYGASLRKQIKKIEISQHAKYFCPFCGKHAVKRQAVGIWR------------------------   56 (90)
T ss_pred             CCCcCceeeecCCCcCccCHHHHHHHHHHHHHHhCCccCCCCCCCceeeeeeEEEE------------------------
Confidence            89999999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHhh
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVN  120 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~~  120 (122)
                       |..|+++||||||+|+||++.++.++|+||+|++
T Consensus        57 -C~~C~~~~AGGAy~~~T~~~~t~~~~irr~~e~~   90 (90)
T PTZ00255         57 -CKGCKKTVAGGAWTLSTPAASTVRSTIRRLRKLK   90 (90)
T ss_pred             -cCCCCCEEeCCccccccchhHHHHHHHHHHHhcC
Confidence             7888999999999999999999999999999974


No 4  
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=100.00  E-value=4.8e-45  Score=260.25  Aligned_cols=91  Identities=54%  Similarity=1.000  Sum_probs=87.7

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |+ |||||||+||||+|||++|||+|++||++||++|+|||||++.|+|.++|||+                        
T Consensus         1 ma-rtkkvG~~GrfG~RYG~slRK~v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~------------------------   55 (91)
T TIGR00280         1 MK-RTKKVGITGRFGPRYGLKLRRQVKKIEIQQKAKYVCPFCGKKTVKRGSTGIWT------------------------   55 (91)
T ss_pred             CC-CCceeeecCCCcCccCHHHHHHHHHHHHHHhcCccCCCCCCCceEEEeeEEEE------------------------
Confidence            66 89999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHhhhC
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL  122 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~~~~  122 (122)
                       |..|+++||||||+|+||++.++.++|+||+|++|.
T Consensus        56 -C~~C~~~~AGGAy~p~T~~~~t~~~~irrl~e~~~~   91 (91)
T TIGR00280        56 -CRKCGAKFAGGAYTPVTPAGKTVRKTIRRIVEMKEA   91 (91)
T ss_pred             -cCCCCCEEeCCccccccchhHHHHHHHHHHHHhhcC
Confidence             788899999999999999999999999999999873


No 5  
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=100.00  E-value=1.5e-44  Score=257.15  Aligned_cols=89  Identities=44%  Similarity=0.796  Sum_probs=86.1

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |++|||||||+||||+|||++|||+|++||++||++|+|||||+++|+|.++|||+                        
T Consensus         1 m~~rtkkvGi~Gr~G~RYG~slRK~v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~------------------------   56 (90)
T PRK03976          1 MMSRTKKVGSAGRFGARYGRKIRKRVADIEEKMRAKHVCPVCGRPKVKRVGTGIWE------------------------   56 (90)
T ss_pred             CCCcCceEeecCCCcCccCHHHHHHHHHHHHHHhcCccCCCCCCCceEEEEEEEEE------------------------
Confidence            67799999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHh
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV  119 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~  119 (122)
                       |.+|+++||||||+|+||++.++.++|+||+|.
T Consensus        57 -C~~C~~~~AGGAy~~~T~~~~t~~~~irr~~~~   89 (90)
T PRK03976         57 -CRKCGAKFAGGAYTPETPAGKTVTRAIRRAVEE   89 (90)
T ss_pred             -cCCCCCEEeCCccccccchhhhHHHHHHHHhhc
Confidence             788889999999999999999999999999985


No 6  
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2.6e-38  Score=225.21  Aligned_cols=88  Identities=49%  Similarity=0.915  Sum_probs=85.6

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |++ ||||||+|+||+|||++||++|++||++|+++|.||+||++.++|.++|||.                        
T Consensus         1 M~~-TkkvG~aGrfGpRYG~~~Rrrv~~ie~~~~~~~~Cp~C~~~~VkR~a~GIW~------------------------   55 (89)
T COG1997           1 MAK-TKKVGIAGRFGPRYGSKLRRRVKEIEAQQRAKHVCPFCGRTTVKRIATGIWK------------------------   55 (89)
T ss_pred             CCc-cceeccCcccccccchHHHHHHHHHHHHHhcCCcCCCCCCcceeeeccCeEE------------------------
Confidence            777 9999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHh
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV  119 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~  119 (122)
                       |.+||.+||||||+|.|+++.++.++|+|+.|.
T Consensus        56 -C~kCg~~fAGgay~P~t~~~k~~~~~i~r~~e~   88 (89)
T COG1997          56 -CRKCGAKFAGGAYTPVTPAGKAVKRTIRREVEM   88 (89)
T ss_pred             -cCCCCCeeccccccccchHHHHHHHHHHHHhcc
Confidence             789999999999999999999999999999985


No 7  
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=97.25  E-value=4e-05  Score=55.07  Aligned_cols=25  Identities=24%  Similarity=0.352  Sum_probs=22.6

Q ss_pred             cceeeecceeeeeccceeeeeeecC
Q psy836           65 CKRIVAGGAWDSMKRSCVGIWSCKR   89 (122)
Q Consensus        65 C~~~vAggAy~~~t~~AvtV~s~~r   89 (122)
                      |+++||||||+|+|.+++++.+.|+
T Consensus        60 C~~~~AGGAy~~~T~~~~t~~~~ir   84 (90)
T PRK03976         60 CGAKFAGGAYTPETPAGKTVTRAIR   84 (90)
T ss_pred             CCCEEeCCccccccchhhhHHHHHH
Confidence            8999999999999999999877665


No 8  
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=97.23  E-value=3.6e-05  Score=55.48  Aligned_cols=25  Identities=24%  Similarity=0.416  Sum_probs=22.6

Q ss_pred             cceeeecceeeeeccceeeeeeecC
Q psy836           65 CKRIVAGGAWDSMKRSCVGIWSCKR   89 (122)
Q Consensus        65 C~~~vAggAy~~~t~~AvtV~s~~r   89 (122)
                      |+++||||||+|+|.+++++.+.|+
T Consensus        59 C~~~~AGGAy~p~T~~~~t~~~~ir   83 (91)
T TIGR00280        59 CGAKFAGGAYTPVTPAGKTVRKTIR   83 (91)
T ss_pred             CCCEEeCCccccccchhHHHHHHHH
Confidence            8999999999999999999877665


No 9  
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=97.20  E-value=4.1e-05  Score=55.02  Aligned_cols=25  Identities=40%  Similarity=0.712  Sum_probs=22.7

Q ss_pred             cceeeecceeeeeccceeeeeeecC
Q psy836           65 CKRIVAGGAWDSMKRSCVGIWSCKR   89 (122)
Q Consensus        65 C~~~vAggAy~~~t~~AvtV~s~~r   89 (122)
                      |+++||||||+|+|.+++++.+.++
T Consensus        60 C~~~~AGGAy~~~T~~~~t~~~~ir   84 (90)
T PTZ00255         60 CKKTVAGGAWTLSTPAASTVRSTIR   84 (90)
T ss_pred             CCCEEeCCccccccchhHHHHHHHH
Confidence            8999999999999999999877665


No 10 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=97.19  E-value=3e-05  Score=55.69  Aligned_cols=27  Identities=26%  Similarity=0.478  Sum_probs=21.3

Q ss_pred             cCcceeeecceeeeeccceeeeeeecC
Q psy836           63 KRCKRIVAGGAWDSMKRSCVGIWSCKR   89 (122)
Q Consensus        63 ~~C~~~vAggAy~~~t~~AvtV~s~~r   89 (122)
                      ++|+++||||||+|+|.+++++++.++
T Consensus        57 ~~C~~~~AGGAy~~~T~~~~t~~~~i~   83 (90)
T PF01780_consen   57 KKCGKKFAGGAYTPSTPAAKTVKRAIR   83 (90)
T ss_dssp             TTTTEEEE-BSSSSS-HHHHHHHHHHH
T ss_pred             CCCCCEEeCCCccccchHHHHHHHHHH
Confidence            048999999999999999999987664


No 11 
>KOG0402|consensus
Probab=96.76  E-value=0.00019  Score=51.96  Aligned_cols=25  Identities=36%  Similarity=0.671  Sum_probs=23.0

Q ss_pred             cceeeecceeeeeccceeeeeeecC
Q psy836           65 CKRIVAGGAWDSMKRSCVGIWSCKR   89 (122)
Q Consensus        65 C~~~vAggAy~~~t~~AvtV~s~~r   89 (122)
                      |++++|||||+++|.+|++++|.++
T Consensus        60 C~kv~agga~~~~t~aa~t~rs~ir   84 (92)
T KOG0402|consen   60 CKKVVAGGAYTVTTAAAATVRSTIR   84 (92)
T ss_pred             ccceeccceEEeccchhHHHHHHHH
Confidence            7889999999999999999988775


No 12 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=95.83  E-value=0.007  Score=37.39  Aligned_cols=27  Identities=30%  Similarity=0.859  Sum_probs=22.6

Q ss_pred             cccCCCCCCceeEeEEe-eeeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSCV-GIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~av-GIW~C~~C~~   67 (122)
                      -+.||.||.....+... +.|.|+.|.+
T Consensus        18 g~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   18 GFVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            46799999987777766 9999999875


No 13 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=94.72  E-value=0.027  Score=35.68  Aligned_cols=25  Identities=28%  Similarity=0.817  Sum_probs=15.7

Q ss_pred             cCCCCCCcee-Ee------EEeeeeeecCcce
Q psy836           43 TCSFCGKDSM-KR------SCVGIWSCKRCKR   67 (122)
Q Consensus        43 ~Cp~Cgk~~m-kR------~avGIW~C~~C~~   67 (122)
                      .|||||.... -|      ...|+|.|..|+-
T Consensus         3 PCPfCGg~~~~~~~~~~~~~~~~~~~C~~Cga   34 (53)
T TIGR03655         3 PCPFCGGADVYLRRGFDPLDLSHYFECSTCGA   34 (53)
T ss_pred             CCCCCCCcceeeEeccCCCCCEEEEECCCCCC
Confidence            6999998754 44      2445566555554


No 14 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=94.39  E-value=0.023  Score=34.85  Aligned_cols=29  Identities=24%  Similarity=0.487  Sum_probs=22.3

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|.||.||.....-...+.++|+.||..
T Consensus         2 ~~y~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          2 AEYKCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             CEEECCCCCCEEEECCCCCceECCCCCCe
Confidence            36899999998655555558899999875


No 15 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=94.29  E-value=0.028  Score=34.11  Aligned_cols=33  Identities=18%  Similarity=0.451  Sum_probs=23.8

Q ss_pred             ccCCCCCCce-eEeEEeeeeeecCcceeeeccee
Q psy836           42 YTCSFCGKDS-MKRSCVGIWSCKRCKRIVAGGAW   74 (122)
Q Consensus        42 y~Cp~Cgk~~-mkR~avGIW~C~~C~~~vAggAy   74 (122)
                      |.||.||... +-=.+.|-..|+.||.++....-
T Consensus         1 m~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl~e~~i   34 (43)
T PF08271_consen    1 MKCPNCGSKEIVFDPERGELVCPNCGLVLEENII   34 (43)
T ss_dssp             ESBTTTSSSEEEEETTTTEEEETTT-BBEE-TTB
T ss_pred             CCCcCCcCCceEEcCCCCeEECCCCCCEeecccc
Confidence            6899999986 34457789999999888765543


No 16 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=93.93  E-value=0.028  Score=36.05  Aligned_cols=26  Identities=23%  Similarity=0.715  Sum_probs=21.4

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCccee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      -.||.||.. +-....+.|+|++|+.+
T Consensus        21 ~fCP~Cg~~-~m~~~~~r~~C~~Cgyt   46 (50)
T PRK00432         21 KFCPRCGSG-FMAEHLDRWHCGKCGYT   46 (50)
T ss_pred             CcCcCCCcc-hheccCCcEECCCcCCE
Confidence            379999997 66666799999888876


No 17 
>PHA00626 hypothetical protein
Probab=93.10  E-value=0.055  Score=36.63  Aligned_cols=33  Identities=18%  Similarity=0.500  Sum_probs=25.0

Q ss_pred             cCCCCCCceeEe-----EEeeeeeecCcceeeecceee
Q psy836           43 TCSFCGKDSMKR-----SCVGIWSCKRCKRIVAGGAWD   75 (122)
Q Consensus        43 ~Cp~Cgk~~mkR-----~avGIW~C~~C~~~vAggAy~   75 (122)
                      .||.||+..+-|     .....+.|+.||..+.-+|+.
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~~~~~   39 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDAFG   39 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeechhhhh
Confidence            599999975555     556789988888887766654


No 18 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=93.10  E-value=0.063  Score=34.65  Aligned_cols=28  Identities=29%  Similarity=0.654  Sum_probs=23.9

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      .-+||.||...-++...-.|.|+.||..
T Consensus        28 Sq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   28 SQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             ccCccCcccccccccccceEEcCCCCCE
Confidence            3469999999877888889999999886


No 19 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=92.17  E-value=0.091  Score=40.49  Aligned_cols=24  Identities=29%  Similarity=0.901  Sum_probs=16.9

Q ss_pred             ccCCCCCCce--------------eEeEEeeeeeecCcceee
Q psy836           42 YTCSFCGKDS--------------MKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        42 y~Cp~Cgk~~--------------mkR~avGIW~C~~C~~~v   69 (122)
                      +.||+||.+.              ++|.    .+|+.||+++
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~~~~~~~~----~~c~~c~~~f   38 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAEDGNAIRRR----RECLACGKRF   38 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCCCCceeee----eeccccCCcc
Confidence            4799999654              3333    7888888874


No 20 
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=91.84  E-value=0.037  Score=35.06  Aligned_cols=15  Identities=27%  Similarity=0.662  Sum_probs=10.9

Q ss_pred             ccCCCCCCceeEeEE
Q psy836           42 YTCSFCGKDSMKRSC   56 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~a   56 (122)
                      ..|||||...+.-..
T Consensus         4 kPCPFCG~~~~~~~~   18 (61)
T PF14354_consen    4 KPCPFCGSADVLIRQ   18 (61)
T ss_pred             cCCCCCCCcceEeec
Confidence            569999988655444


No 21 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=91.71  E-value=0.12  Score=32.02  Aligned_cols=30  Identities=30%  Similarity=0.883  Sum_probs=14.7

Q ss_pred             ccCCCCCCc-eeE----eEEeeeeeecCcceeeecc
Q psy836           42 YTCSFCGKD-SMK----RSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        42 y~Cp~Cgk~-~mk----R~avGIW~C~~C~~~vAgg   72 (122)
                      -.||.||-. +++    ....|-|.|..|+. ++|.
T Consensus         4 ~pCP~CGG~DrFri~~d~~~~G~~~C~~C~~-~~GD   38 (40)
T PF08273_consen    4 GPCPICGGKDRFRIFDDKDGRGTWICRQCGG-DAGD   38 (40)
T ss_dssp             E--TTTT-TTTEEEETT----S-EEETTTTB-E---
T ss_pred             CCCCCCcCccccccCcCcccCCCEECCCCCC-cCCC
Confidence            469999654 666    33459999999955 4543


No 22 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=91.52  E-value=0.073  Score=39.50  Aligned_cols=25  Identities=28%  Similarity=0.690  Sum_probs=17.2

Q ss_pred             hHhHHHHHHHhhccccCCCCCCcee
Q psy836           28 RKMVKKMEITQHAKYTCSFCGKDSM   52 (122)
Q Consensus        28 RK~v~kie~~~~aky~Cp~Cgk~~m   52 (122)
                      |+.++..-......|+|||||...+
T Consensus         9 r~~ik~~~~~L~k~FtCp~Cghe~v   33 (104)
T COG4888           9 RKIIKRRPQVLPKTFTCPRCGHEKV   33 (104)
T ss_pred             cccCcccCccCCceEecCccCCeee
Confidence            4444444444667899999999864


No 23 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=91.42  E-value=0.022  Score=41.16  Aligned_cols=22  Identities=23%  Similarity=0.432  Sum_probs=18.0

Q ss_pred             cceeeecceeeeeccceeeeee
Q psy836           65 CKRIVAGGAWDSMKRSCVGIWS   86 (122)
Q Consensus        65 C~~~vAggAy~~~t~~AvtV~s   86 (122)
                      ||.++|||||++.|.++.++.+
T Consensus        59 Cg~~fAGgay~P~t~~~k~~~~   80 (89)
T COG1997          59 CGAKFAGGAYTPVTPAGKAVKR   80 (89)
T ss_pred             CCCeeccccccccchHHHHHHH
Confidence            7889999999998887766543


No 24 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=90.84  E-value=0.16  Score=49.65  Aligned_cols=67  Identities=24%  Similarity=0.456  Sum_probs=37.8

Q ss_pred             hccccCCCCCCceeEeEE-------eeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchHHHHHHH
Q psy836           39 HAKYTCSFCGKDSMKRSC-------VGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRS  111 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~a-------vGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~~~~~~~  111 (122)
                      -....||.||.......+       ..+|.|+.|+....             -..|.+||.....+.+. .-+....+++
T Consensus       624 Vg~RfCpsCG~~t~~frCP~CG~~Te~i~fCP~CG~~~~-------------~y~CPKCG~El~~~s~~-~i~l~~~~~~  689 (1121)
T PRK04023        624 IGRRKCPSCGKETFYRRCPFCGTHTEPVYRCPRCGIEVE-------------EDECEKCGREPTPYSKR-KIDLKELYDR  689 (1121)
T ss_pred             ccCccCCCCCCcCCcccCCCCCCCCCcceeCccccCcCC-------------CCcCCCCCCCCCccceE-EecHHHHHHH
Confidence            356678888777432211       23445555544311             12277777777666543 3456667777


Q ss_pred             HHHHHHHh
Q psy836          112 AIRRLREV  119 (122)
Q Consensus       112 ~i~rl~e~  119 (122)
                      |+.+|.+-
T Consensus       690 A~~~lg~~  697 (1121)
T PRK04023        690 ALENLGER  697 (1121)
T ss_pred             HHHHhCCc
Confidence            88877653


No 25 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=90.39  E-value=0.23  Score=30.23  Aligned_cols=32  Identities=16%  Similarity=0.344  Sum_probs=23.6

Q ss_pred             cCCCCCCceeEeEEee--eeeecCcceeeeccee
Q psy836           43 TCSFCGKDSMKRSCVG--IWSCKRCKRIVAGGAW   74 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avG--IW~C~~C~~~vAggAy   74 (122)
                      .||.||........-+  .|.|+.|+....-+++
T Consensus         2 FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~~~~~~~   35 (52)
T smart00661        2 FCPKCGNMLIPKEGKEKRRFVCRKCGYEEPIEQK   35 (52)
T ss_pred             CCCCCCCccccccCCCCCEEECCcCCCeEECCCc
Confidence            6999999875554432  7999999887666665


No 26 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=90.34  E-value=0.17  Score=38.86  Aligned_cols=22  Identities=32%  Similarity=0.853  Sum_probs=18.7

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCccee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      =.||.||.     ...+.|.|+.||.+
T Consensus       310 ~~C~~cg~-----~~~r~~~C~~cg~~  331 (364)
T COG0675         310 KTCPCCGH-----LSGRLFKCPRCGFV  331 (364)
T ss_pred             ccccccCC-----ccceeEECCCCCCe
Confidence            35999999     66889999999986


No 27 
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=88.52  E-value=0.12  Score=35.32  Aligned_cols=19  Identities=26%  Similarity=0.655  Sum_probs=14.3

Q ss_pred             cCCCCCCceeEeEEeeeee
Q psy836           43 TCSFCGKDSMKRSCVGIWS   61 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~   61 (122)
                      .|||||...+.-.+.+-|-
T Consensus         8 PCPFCG~~~~~v~~~~g~~   26 (64)
T PRK09710          8 PCPFCGCPSVTVKAISGYY   26 (64)
T ss_pred             CCCCCCCceeEEEecCceE
Confidence            5999999987666656554


No 28 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=88.52  E-value=0.22  Score=32.85  Aligned_cols=30  Identities=20%  Similarity=0.595  Sum_probs=18.1

Q ss_pred             hccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           39 HAKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..+-.||.||--.+==.----|+|.+||.+
T Consensus        17 rk~~~CPrCG~gvfmA~H~dR~~CGkCgyT   46 (51)
T COG1998          17 RKNRFCPRCGPGVFMADHKDRWACGKCGYT   46 (51)
T ss_pred             EccccCCCCCCcchhhhcCceeEeccccce
Confidence            356679999953211111125998888875


No 29 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=88.27  E-value=0.52  Score=41.56  Aligned_cols=37  Identities=30%  Similarity=0.795  Sum_probs=28.3

Q ss_pred             hhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcce
Q psy836           26 SLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        26 slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      .||++|.+ .+.+...|.|..||-.+    -+=-|+||+|+.
T Consensus       340 ~lr~mvge-~l~~~~~YRC~~CGF~a----~~l~W~CPsC~~  376 (389)
T COG2956         340 LLRDMVGE-QLRRKPRYRCQNCGFTA----HTLYWHCPSCRA  376 (389)
T ss_pred             HHHHHHHH-HHhhcCCceecccCCcc----eeeeeeCCCccc
Confidence            36666665 35678899999999875    345699999986


No 30 
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=87.84  E-value=0.61  Score=33.95  Aligned_cols=33  Identities=21%  Similarity=0.633  Sum_probs=21.7

Q ss_pred             cCC--CCCCceeEeEEeeeeeecCcceeeecceeee
Q psy836           43 TCS--FCGKDSMKRSCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        43 ~Cp--~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~   76 (122)
                      -||  .|+|.-.. ..-|.|.|++|++.+..--|-+
T Consensus        20 aC~~~~C~kKv~~-~~~~~y~C~~C~~~~~~~~~ry   54 (146)
T PF08646_consen   20 ACPNEKCNKKVTE-NGDGSYRCEKCNKTVENPKYRY   54 (146)
T ss_dssp             E-TSTTTS-B-EE-ETTTEEEETTTTEEESS-EEEE
T ss_pred             CCCCccCCCEeec-CCCcEEECCCCCCcCCCeeEEE
Confidence            499  99986433 3668999999999876555555


No 31 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=87.83  E-value=0.3  Score=29.45  Aligned_cols=27  Identities=30%  Similarity=0.663  Sum_probs=22.7

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ...|+.|+.. .-...-|.|.|.+||-+
T Consensus         8 ~~~C~~C~~~-~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    8 NEPCPVCGSR-WFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CCcCCCCCCe-EeEccCCEEEhhhCceE
Confidence            3459999999 88899999998888764


No 32 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=87.52  E-value=0.17  Score=36.73  Aligned_cols=34  Identities=26%  Similarity=0.598  Sum_probs=21.3

Q ss_pred             HHHHHhhccccCCCCCCcee----EeEEeeeeeecCcce
Q psy836           33 KMEITQHAKYTCSFCGKDSM----KRSCVGIWSCKRCKR   67 (122)
Q Consensus        33 kie~~~~aky~Cp~Cgk~~m----kR~avGIW~C~~C~~   67 (122)
                      +...+...-+.||+||...+    .| ..+.-.|+.||.
T Consensus        13 k~k~klpt~f~CP~Cge~~v~v~~~k-~~~h~~C~~CG~   50 (99)
T PRK14892         13 RPKPKLPKIFECPRCGKVSISVKIKK-NIAIITCGNCGL   50 (99)
T ss_pred             ccccCCCcEeECCCCCCeEeeeecCC-CcceEECCCCCC
Confidence            33445567789999996544    23 445566666654


No 33 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.25  E-value=0.34  Score=32.69  Aligned_cols=14  Identities=29%  Similarity=0.767  Sum_probs=8.6

Q ss_pred             hccccCCCCCCcee
Q psy836           39 HAKYTCSFCGKDSM   52 (122)
Q Consensus        39 ~aky~Cp~Cgk~~m   52 (122)
                      ..+|.||.||...+
T Consensus        23 ~~~F~CPnCG~~~I   36 (59)
T PRK14890         23 AVKFLCPNCGEVII   36 (59)
T ss_pred             cCEeeCCCCCCeeE
Confidence            35667777776533


No 34 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=86.94  E-value=0.4  Score=39.63  Aligned_cols=39  Identities=21%  Similarity=0.505  Sum_probs=31.0

Q ss_pred             HHHHhhccccCCCCCCce-eEeEEeeeeeecCcceeeecc
Q psy836           34 MEITQHAKYTCSFCGKDS-MKRSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        34 ie~~~~aky~Cp~Cgk~~-mkR~avGIW~C~~C~~~vAgg   72 (122)
                      .+........||.||.+. +.-...|..-|..||.++...
T Consensus         4 ~~~~~~~~~~Cp~Cg~~~iv~d~~~Ge~vC~~CG~Vl~e~   43 (310)
T PRK00423          4 LVLEEEEKLVCPECGSDKLIYDYERGEIVCADCGLVIEEN   43 (310)
T ss_pred             hhhhcccCCcCcCCCCCCeeEECCCCeEeecccCCccccc
Confidence            345556677899999854 566789999999999998765


No 35 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=86.81  E-value=0.72  Score=36.66  Aligned_cols=53  Identities=25%  Similarity=0.474  Sum_probs=38.2

Q ss_pred             CCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccC
Q psy836           44 CSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYN  102 (122)
Q Consensus        44 Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~  102 (122)
                      ||.||++.-. .--|  -|+.|=..-.+=+-   ....+.|--|..||..+-+|.|...
T Consensus         1 C~~CG~~~~~-~~~~--lC~~C~~~~~~i~e---i~~~i~v~~C~~Cg~~~~~~~W~~~   53 (236)
T PF04981_consen    1 CPRCGREIEP-LIDG--LCPDCYLKRFDIIE---IPDRIEVTICPKCGRYRIGGRWVDP   53 (236)
T ss_pred             CCCCCCCCCC-cccc--cChHHhcccCCeee---cCCccCceECCCCCCEECCCEeeec
Confidence            9999996533 2223  79999776554333   3344577779999999999999987


No 36 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=86.61  E-value=0.52  Score=47.03  Aligned_cols=32  Identities=22%  Similarity=0.316  Sum_probs=17.1

Q ss_pred             ecCcCeEEeccccccCchHHHHHHHHHHHHHHh
Q psy836           87 CKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV  119 (122)
Q Consensus        87 ~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~  119 (122)
                      |.+|+...-.-.+. .-+....+++|+.+|.+-
T Consensus       712 CP~CGtplv~~~~~-~i~~~~~~~~A~~~~g~~  743 (1337)
T PRK14714        712 CPRCDVELTPYQRR-TINVKEEYRSALENVGER  743 (1337)
T ss_pred             CCCCCCcccccceE-EecHHHHHHHHHHHhCcc
Confidence            66665433322221 334566777788777553


No 37 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=85.73  E-value=1  Score=31.20  Aligned_cols=18  Identities=22%  Similarity=0.599  Sum_probs=5.4

Q ss_pred             HHHHhhccccCCCCC-Cce
Q psy836           34 MEITQHAKYTCSFCG-KDS   51 (122)
Q Consensus        34 ie~~~~aky~Cp~Cg-k~~   51 (122)
                      -.......+.||||+ ..+
T Consensus        15 ~~~~l~~~F~CPfC~~~~s   33 (81)
T PF05129_consen   15 KKPKLPKVFDCPFCNHEKS   33 (81)
T ss_dssp             -----SS----TTT--SS-
T ss_pred             cCCCCCceEcCCcCCCCCe
Confidence            334555789999999 544


No 38 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.49  E-value=0.62  Score=27.00  Aligned_cols=27  Identities=22%  Similarity=0.498  Sum_probs=17.3

Q ss_pred             cccCCCCCCceeEeEE---eeeeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSC---VGIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~a---vGIW~C~~C~~   67 (122)
                      .|.|+.||..--....   -..-.|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKISDDPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEecCCCCCCCCCCCCC
Confidence            5789999985322222   33667888876


No 39 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=85.41  E-value=0.45  Score=35.38  Aligned_cols=32  Identities=25%  Similarity=0.573  Sum_probs=18.8

Q ss_pred             hhccccCCCCCCceeEeE------EeeeeeecCcceee
Q psy836           38 QHAKYTCSFCGKDSMKRS------CVGIWSCKRCKRIV   69 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~------avGIW~C~~C~~~v   69 (122)
                      ...-|.||.||..---=.      -.|.-.||.||..+
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEE
Confidence            345789999986521101      13447777777653


No 40 
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=85.31  E-value=0.26  Score=47.32  Aligned_cols=66  Identities=23%  Similarity=0.528  Sum_probs=0.0

Q ss_pred             hccccCCCCCCceeEeEE--ee-----eeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchHHHHHHH
Q psy836           39 HAKYTCSFCGKDSMKRSC--VG-----IWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRS  111 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~a--vG-----IW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~~~~~~~  111 (122)
                      -..+.||.||+.++...+  -|     +|.|+.|+..+-.+             .|.+|+.....-.+ .+-+....+++
T Consensus       653 i~~r~Cp~Cg~~t~~~~Cp~CG~~T~~~~~Cp~C~~~~~~~-------------~C~~C~~~~~~~~~-~~i~l~~~~~~  718 (900)
T PF03833_consen  653 IGRRRCPKCGKETFYNRCPECGSHTEPVYVCPDCGIEVEED-------------ECPKCGRETTSYSK-QKIDLKEEYDR  718 (900)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             eecccCcccCCcchhhcCcccCCccccceeccccccccCcc-------------ccccccccCcccce-eecCHHHHHHH
Confidence            367789999999887766  23     56788888875554             58888876433222 23445555666


Q ss_pred             HHHHHHH
Q psy836          112 AIRRLRE  118 (122)
Q Consensus       112 ~i~rl~e  118 (122)
                      |+.+|-+
T Consensus       719 A~e~lg~  725 (900)
T PF03833_consen  719 ALENLGE  725 (900)
T ss_dssp             -------
T ss_pred             HHHhhcc
Confidence            6666654


No 41 
>PRK11823 DNA repair protein RadA; Provisional
Probab=84.46  E-value=0.42  Score=41.45  Aligned_cols=32  Identities=31%  Similarity=0.801  Sum_probs=25.1

Q ss_pred             hhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeecc
Q psy836           38 QHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKR   79 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~   79 (122)
                      .+..|.|..||...-+..    |+||.|+      +|....-
T Consensus         4 ~~~~y~C~~Cg~~~~~~~----g~Cp~C~------~w~t~~e   35 (446)
T PRK11823          4 KKTAYVCQECGAESPKWL----GRCPECG------AWNTLVE   35 (446)
T ss_pred             CCCeEECCcCCCCCcccC----eeCcCCC------Cccceee
Confidence            356799999999988875    9999995      4655544


No 42 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=83.28  E-value=0.57  Score=29.39  Aligned_cols=12  Identities=42%  Similarity=1.334  Sum_probs=9.6

Q ss_pred             cccCCCCCCceeE
Q psy836           41 KYTCSFCGKDSMK   53 (122)
Q Consensus        41 ky~Cp~Cgk~~mk   53 (122)
                      .|+|||||+ .+-
T Consensus         2 ~f~CP~C~~-~~~   13 (54)
T PF05605_consen    2 SFTCPYCGK-GFS   13 (54)
T ss_pred             CcCCCCCCC-ccC
Confidence            689999999 444


No 43 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=83.26  E-value=0.75  Score=31.82  Aligned_cols=22  Identities=32%  Similarity=0.588  Sum_probs=10.5

Q ss_pred             hccccCCCCCCceeEeEEeeee
Q psy836           39 HAKYTCSFCGKDSMKRSCVGIW   60 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~avGIW   60 (122)
                      -.+..||.||-..+.|.++.+=
T Consensus        22 ~~k~FCp~CGn~TL~rvsvsv~   43 (73)
T PF08772_consen   22 MTKQFCPKCGNATLKRVSVSVD   43 (73)
T ss_dssp             SS--S-SSS--S--EEEE-B--
T ss_pred             CCceeCcccCCCcceEEEEEEC
Confidence            3678999999999999998753


No 44 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=82.54  E-value=0.58  Score=40.85  Aligned_cols=32  Identities=34%  Similarity=0.908  Sum_probs=25.1

Q ss_pred             hhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeecc
Q psy836           38 QHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKR   79 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~   79 (122)
                      .+..|.|..||-..-+..    |+||.|+      +|.....
T Consensus         4 ~~~~y~C~~Cg~~~~~~~----g~Cp~C~------~w~t~~~   35 (454)
T TIGR00416         4 AKSKFVCQHCGADSPKWQ----GKCPACH------AWNTITE   35 (454)
T ss_pred             CCCeEECCcCCCCCcccc----EECcCCC------Cccccch
Confidence            356799999999988875    9999995      4665554


No 45 
>PRK12366 replication factor A; Reviewed
Probab=82.44  E-value=0.86  Score=41.52  Aligned_cols=23  Identities=26%  Similarity=0.683  Sum_probs=10.1

Q ss_pred             CCCCCCceeEeEEeeeeeecCccee
Q psy836           44 CSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        44 Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ||.|.|.-..  .-|.|.|++|+++
T Consensus       535 Cp~CnkKv~~--~~g~~~C~~c~~~  557 (637)
T PRK12366        535 CPNCRKRVEE--VDGEYICEFCGEV  557 (637)
T ss_pred             ccccCeEeEc--CCCcEECCCCCCC
Confidence            5555443321  2344555555544


No 46 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=82.19  E-value=1.5  Score=30.36  Aligned_cols=26  Identities=23%  Similarity=0.733  Sum_probs=17.5

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeee
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVA   70 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vA   70 (122)
                      .||.|+.. |.+.. |.++|..|.+-+.
T Consensus         3 ~CP~C~~~-L~~~~-~~~~C~~C~~~~~   28 (70)
T PF07191_consen    3 TCPKCQQE-LEWQG-GHYHCEACQKDYK   28 (70)
T ss_dssp             B-SSS-SB-EEEET-TEEEETTT--EEE
T ss_pred             cCCCCCCc-cEEeC-CEEECccccccce
Confidence            69999988 77666 8999999998643


No 47 
>PHA02942 putative transposase; Provisional
Probab=81.85  E-value=0.72  Score=39.56  Aligned_cols=26  Identities=19%  Similarity=0.520  Sum_probs=18.4

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCccee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      -+||.||... ++.+...|.|+.||..
T Consensus       326 q~Cs~CG~~~-~~l~~r~f~C~~CG~~  351 (383)
T PHA02942        326 VSCPKCGHKM-VEIAHRYFHCPSCGYE  351 (383)
T ss_pred             ccCCCCCCcc-CcCCCCEEECCCCCCE
Confidence            4599999754 3445568998888875


No 48 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=81.77  E-value=0.4  Score=27.19  Aligned_cols=13  Identities=15%  Similarity=0.202  Sum_probs=7.1

Q ss_pred             eeeeeecCcCeEE
Q psy836           82 VGIWSCKRCKRIV   94 (122)
Q Consensus        82 vtV~s~~rC~~~~   94 (122)
                      +..+.|..||+.|
T Consensus        12 ~~~~~Cp~CG~~F   24 (26)
T PF10571_consen   12 ESAKFCPHCGYDF   24 (26)
T ss_pred             hhcCcCCCCCCCC
Confidence            3344466666654


No 49 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=80.48  E-value=1.3  Score=32.75  Aligned_cols=33  Identities=21%  Similarity=0.635  Sum_probs=22.3

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecceeee
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~   76 (122)
                      -||.|.|... -...|.|.|.+|+..+.---|-|
T Consensus        36 aC~~C~kkv~-~~~~~~~~C~~C~~~~~~~~~ry   68 (166)
T cd04476          36 ACPGCNKKVV-EEGNGTYRCEKCNKSVPNPEYRY   68 (166)
T ss_pred             cccccCcccE-eCCCCcEECCCCCCcCCCccEEE
Confidence            4999988643 22238899999998875444444


No 50 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=80.26  E-value=1  Score=24.67  Aligned_cols=15  Identities=40%  Similarity=1.008  Sum_probs=11.3

Q ss_pred             HHhhccccCCCCCCc
Q psy836           36 ITQHAKYTCSFCGKD   50 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~   50 (122)
                      -+...+|.||.|++.
T Consensus         9 H~~~k~~~C~~C~k~   23 (26)
T PF13465_consen    9 HTGEKPYKCPYCGKS   23 (26)
T ss_dssp             HSSSSSEEESSSSEE
T ss_pred             cCCCCCCCCCCCcCe
Confidence            345578999999875


No 51 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=80.12  E-value=1.1  Score=28.03  Aligned_cols=27  Identities=26%  Similarity=0.813  Sum_probs=17.8

Q ss_pred             cccCCCCCCce-eEeEEeeeeeecCcceee
Q psy836           41 KYTCSFCGKDS-MKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        41 ky~Cp~Cgk~~-mkR~avGIW~C~~C~~~v   69 (122)
                      .|.|..||..- ++  ..+.=.|+.||..|
T Consensus         2 ~Y~C~~Cg~~~~~~--~~~~irC~~CG~rI   29 (44)
T smart00659        2 IYICGECGRENEIK--SKDVVRCRECGYRI   29 (44)
T ss_pred             EEECCCCCCEeecC--CCCceECCCCCceE
Confidence            48888888863 43  23445788887764


No 52 
>PF12773 DZR:  Double zinc ribbon
Probab=79.16  E-value=0.47  Score=28.87  Aligned_cols=27  Identities=19%  Similarity=0.303  Sum_probs=15.0

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~v   69 (122)
                      ..||.||.... ......+.|+.|+..+
T Consensus        13 ~fC~~CG~~l~-~~~~~~~~C~~Cg~~~   39 (50)
T PF12773_consen   13 KFCPHCGTPLP-PPDQSKKICPNCGAEN   39 (50)
T ss_pred             cCChhhcCChh-hccCCCCCCcCCcCCC
Confidence            45666766654 3333445666666653


No 53 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=79.14  E-value=1.7  Score=36.42  Aligned_cols=35  Identities=20%  Similarity=0.470  Sum_probs=29.0

Q ss_pred             ccCCCCCCceeEe-EEeeeeeecCcceeeecceeee
Q psy836           42 YTCSFCGKDSMKR-SCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        42 y~Cp~Cgk~~mkR-~avGIW~C~~C~~~vAggAy~~   76 (122)
                      +.||.||.+.+-. ...|-|-|..||-++-+...++
T Consensus         2 ~~CpeCg~~~~~~d~~~ge~VC~~CG~Vi~~~~id~   37 (285)
T COG1405           2 MSCPECGSTNIITDYERGEIVCADCGLVLEDSLIDP   37 (285)
T ss_pred             CCCCCCCCccceeeccCCeEEeccCCEEeccccccC
Confidence            5799999996555 4789999999999998876654


No 54 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.07  E-value=0.96  Score=35.56  Aligned_cols=23  Identities=22%  Similarity=0.684  Sum_probs=10.7

Q ss_pred             hhhHhHHHHHHHhhccccCCCCCCc
Q psy836           26 SLRKMVKKMEITQHAKYTCSFCGKD   50 (122)
Q Consensus        26 slRK~v~kie~~~~aky~Cp~Cgk~   50 (122)
                      -+|+-++.++..+  -|.||.||-+
T Consensus       121 ~~~~~Le~~~~~~--~~vC~vCGy~  143 (166)
T COG1592         121 MFRGLLERLEEGK--VWVCPVCGYT  143 (166)
T ss_pred             HHHHHHHhhhcCC--EEEcCCCCCc
Confidence            3455555555444  3444444433


No 55 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=78.49  E-value=4.8  Score=23.40  Aligned_cols=43  Identities=19%  Similarity=0.390  Sum_probs=24.1

Q ss_pred             CCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEe
Q psy836           44 CSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVA   95 (122)
Q Consensus        44 Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~A   95 (122)
                      ||+||...+.+...-.+--      . ||  ....-..+-.|.|..||+.+-
T Consensus         1 C~~C~~~~~~~~~~~~~~~------~-~~--~~~~i~~vp~~~C~~CGE~~~   43 (46)
T TIGR03831         1 CPICGGEELEGKTTTETYE------Y-GG--ELIVIENVPALVCPQCGEEYL   43 (46)
T ss_pred             CCCCCCceecceEEEEEEE------e-CC--EEEEEeCCCccccccCCCEee
Confidence            8999777766666444331      1 11  112223445566888887764


No 56 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=78.32  E-value=1.5  Score=33.50  Aligned_cols=26  Identities=23%  Similarity=0.429  Sum_probs=22.4

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      .+.||.||.+.++  -.|-=.||-|+.+
T Consensus        28 ~~hCp~Cg~PLF~--KdG~v~CPvC~~~   53 (131)
T COG1645          28 AKHCPKCGTPLFR--KDGEVFCPVCGYR   53 (131)
T ss_pred             HhhCcccCCccee--eCCeEECCCCCce
Confidence            4679999999999  7888899988854


No 57 
>KOG2462|consensus
Probab=77.08  E-value=1.2  Score=37.88  Aligned_cols=68  Identities=29%  Similarity=0.501  Sum_probs=47.1

Q ss_pred             HHHHHHhhc-cccCCCCCCcee--------EeEEeee--eeecCcceeeecceee---eeccceeeeeeecCcCeEEecc
Q psy836           32 KKMEITQHA-KYTCSFCGKDSM--------KRSCVGI--WSCKRCKRIVAGGAWD---SMKRSCVGIWSCKRCKRIVAGG   97 (122)
Q Consensus        32 ~kie~~~~a-ky~Cp~Cgk~~m--------kR~avGI--W~C~~C~~~vAggAy~---~~t~~AvtV~s~~rC~~~~AGG   97 (122)
                      .++++.-|. .+.|++|||.--        -|+-+|.  ..|++|+|.+||--=-   .-|-+.+-=-.|.+|+++||==
T Consensus       177 LkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  177 LKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             HhhHhhccCCCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHH
Confidence            356666676 899999999743        5777774  7899999999885321   1233344445699999988743


Q ss_pred             cc
Q psy836           98 AW   99 (122)
Q Consensus        98 Ay   99 (122)
                      .|
T Consensus       257 Sy  258 (279)
T KOG2462|consen  257 SY  258 (279)
T ss_pred             HH
Confidence            33


No 58 
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=76.45  E-value=1.3  Score=37.85  Aligned_cols=28  Identities=36%  Similarity=0.800  Sum_probs=22.4

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeeeecc
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKR   79 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~   79 (122)
                      |.|..||....+..    |+||.|+      +|....-
T Consensus         1 ~~c~~cg~~~~~~~----g~cp~c~------~w~~~~e   28 (372)
T cd01121           1 YVCSECGYVSPKWL----GKCPECG------EWNTLVE   28 (372)
T ss_pred             CCCCCCCCCCCCcc----EECcCCC------Cceeeee
Confidence            78999999998875    8999996      4665544


No 59 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=76.40  E-value=1.5  Score=24.75  Aligned_cols=9  Identities=33%  Similarity=1.169  Sum_probs=4.2

Q ss_pred             ccccCCCCC
Q psy836           40 AKYTCSFCG   48 (122)
Q Consensus        40 aky~Cp~Cg   48 (122)
                      ..|.||.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            344444444


No 60 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=76.15  E-value=3.6  Score=24.59  Aligned_cols=23  Identities=30%  Similarity=0.741  Sum_probs=12.2

Q ss_pred             cCCCCCCceeEeEE---eeeeeecCcc
Q psy836           43 TCSFCGKDSMKRSC---VGIWSCKRCK   66 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~a---vGIW~C~~C~   66 (122)
                      +||.|+.. |....   +-|..|+.|+
T Consensus         1 ~CP~C~~~-l~~~~~~~~~id~C~~C~   26 (41)
T PF13453_consen    1 KCPRCGTE-LEPVRLGDVEIDVCPSCG   26 (41)
T ss_pred             CcCCCCcc-cceEEECCEEEEECCCCC
Confidence            48888774 44333   2345544443


No 61 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=75.86  E-value=1  Score=30.38  Aligned_cols=31  Identities=19%  Similarity=0.466  Sum_probs=23.1

Q ss_pred             hhccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           38 QHAKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      +..+..|..||....-+.-.-...|+.||..
T Consensus         4 ~~~~~~CtSCg~~i~~~~~~~~F~CPnCG~~   34 (59)
T PRK14890          4 MMEPPKCTSCGIEIAPREKAVKFLCPNCGEV   34 (59)
T ss_pred             cccCccccCCCCcccCCCccCEeeCCCCCCe
Confidence            4466789999999877774456778888775


No 62 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=75.45  E-value=7  Score=26.34  Aligned_cols=41  Identities=27%  Similarity=0.613  Sum_probs=22.2

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeeccee----eeeccceeeeeeecCcCeE
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAW----DSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy----~~~t~~AvtV~s~~rC~~~   93 (122)
                      |.||.||.....=..+          ...||.|    +..... ..+-+|.+||++
T Consensus         1 y~C~KCg~~~~e~~~v----------~~tgg~~skiFdvq~~~-f~~v~C~~CGYT   45 (64)
T PF09855_consen    1 YKCPKCGNEEYESGEV----------RATGGGLSKIFDVQNKK-FTTVSCTNCGYT   45 (64)
T ss_pred             CCCCCCCCcceecceE----------EccCCeeEEEEEecCcE-EEEEECCCCCCE
Confidence            6788888764222111          1233333    223333 445589999987


No 63 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=75.31  E-value=0.78  Score=31.27  Aligned_cols=13  Identities=31%  Similarity=0.848  Sum_probs=8.3

Q ss_pred             hccccCCCCCCce
Q psy836           39 HAKYTCSFCGKDS   51 (122)
Q Consensus        39 ~aky~Cp~Cgk~~   51 (122)
                      ..+|.||.||...
T Consensus        25 ~v~F~CPnCGe~~   37 (61)
T COG2888          25 AVKFPCPNCGEVE   37 (61)
T ss_pred             eeEeeCCCCCcee
Confidence            3567777777543


No 64 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=74.83  E-value=1.7  Score=42.88  Aligned_cols=14  Identities=21%  Similarity=0.546  Sum_probs=8.0

Q ss_pred             EEeeeeeecCccee
Q psy836           55 SCVGIWSCKRCKRI   68 (122)
Q Consensus        55 ~avGIW~C~~C~~~   68 (122)
                      ..+|.-.|+.||..
T Consensus       622 VEVg~RfCpsCG~~  635 (1121)
T PRK04023        622 VEIGRRKCPSCGKE  635 (1121)
T ss_pred             ecccCccCCCCCCc
Confidence            34555566666654


No 65 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=74.31  E-value=1.6  Score=30.23  Aligned_cols=27  Identities=22%  Similarity=0.557  Sum_probs=20.5

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeec
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAG   71 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAg   71 (122)
                      .||.||......  .+.+.|+.|+.+..-
T Consensus         2 fC~~Cg~~l~~~--~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         2 FCPKCGSLMTPK--NGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCcccCcccccC--CCeEECcCCCCcccc
Confidence            599999887654  368999999976553


No 66 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=74.29  E-value=5.8  Score=31.41  Aligned_cols=60  Identities=18%  Similarity=0.362  Sum_probs=34.8

Q ss_pred             ccccCCCCCCc-eeEeEEeeeeee---cCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCc
Q psy836           40 AKYTCSFCGKD-SMKRSCVGIWSC---KRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNT  103 (122)
Q Consensus        40 aky~Cp~Cgk~-~mkR~avGIW~C---~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T  103 (122)
                      .+.+||+|++. ..++.-+|--.-   -.=-.    --|.-..+---.||.|..||+.+.-.-|..-+
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~----~~Y~~vnP~~Y~V~vCP~CgyA~~~~~F~~l~   67 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFC----PRYKGVNPLFYEVWVCPHCGYAAFEEDFEKLS   67 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCc----cccCCCCCeeeeEEECCCCCCcccccccccCC
Confidence            57899999987 344433322110   00000    01223455667788899999988877776433


No 67 
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=73.33  E-value=0.62  Score=34.70  Aligned_cols=65  Identities=14%  Similarity=0.193  Sum_probs=44.7

Q ss_pred             hhccccCCCCCCceeEeE-----EeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchH
Q psy836           38 QHAKYTCSFCGKDSMKRS-----CVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTA  105 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~-----avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~  105 (122)
                      ++-+=.||+|+...+.+.     ..--|.|+.|++++..---++...   ....+..|..+++.+.+.+.-.+
T Consensus        27 ~~~~~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~~~~~~~~---~~~~~~~~~~~~~~~~~~i~~~a   96 (129)
T COG3677          27 QITKVNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVETGSPLSK---ALYKIKLQAVTLYMLGLGIRDIA   96 (129)
T ss_pred             hcccCcCCCCCccceeeECCccccccccccCCcCcceeeeccCcccc---cchHHHHHHHHHHHcCCCcccHH
Confidence            445578999998873332     355689999999866544444333   66778888888888877665443


No 68 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=72.22  E-value=1.7  Score=43.57  Aligned_cols=39  Identities=21%  Similarity=0.604  Sum_probs=29.0

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEecc
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGG   97 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGG   97 (122)
                      .+.||.||.....      ..|+.||...            ..+..|..||..+...
T Consensus       667 ~rkCPkCG~~t~~------~fCP~CGs~t------------e~vy~CPsCGaev~~d  705 (1337)
T PRK14714        667 RRRCPSCGTETYE------NRCPDCGTHT------------EPVYVCPDCGAEVPPD  705 (1337)
T ss_pred             EEECCCCCCcccc------ccCcccCCcC------------CCceeCccCCCccCCC
Confidence            4899999997543      3999999862            1245799999987544


No 69 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=72.20  E-value=1.5  Score=25.38  Aligned_cols=24  Identities=29%  Similarity=0.707  Sum_probs=12.2

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      |.|+.||-.-..  ...-|.|+-|+.
T Consensus         2 ~~C~~CGy~y~~--~~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDG--EEAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECC--CcCCCcCcCCCC
Confidence            556666654221  125566666653


No 70 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=71.90  E-value=9.1  Score=23.15  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=7.9

Q ss_pred             ccCCCCCCceeE
Q psy836           42 YTCSFCGKDSMK   53 (122)
Q Consensus        42 y~Cp~Cgk~~mk   53 (122)
                      +.||.||....-
T Consensus         1 ~~Cp~C~~~~a~   12 (40)
T smart00440        1 APCPKCGNREAT   12 (40)
T ss_pred             CcCCCCCCCeEE
Confidence            468888876433


No 71 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=71.60  E-value=5  Score=23.75  Aligned_cols=28  Identities=21%  Similarity=0.357  Sum_probs=20.5

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ...|+.||...+--..-++..|..|+.+
T Consensus         3 ~~~C~~C~~~~i~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    3 LKKCSKCGGNGIVNKEDDYEVCIFCGSS   30 (33)
T ss_pred             ceEcCCCCCCeEEEecCCeEEcccCCcE
Confidence            3568888888776677777887777765


No 72 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=70.85  E-value=2.9  Score=25.55  Aligned_cols=27  Identities=26%  Similarity=0.779  Sum_probs=18.3

Q ss_pred             cccCCCCCCc-eeE---eEEeeeeeecCcce
Q psy836           41 KYTCSFCGKD-SMK---RSCVGIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~-~mk---R~avGIW~C~~C~~   67 (122)
                      .-.||.||.. +++   +...|-|.|..|+.
T Consensus         3 ~~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        3 HGPCPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             ccCCCCCCCccccccccCCCCcCEEeCCCCC
Confidence            3469999654 554   22349999988863


No 73 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=70.01  E-value=1.1  Score=26.62  Aligned_cols=9  Identities=44%  Similarity=1.316  Sum_probs=5.3

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      |.|..||..
T Consensus         1 Y~C~~Cg~~    9 (32)
T PF03604_consen    1 YICGECGAE    9 (32)
T ss_dssp             EBESSSSSS
T ss_pred             CCCCcCCCe
Confidence            456666655


No 74 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=69.70  E-value=2.2  Score=23.90  Aligned_cols=23  Identities=26%  Similarity=0.739  Sum_probs=14.6

Q ss_pred             eeeeecCcceeeecceeeeeccceeeeeeecCcC
Q psy836           58 GIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCK   91 (122)
Q Consensus        58 GIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~   91 (122)
                      |.|.|..|...           +...-..|..|+
T Consensus         3 g~W~C~~C~~~-----------N~~~~~~C~~C~   25 (30)
T PF00641_consen    3 GDWKCPSCTFM-----------NPASRSKCVACG   25 (30)
T ss_dssp             SSEEETTTTEE-----------EESSSSB-TTT-
T ss_pred             cCccCCCCcCC-----------chHHhhhhhCcC
Confidence            67999999875           344444577775


No 75 
>PRK00420 hypothetical protein; Validated
Probab=69.54  E-value=6.4  Score=29.20  Aligned_cols=28  Identities=18%  Similarity=0.349  Sum_probs=20.0

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ....||.||.+.++= -.|--.|+.|+..
T Consensus        22 l~~~CP~Cg~pLf~l-k~g~~~Cp~Cg~~   49 (112)
T PRK00420         22 LSKHCPVCGLPLFEL-KDGEVVCPVHGKV   49 (112)
T ss_pred             ccCCCCCCCCcceec-CCCceECCCCCCe
Confidence            346799999887762 4566787777764


No 76 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=68.89  E-value=3.5  Score=25.24  Aligned_cols=27  Identities=22%  Similarity=0.657  Sum_probs=16.2

Q ss_pred             cccCCCCCCce-eEeE-E-eeeeeecCcce
Q psy836           41 KYTCSFCGKDS-MKRS-C-VGIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~-mkR~-a-vGIW~C~~C~~   67 (122)
                      .|.|+.||..- +-+. + -..-.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            57888888742 2221 1 13456888886


No 77 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=68.16  E-value=2.2  Score=21.16  Aligned_cols=9  Identities=44%  Similarity=1.471  Sum_probs=3.7

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      |.||.|++.
T Consensus         1 ~~C~~C~~~    9 (24)
T PF13894_consen    1 FQCPICGKS    9 (24)
T ss_dssp             EE-SSTS-E
T ss_pred             CCCcCCCCc
Confidence            456666543


No 78 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=67.64  E-value=2.2  Score=31.24  Aligned_cols=26  Identities=27%  Similarity=0.654  Sum_probs=15.0

Q ss_pred             ccccCCCCCCce--eEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDS--MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~--mkR~avGIW~C~~C~~~   68 (122)
                      .|++||.||+.-  |.|.-   =.|++||..
T Consensus         8 tKR~Cp~CG~kFYDLnk~P---ivCP~CG~~   35 (108)
T PF09538_consen    8 TKRTCPSCGAKFYDLNKDP---IVCPKCGTE   35 (108)
T ss_pred             CcccCCCCcchhccCCCCC---ccCCCCCCc
Confidence            467777777662  44422   146666654


No 79 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=67.10  E-value=5.2  Score=23.39  Aligned_cols=18  Identities=28%  Similarity=0.623  Sum_probs=14.2

Q ss_pred             eecCcCeEEeccccccCc
Q psy836           86 SCKRCKRIVAGGAWVYNT  103 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T  103 (122)
                      +|+-|++.|.|..|.-.|
T Consensus         2 sCiDC~~~F~~~~y~~Ht   19 (28)
T PF08790_consen    2 SCIDCSKDFDGDSYKSHT   19 (28)
T ss_dssp             EETTTTEEEEGGGTTT--
T ss_pred             eeecCCCCcCcCCcCCCC
Confidence            699999999999887654


No 80 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=66.82  E-value=1.9  Score=23.57  Aligned_cols=7  Identities=43%  Similarity=1.388  Sum_probs=3.4

Q ss_pred             CCCCCCc
Q psy836           44 CSFCGKD   50 (122)
Q Consensus        44 Cp~Cgk~   50 (122)
                      ||.||+.
T Consensus         2 Cp~CG~~    8 (23)
T PF13240_consen    2 CPNCGAE    8 (23)
T ss_pred             CcccCCC
Confidence            4555444


No 81 
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=66.00  E-value=4.3  Score=34.22  Aligned_cols=54  Identities=19%  Similarity=0.392  Sum_probs=24.7

Q ss_pred             HHHhhccccCCCCCCceeEeE----EeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccc
Q psy836           35 EITQHAKYTCSFCGKDSMKRS----CVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWV  100 (122)
Q Consensus        35 e~~~~aky~Cp~Cgk~~mkR~----avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~  100 (122)
                      |.=-.....||-||...+...    -|....|+.|+-.     |++--.       ...=+.++++|||.
T Consensus        25 E~Wv~~n~yCP~Cg~~~L~~f~NN~PVaDF~C~~C~ee-----yELKSk-------~~~l~~~I~dGAY~   82 (254)
T PF06044_consen   25 EDWVAENMYCPNCGSKPLSKFENNRPVADFYCPNCNEE-----YELKSK-------KKKLSNKINDGAYH   82 (254)
T ss_dssp             HHHHHHH---TTT--SS-EE--------EEE-TTT--E-----EEEEEE-------ESS--SEEEEEEHH
T ss_pred             HHHHHHCCcCCCCCChhHhhccCCCccceeECCCCchH-----Hhhhhh-------ccccCCcccCccHH
Confidence            344456788999999976654    5788999999864     333111       13334678888883


No 82 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=65.98  E-value=3.5  Score=23.85  Aligned_cols=9  Identities=22%  Similarity=0.708  Sum_probs=6.4

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      ..||.|+..
T Consensus         3 ~~CP~C~~~   11 (38)
T TIGR02098         3 IQCPNCKTS   11 (38)
T ss_pred             EECCCCCCE
Confidence            568888774


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=65.33  E-value=4.3  Score=31.32  Aligned_cols=36  Identities=11%  Similarity=0.259  Sum_probs=23.5

Q ss_pred             eecCcce--eeecceeeeeccceee-eeeecCcCeEEec
Q psy836           61 SCKRCKR--IVAGGAWDSMKRSCVG-IWSCKRCKRIVAG   96 (122)
Q Consensus        61 ~C~~C~~--~vAggAy~~~t~~Avt-V~s~~rC~~~~AG   96 (122)
                      +||+|+.  +-+=..|..+-.+.+. -..|..||++|.+
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f~~   40 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRFTT   40 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcceE
Confidence            6999994  2233334334455554 5889999999864


No 84 
>PF14353 CpXC:  CpXC protein
Probab=65.17  E-value=4.9  Score=28.69  Aligned_cols=9  Identities=44%  Similarity=1.217  Sum_probs=5.9

Q ss_pred             cCCCCCCce
Q psy836           43 TCSFCGKDS   51 (122)
Q Consensus        43 ~Cp~Cgk~~   51 (122)
                      +||.||...
T Consensus         3 tCP~C~~~~   11 (128)
T PF14353_consen    3 TCPHCGHEF   11 (128)
T ss_pred             CCCCCCCee
Confidence            577777653


No 85 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=65.05  E-value=5.9  Score=32.18  Aligned_cols=29  Identities=17%  Similarity=0.492  Sum_probs=21.8

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..-.||.||.....+..--...|+.|+..
T Consensus        98 ~~~fC~~CG~~~~~~~~~~~~~C~~c~~~  126 (256)
T PRK00241         98 SHRFCGYCGHPMHPSKTEWAMLCPHCRER  126 (256)
T ss_pred             cCccccccCCCCeecCCceeEECCCCCCE
Confidence            34469999998766655556789999865


No 86 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=64.84  E-value=3.2  Score=27.00  Aligned_cols=29  Identities=21%  Similarity=0.489  Sum_probs=15.4

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|.|..||+.--.=....--.|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVELDQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeehhhccCceeCCCCCcE
Confidence            35677777766521223333466666655


No 87 
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=64.83  E-value=15  Score=25.46  Aligned_cols=43  Identities=23%  Similarity=0.454  Sum_probs=23.4

Q ss_pred             CCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEec
Q psy836           44 CSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAG   96 (122)
Q Consensus        44 Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AG   96 (122)
                      ||.||+..+.+. +..-+     .++-|-..++    -+..+.|..||..+..
T Consensus         1 C~~C~~~~~~~~-~~~~~-----~~~~G~~~~v----~~~~~~C~~CGe~~~~   43 (127)
T TIGR03830         1 CPICGSGELVRD-VKDEP-----YTYKGESITI----GVPGWYCPACGEELLD   43 (127)
T ss_pred             CCCCCCccceee-eecce-----EEEcCEEEEE----eeeeeECCCCCCEEEc
Confidence            999997655422 22222     1222322222    5566679999887643


No 88 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=64.55  E-value=2.3  Score=37.86  Aligned_cols=30  Identities=20%  Similarity=0.447  Sum_probs=19.8

Q ss_pred             cccCCCCCCc-eeEeEEeeeeeecCcceeeecc
Q psy836           41 KYTCSFCGKD-SMKRSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        41 ky~Cp~Cgk~-~mkR~avGIW~C~~C~~~vAgg   72 (122)
                      +=.||+||.. .-+-..  -|.|++|+.....-
T Consensus       350 ~p~Cp~Cg~~m~S~G~~--g~rC~kCg~~~~~~  380 (421)
T COG1571         350 NPVCPRCGGRMKSAGRN--GFRCKKCGTRARET  380 (421)
T ss_pred             CCCCCccCCchhhcCCC--CcccccccccCCcc
Confidence            4479999976 222222  59999999875443


No 89 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=64.24  E-value=7.2  Score=29.01  Aligned_cols=25  Identities=28%  Similarity=0.747  Sum_probs=16.0

Q ss_pred             CCCCCCceeEeEEeeeeeecCcceeeecc
Q psy836           44 CSFCGKDSMKRSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        44 Cp~Cgk~~mkR~avGIW~C~~C~~~vAgg   72 (122)
                      ||.||..-    .|---+|+.|+-+|-|.
T Consensus         1 CPvCg~~l----~vt~l~C~~C~t~i~G~   25 (113)
T PF09862_consen    1 CPVCGGEL----VVTRLKCPSCGTEIEGE   25 (113)
T ss_pred             CCCCCCce----EEEEEEcCCCCCEEEee
Confidence            99999763    22335777777666553


No 90 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=63.86  E-value=4.9  Score=22.88  Aligned_cols=26  Identities=19%  Similarity=0.396  Sum_probs=12.9

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      -.||.||.+...-.+--.-.|+.|+.
T Consensus         4 rfC~~CG~~t~~~~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    4 RFCGRCGAPTKPAPGGWARRCPSCGH   29 (32)
T ss_dssp             SB-TTT--BEEE-SSSS-EEESSSS-
T ss_pred             cccCcCCccccCCCCcCEeECCCCcC
Confidence            35999998876655543446666654


No 91 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=63.61  E-value=2.4  Score=21.69  Aligned_cols=8  Identities=63%  Similarity=1.751  Sum_probs=3.8

Q ss_pred             ccCCCCCC
Q psy836           42 YTCSFCGK   49 (122)
Q Consensus        42 y~Cp~Cgk   49 (122)
                      |.||.|++
T Consensus         1 y~C~~C~~    8 (23)
T PF00096_consen    1 YKCPICGK    8 (23)
T ss_dssp             EEETTTTE
T ss_pred             CCCCCCCC
Confidence            34555544


No 92 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=63.14  E-value=2.6  Score=31.80  Aligned_cols=27  Identities=30%  Similarity=0.742  Sum_probs=20.2

Q ss_pred             hhccccCCCCCCce--eEeEEeeeeeecCccee
Q psy836           38 QHAKYTCSFCGKDS--MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~--mkR~avGIW~C~~C~~~   68 (122)
                      +-...+||.|||..  +.|+.    .|.+|+..
T Consensus        66 kav~V~CP~C~K~TKmLGr~D----~CM~C~~p   94 (114)
T PF11023_consen   66 KAVQVECPNCGKQTKMLGRVD----ACMHCKEP   94 (114)
T ss_pred             cceeeECCCCCChHhhhchhh----ccCcCCCc
Confidence            33456799999996  77773    78888764


No 93 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=63.13  E-value=2.5  Score=23.33  Aligned_cols=22  Identities=23%  Similarity=0.581  Sum_probs=11.5

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ..||.||+. +   ..+.=.|+.||.
T Consensus         3 ~~Cp~Cg~~-~---~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAE-I---DPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCc-C---CcccccChhhCC
Confidence            357777763 2   233345555554


No 94 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=62.84  E-value=3.5  Score=33.51  Aligned_cols=53  Identities=17%  Similarity=0.356  Sum_probs=21.1

Q ss_pred             ccccCCCCCCc-eeEeEEe----ee-----------e-----eecCcceeeecceeee--eccceeeeeeecCcCe
Q psy836           40 AKYTCSFCGKD-SMKRSCV----GI-----------W-----SCKRCKRIVAGGAWDS--MKRSCVGIWSCKRCKR   92 (122)
Q Consensus        40 aky~Cp~Cgk~-~mkR~av----GI-----------W-----~C~~C~~~vAggAy~~--~t~~AvtV~s~~rC~~   92 (122)
                      .+-.||.||.. .+-...-    |.           |     .|+.||..=...-+.+  ....+.-|-.|..|+-
T Consensus       171 ~~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R~~Cp~Cg~~~~~~l~~~~~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  171 QRGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVRIKCPYCGNTDHEKLEYFTVEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             T-SS-TTT---EEEEEEE------EEEEEETTT--EEE--TTS-TTT---SS-EEE--------SEEEEEETTTTE
T ss_pred             cCCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecCCCCcCCCCCCCcceeeEecCCCCcEEEEECCcccc
Confidence            34689999887 3333222    21           2     3666666644444443  3566778888888874


No 95 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=62.69  E-value=5.2  Score=24.23  Aligned_cols=17  Identities=24%  Similarity=0.645  Sum_probs=13.6

Q ss_pred             hccccCCCCCCceeEeE
Q psy836           39 HAKYTCSFCGKDSMKRS   55 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~   55 (122)
                      ...-.||.||...++|.
T Consensus        24 ~~~~~CP~Cg~~~~~r~   40 (42)
T PF09723_consen   24 DDPVPCPECGSTEVRRV   40 (42)
T ss_pred             CCCCcCCCCCCCceEEe
Confidence            45678999999888875


No 96 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=62.50  E-value=7  Score=28.58  Aligned_cols=64  Identities=17%  Similarity=0.340  Sum_probs=31.4

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchHHHHHHHHHHHHHHh
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV  119 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~  119 (122)
                      +-.||+||.+..-+.+.-|+- .           .++-..  -+|-|..|+-=|-==. .-+.|+++-+...+|++|..
T Consensus         2 p~~CpYCg~~~~l~~~~~iYg-~-----------~~~~~~--~~y~C~~C~AyVG~H~-~t~~PlGtLAd~~lR~~R~~   65 (102)
T PF11672_consen    2 PIICPYCGGPAELVDGSEIYG-H-----------RYDDGP--YLYVCTPCDAYVGCHP-GTDIPLGTLADAELRRARKA   65 (102)
T ss_pred             CcccCCCCCeeEEcccchhcC-c-----------cCCCCc--eeEECCCCCceeeeeC-CCCCcCcccCCHHHHHHHHH
Confidence            346999999876655433332 0           000001  1255666642211000 01456777777777766643


No 97 
>KOG2593|consensus
Probab=62.36  E-value=6.4  Score=35.42  Aligned_cols=41  Identities=27%  Similarity=0.546  Sum_probs=25.5

Q ss_pred             hhHhHHHHHH--HhhccccCCCCCCc-------eeEeEEeeeeeecCcce
Q psy836           27 LRKMVKKMEI--TQHAKYTCSFCGKD-------SMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        27 lRK~v~kie~--~~~aky~Cp~Cgk~-------~mkR~avGIW~C~~C~~   67 (122)
                      +||+++.-+.  ...+-|.||+|.+.       .+-=-..|-.+|..|+-
T Consensus       112 m~krled~~~d~t~~~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  112 MRKRLEDRLRDDTNVAGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGG  161 (436)
T ss_pred             HHHHHHHHhhhccccccccCCccccchhhhHHHHhhcccCceEEEecCCC
Confidence            4555555433  35688999999987       11112357788766654


No 98 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=62.29  E-value=3.5  Score=31.66  Aligned_cols=26  Identities=15%  Similarity=0.119  Sum_probs=16.2

Q ss_pred             ccccCCCCCCce--eEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDS--MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~--mkR~avGIW~C~~C~~~   68 (122)
                      .|++||.||+.-  +.|.-   =.|++||..
T Consensus         8 tKr~Cp~cg~kFYDLnk~p---~vcP~cg~~   35 (129)
T TIGR02300         8 TKRICPNTGSKFYDLNRRP---AVSPYTGEQ   35 (129)
T ss_pred             ccccCCCcCccccccCCCC---ccCCCcCCc
Confidence            577888888763  44432   256666665


No 99 
>PHA00616 hypothetical protein
Probab=61.88  E-value=2.6  Score=26.77  Aligned_cols=11  Identities=36%  Similarity=0.697  Sum_probs=8.4

Q ss_pred             cccCCCCCCce
Q psy836           41 KYTCSFCGKDS   51 (122)
Q Consensus        41 ky~Cp~Cgk~~   51 (122)
                      +|+||.||+.-
T Consensus         1 pYqC~~CG~~F   11 (44)
T PHA00616          1 MYQCLRCGGIF   11 (44)
T ss_pred             CCccchhhHHH
Confidence            48899998753


No 100
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=61.42  E-value=6.7  Score=28.62  Aligned_cols=30  Identities=20%  Similarity=0.432  Sum_probs=24.0

Q ss_pred             cCCCCCCceeEeE--EeeeeeecCcceeeecc
Q psy836           43 TCSFCGKDSMKRS--CVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~--avGIW~C~~C~~~vAgg   72 (122)
                      .||.||..-.-+.  ..+.+.|++|+...--.
T Consensus         4 FCp~Cgsll~p~~~~~~~~l~C~kCgye~~~~   35 (113)
T COG1594           4 FCPKCGSLLYPKKDDEGGKLVCRKCGYEEEAS   35 (113)
T ss_pred             ccCCccCeeEEeEcCCCcEEECCCCCcchhcc
Confidence            6999999987776  46799999999765433


No 101
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=60.95  E-value=3.9  Score=23.31  Aligned_cols=20  Identities=25%  Similarity=0.576  Sum_probs=11.1

Q ss_pred             cCCCCCCceeEeEEeeeeee
Q psy836           43 TCSFCGKDSMKRSCVGIWSC   62 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C   62 (122)
                      .||.||...++-..--+|.|
T Consensus         1 ~CP~C~s~l~~~~~ev~~~C   20 (28)
T PF03119_consen    1 TCPVCGSKLVREEGEVDIRC   20 (28)
T ss_dssp             B-TTT--BEEE-CCTTCEEE
T ss_pred             CcCCCCCEeEcCCCCEeEEC
Confidence            59999999886555446665


No 102
>PRK12366 replication factor A; Reviewed
Probab=60.79  E-value=5.3  Score=36.53  Aligned_cols=53  Identities=21%  Similarity=0.432  Sum_probs=34.3

Q ss_pred             hHhHHHHHHHhhccccCCCCCCceeEeE-EeeeeeecCcceeeecceeeeeccceeeeeeecCcCeE
Q psy836           28 RKMVKKMEITQHAKYTCSFCGKDSMKRS-CVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        28 RK~v~kie~~~~aky~Cp~Cgk~~mkR~-avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~   93 (122)
                      ||.+.+|+.   ..+ -...|.....+. ..=+..||.|+|+|..+         -+.|.|.+|+++
T Consensus       504 ~~~I~~i~~---~~~-~~v~g~i~~i~~~~~~y~aCp~CnkKv~~~---------~g~~~C~~c~~~  557 (637)
T PRK12366        504 RKFIADLEE---DDT-VEIRGTVVDIRKQKIILYLCPNCRKRVEEV---------DGEYICEFCGEV  557 (637)
T ss_pred             ccCHHHccc---CCe-EEEEEEEEEEeCCCEEEecccccCeEeEcC---------CCcEECCCCCCC
Confidence            455555544   444 455565543333 33356899999998743         278899999987


No 103
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=60.24  E-value=7.8  Score=24.95  Aligned_cols=29  Identities=17%  Similarity=0.434  Sum_probs=17.6

Q ss_pred             ccccCC--CCCCceeEeEEeeeeeecCccee
Q psy836           40 AKYTCS--FCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp--~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..-.||  .||.-.+==.-..-|+|.+|+.|
T Consensus        17 ~rk~CP~~~CG~GvFMA~H~dR~~CGKCg~T   47 (47)
T PF01599_consen   17 LRKECPSPRCGAGVFMAEHKDRHYCGKCGYT   47 (47)
T ss_dssp             SSEE-TSTTTTSSSEEEE-SSEEEETTTSS-
T ss_pred             hhhcCCCcccCCceEeeecCCCccCCCcccC
Confidence            455799  99986433333467898888753


No 104
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=60.22  E-value=3.4  Score=38.23  Aligned_cols=45  Identities=20%  Similarity=0.392  Sum_probs=26.8

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCc
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNT  103 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T  103 (122)
                      ..||.||.....      =.|+.||..+..           +.+.|..||.....=.|.+-+
T Consensus        16 kFC~~CG~~l~~------~~Cp~CG~~~~~-----------~~~fC~~CG~~~~~~~~~~~~   60 (645)
T PRK14559         16 RFCQKCGTSLTH------KPCPQCGTEVPV-----------DEAHCPNCGAETGTIWWAIIA   60 (645)
T ss_pred             ccccccCCCCCC------CcCCCCCCCCCc-----------ccccccccCCcccchhhhhcc
Confidence            357777776421      158888776433           334588888776555554443


No 105
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=60.14  E-value=6.4  Score=24.31  Aligned_cols=16  Identities=25%  Similarity=0.644  Sum_probs=12.6

Q ss_pred             cCCCCCCceeEeEEee
Q psy836           43 TCSFCGKDSMKRSCVG   58 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avG   58 (122)
                      .||.||.....|.+..
T Consensus         1 ~CP~Cg~~a~ir~S~~   16 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQ   16 (47)
T ss_pred             CcCCCCCeeEEEEchh
Confidence            5999999987776643


No 106
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=59.67  E-value=4  Score=24.84  Aligned_cols=25  Identities=36%  Similarity=0.971  Sum_probs=11.4

Q ss_pred             cccCCCCCCce--eEeEEe---eeeeecCc
Q psy836           41 KYTCSFCGKDS--MKRSCV---GIWSCKRC   65 (122)
Q Consensus        41 ky~Cp~Cgk~~--mkR~av---GIW~C~~C   65 (122)
                      +..|+|||+..  +.+.-.   |.+-|..|
T Consensus         1 ~~~CSFCgr~~~~v~~li~g~~~~~IC~~C   30 (41)
T PF06689_consen    1 EKRCSFCGRPESEVGRLISGPNGAYICDEC   30 (41)
T ss_dssp             --B-TTT--BTTTSSSEEEES-SEEEEHHH
T ss_pred             CCCccCCCCCHHHHhceecCCCCcEECHHH
Confidence            35799999984  344333   44565555


No 107
>PRK08402 replication factor A; Reviewed
Probab=58.27  E-value=5.4  Score=34.35  Aligned_cols=26  Identities=15%  Similarity=0.452  Sum_probs=16.1

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ..||.|.|.-..-..-|.|.|..|+.
T Consensus       213 ~aCp~CnKkv~~~~~~~~~~Ce~~~~  238 (355)
T PRK08402        213 DACPECRRKVDYDPATDTWICPEHGE  238 (355)
T ss_pred             ecCCCCCeEEEEecCCCCEeCCCCCC
Confidence            35777766443334457777777775


No 108
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.68  E-value=9.6  Score=27.60  Aligned_cols=29  Identities=34%  Similarity=0.668  Sum_probs=19.5

Q ss_pred             cCCCCCCce--eEeEEeeeeeecCcceeeec
Q psy836           43 TCSFCGKDS--MKRSCVGIWSCKRCKRIVAG   71 (122)
Q Consensus        43 ~Cp~Cgk~~--mkR~avGIW~C~~C~~~vAg   71 (122)
                      .||.|+-..  .-|..|-|=.||.|.=+|-+
T Consensus         3 lCP~C~v~l~~~~rs~vEiD~CPrCrGVWLD   33 (88)
T COG3809           3 LCPICGVELVMSVRSGVEIDYCPRCRGVWLD   33 (88)
T ss_pred             ccCcCCceeeeeeecCceeeeCCccccEeec
Confidence            589998774  45666777777666655443


No 109
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=56.55  E-value=9.3  Score=22.83  Aligned_cols=26  Identities=31%  Similarity=0.563  Sum_probs=13.3

Q ss_pred             cCCCCCCceeEeEEee----eeeecCccee
Q psy836           43 TCSFCGKDSMKRSCVG----IWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avG----IW~C~~C~~~   68 (122)
                      .||.||.....+.-.|    -+-|+.|+.+
T Consensus         2 fC~~CG~~l~~~ip~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    2 FCPQCGGPLERRIPEGDDRERLVCPACGFI   31 (34)
T ss_dssp             B-TTT--B-EEE--TT-SS-EEEETTTTEE
T ss_pred             ccccccChhhhhcCCCCCccceECCCCCCE
Confidence            4999999876665544    3677777654


No 110
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=56.26  E-value=13  Score=28.95  Aligned_cols=25  Identities=24%  Similarity=0.805  Sum_probs=17.4

Q ss_pred             CCCCCCceeEeE------------EeeeeeecCccee
Q psy836           44 CSFCGKDSMKRS------------CVGIWSCKRCKRI   68 (122)
Q Consensus        44 Cp~Cgk~~mkR~------------avGIW~C~~C~~~   68 (122)
                      ||.||...++..            -.=-+.|++||.+
T Consensus         1 CP~Cg~~~~~~~~~~~~IP~F~evii~sf~C~~CGyr   37 (163)
T TIGR00340         1 CPVCGSRTLKAVTYDYDIPYFGKIMLSTYICEKCGYR   37 (163)
T ss_pred             CCCCCCcceEeeeEeccCCCcceEEEEEEECCCCCCc
Confidence            999998755552            2334788888875


No 111
>PRK08665 ribonucleotide-diphosphate reductase subunit alpha; Validated
Probab=55.61  E-value=12  Score=35.08  Aligned_cols=24  Identities=25%  Similarity=0.674  Sum_probs=17.6

Q ss_pred             cCCCCCCceeEeEEeeeeeecCccee
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      .||.||. .+.+. -|=..|+.||..
T Consensus       726 ~Cp~Cg~-~l~~~-~GC~~C~~CG~s  749 (752)
T PRK08665        726 ACPECGS-ILEHE-EGCVVCHSCGYS  749 (752)
T ss_pred             CCCCCCc-ccEEC-CCCCcCCCCCCC
Confidence            5999994 45444 388898888874


No 112
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=55.59  E-value=9.2  Score=22.40  Aligned_cols=25  Identities=20%  Similarity=0.586  Sum_probs=9.6

Q ss_pred             cCCCCCCceeEeEEeeeeeecCccee
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      .||.|+..-.- .--.++-|+.|+.-
T Consensus         4 ~Cp~C~se~~y-~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee-ccCCEEeCCccccc
Confidence            47777766433 34445666655543


No 113
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=55.32  E-value=8.6  Score=22.77  Aligned_cols=26  Identities=19%  Similarity=0.415  Sum_probs=15.1

Q ss_pred             cCCCCCCceeEeEEeeee-eecCccee
Q psy836           43 TCSFCGKDSMKRSCVGIW-SCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW-~C~~C~~~   68 (122)
                      .||.||....-+...... .|+.|+..
T Consensus         3 FCp~C~nlL~p~~~~~~~~~C~~C~Y~   29 (35)
T PF02150_consen    3 FCPECGNLLYPKEDKEKRVACRTCGYE   29 (35)
T ss_dssp             BETTTTSBEEEEEETTTTEEESSSS-E
T ss_pred             eCCCCCccceEcCCCccCcCCCCCCCc
Confidence            699999886554443322 46666554


No 114
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=55.21  E-value=8.2  Score=24.11  Aligned_cols=11  Identities=45%  Similarity=1.062  Sum_probs=5.4

Q ss_pred             ccccCCCCCCc
Q psy836           40 AKYTCSFCGKD   50 (122)
Q Consensus        40 aky~Cp~Cgk~   50 (122)
                      ++-.||.|+++
T Consensus        19 ~~~~CPlC~r~   29 (54)
T PF04423_consen   19 AKGCCPLCGRP   29 (54)
T ss_dssp             -SEE-TTT--E
T ss_pred             CCCcCCCCCCC
Confidence            44489999976


No 115
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=55.04  E-value=3.9  Score=37.89  Aligned_cols=42  Identities=17%  Similarity=0.359  Sum_probs=30.3

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccc-ccc
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGA-WVY  101 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGA-y~~  101 (122)
                      .||.||..-    .-|--.|+.||..+.             ...|..||..+..|+ |++
T Consensus         3 ~Cp~Cg~~n----~~~akFC~~CG~~l~-------------~~~Cp~CG~~~~~~~~fC~   45 (645)
T PRK14559          3 ICPQCQFEN----PNNNRFCQKCGTSLT-------------HKPCPQCGTEVPVDEAHCP   45 (645)
T ss_pred             cCCCCCCcC----CCCCccccccCCCCC-------------CCcCCCCCCCCCccccccc
Confidence            699999874    344458999998752             146999999876654 555


No 116
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=55.01  E-value=9.2  Score=23.73  Aligned_cols=24  Identities=29%  Similarity=0.589  Sum_probs=17.3

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcc
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCK   66 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~   66 (122)
                      -.||.||-+.|+ .--|.-.|..|+
T Consensus        18 ~~Cp~C~~PL~~-~k~g~~~Cv~C~   41 (41)
T PF06677_consen   18 EHCPDCGTPLMR-DKDGKIYCVSCG   41 (41)
T ss_pred             CccCCCCCeeEE-ecCCCEECCCCC
Confidence            469999999998 335556776663


No 117
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=54.06  E-value=9.6  Score=28.24  Aligned_cols=9  Identities=22%  Similarity=0.608  Sum_probs=7.4

Q ss_pred             cCCCCCCce
Q psy836           43 TCSFCGKDS   51 (122)
Q Consensus        43 ~Cp~Cgk~~   51 (122)
                      .|+.|+..-
T Consensus        93 RC~~CN~~L  101 (147)
T PF01927_consen   93 RCPKCNGPL  101 (147)
T ss_pred             ccCCCCcEe
Confidence            699998864


No 118
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=53.56  E-value=8.2  Score=28.01  Aligned_cols=33  Identities=24%  Similarity=0.775  Sum_probs=20.0

Q ss_pred             eec--CcceeeecceeeeeccceeeeeeecCcCeEEecccccc
Q psy836           61 SCK--RCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVY  101 (122)
Q Consensus        61 ~C~--~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~  101 (122)
                      .|+  .|+++|..+.-        +.|.|.+|++.+..-.|.+
T Consensus        20 aC~~~~C~kKv~~~~~--------~~y~C~~C~~~~~~~~~ry   54 (146)
T PF08646_consen   20 ACPNEKCNKKVTENGD--------GSYRCEKCNKTVENPKYRY   54 (146)
T ss_dssp             E-TSTTTS-B-EEETT--------TEEEETTTTEEESS-EEEE
T ss_pred             CCCCccCCCEeecCCC--------cEEECCCCCCcCCCeeEEE
Confidence            699  99998764321        4478999999975544433


No 119
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=53.07  E-value=7.7  Score=23.40  Aligned_cols=24  Identities=25%  Similarity=0.703  Sum_probs=16.7

Q ss_pred             ccCCCCCCce-eEeEEee-----eeeecCc
Q psy836           42 YTCSFCGKDS-MKRSCVG-----IWSCKRC   65 (122)
Q Consensus        42 y~Cp~Cgk~~-mkR~avG-----IW~C~~C   65 (122)
                      -.||+|+.+. ++|-..+     .|.|+.|
T Consensus         6 v~CP~C~s~~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTEGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCCcceeCCCCCCCCEeEecCcC
Confidence            3699999998 8875432     4666555


No 120
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=52.80  E-value=4.2  Score=31.65  Aligned_cols=30  Identities=20%  Similarity=0.451  Sum_probs=19.0

Q ss_pred             ecCcCeEEeccccccCchHHHHHHHHHHHHHHh
Q psy836           87 CKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV  119 (122)
Q Consensus        87 ~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~  119 (122)
                      |..||...-   +.-|+.....++.-|..|.+.
T Consensus       139 Cp~Cg~~L~---~~dn~~~~~~l~~~I~~l~~~  168 (178)
T PRK06266        139 CPQCGEMLE---EYDNSELIKELKEQIKELEEE  168 (178)
T ss_pred             CCCCCCCCe---ecccHHHHHHHHHHHHHHHHH
Confidence            666654332   234777777788777777664


No 121
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=52.58  E-value=8.8  Score=36.27  Aligned_cols=40  Identities=20%  Similarity=0.344  Sum_probs=29.7

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeE
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~   93 (122)
                      ..||+|+..-.-=...+.=.|..||..            --.-.+|..||-+
T Consensus       445 ~~Cp~Cd~~lt~H~~~~~L~CH~Cg~~------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         445 AECPNCDSPLTLHKATGQLRCHYCGYQ------------EPIPQSCPECGSE  484 (730)
T ss_pred             ccCCCCCcceEEecCCCeeEeCCCCCC------------CCCCCCCCCCCCC
Confidence            469999888766666789999999985            1223459999765


No 122
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=52.00  E-value=7.3  Score=28.13  Aligned_cols=41  Identities=22%  Similarity=0.511  Sum_probs=23.1

Q ss_pred             hhHhHHHHHHH-----hhccccCCCCCCceeEeEEeeeeeecCcce
Q psy836           27 LRKMVKKMEIT-----QHAKYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        27 lRK~v~kie~~-----~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      .+|-+.+|+.=     -...|.|+.||....--.+-+--+||+|+.
T Consensus        23 ~~k~~~~il~Crt~~~G~~~~~C~~Cg~~~~~~~SCk~R~CP~C~~   68 (111)
T PF14319_consen   23 QRKAVEAILACRTEALGFHRYRCEDCGHEKIVYNSCKNRHCPSCQA   68 (111)
T ss_pred             HHHHHHHHHhcCCccCCcceeecCCCCceEEecCcccCcCCCCCCC
Confidence            34445555432     234577888877765555555556666654


No 123
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=51.75  E-value=4.7  Score=21.57  Aligned_cols=11  Identities=36%  Similarity=1.171  Sum_probs=7.9

Q ss_pred             eeeeecCccee
Q psy836           58 GIWSCKRCKRI   68 (122)
Q Consensus        58 GIW~C~~C~~~   68 (122)
                      |.|.|..|+..
T Consensus         1 g~W~C~~C~~~   11 (26)
T smart00547        1 GDWECPACTFL   11 (26)
T ss_pred             CcccCCCCCCc
Confidence            56888888653


No 124
>KOG3214|consensus
Probab=51.63  E-value=9  Score=28.73  Aligned_cols=54  Identities=19%  Similarity=0.401  Sum_probs=36.2

Q ss_pred             HHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchHHHH
Q psy836           36 ITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATS  108 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~~~~  108 (122)
                      ...-..|.||||.-.+.       =+|            ++....-+|.-+|.-|+..|+.-+=.+++|.-.+
T Consensus        18 ~~ldt~FnClfcnHek~-------v~~------------~~Dk~~~iG~~sC~iC~esFqt~it~LsepIDVY   71 (109)
T KOG3214|consen   18 EPLDTQFNCLFCNHEKS-------VSC------------TLDKKHNIGKASCRICEESFQTTITALSEPIDVY   71 (109)
T ss_pred             cchheeeccCccccccc-------eee------------eehhhcCcceeeeeehhhhhccchHhhccchHHH
Confidence            34456788999976641       111            2344555666778999999888887777776554


No 125
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=51.10  E-value=31  Score=20.63  Aligned_cols=9  Identities=33%  Similarity=1.102  Sum_probs=4.0

Q ss_pred             cCCCCCCce
Q psy836           43 TCSFCGKDS   51 (122)
Q Consensus        43 ~Cp~Cgk~~   51 (122)
                      +||.||...
T Consensus         2 ~Cp~Cg~~~   10 (39)
T PF01096_consen    2 KCPKCGHNE   10 (39)
T ss_dssp             --SSS-SSE
T ss_pred             CCcCCCCCe
Confidence            577777664


No 126
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=50.40  E-value=7  Score=28.30  Aligned_cols=12  Identities=17%  Similarity=0.498  Sum_probs=6.1

Q ss_pred             eeeeeecCccee
Q psy836           57 VGIWSCKRCKRI   68 (122)
Q Consensus        57 vGIW~C~~C~~~   68 (122)
                      -+...|+.|+..
T Consensus        68 p~~~~C~~Cg~~   79 (114)
T PRK03681         68 EAECWCETCQQY   79 (114)
T ss_pred             CcEEEcccCCCe
Confidence            344555555543


No 127
>PRK07218 replication factor A; Provisional
Probab=50.21  E-value=6.9  Score=34.56  Aligned_cols=27  Identities=22%  Similarity=0.391  Sum_probs=19.6

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~   76 (122)
                      ..||.|++.-      ..|.|+.||.+  .+-|++
T Consensus       298 ~rCP~C~r~v------~~~~C~~hG~v--e~~~dl  324 (423)
T PRK07218        298 ERCPECGRVI------QKGQCRSHGAV--EGEDDL  324 (423)
T ss_pred             ecCcCccccc------cCCcCCCCCCc--CCeeee
Confidence            5799998765      33899999976  444544


No 128
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=49.34  E-value=10  Score=33.53  Aligned_cols=38  Identities=18%  Similarity=0.345  Sum_probs=23.9

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCe
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKR   92 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~   92 (122)
                      .||.|+-.-.--...+.=.|..||.+            +.--+.|..|+-
T Consensus       224 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~------------~~~~~~Cp~C~s  261 (505)
T TIGR00595       224 CCPNCDVSLTYHKKEGKLRCHYCGYQ------------EPIPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCceEEecCCCeEEcCCCcCc------------CCCCCCCCCCCC
Confidence            47777765444345556678888875            222346888865


No 129
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=48.82  E-value=18  Score=29.24  Aligned_cols=57  Identities=18%  Similarity=0.348  Sum_probs=40.1

Q ss_pred             hhccccCCCCCCce-eEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEecccccc
Q psy836           38 QHAKYTCSFCGKDS-MKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVY  101 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~-mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~  101 (122)
                      ....|.||..++.- -+-..|-||.|   |-+++.-|..-..    .=+.|.-|+..|.---=.+
T Consensus       110 ~~~~~~CPvt~~~~~~~~~fv~l~~c---G~V~s~~alke~k----~~~~Cp~c~~~f~~~DiI~  167 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKHKFVYLRPC---GCVFSEKALKELK----KSKKCPVCGKPFTEEDIIP  167 (260)
T ss_pred             CCceeECCCCCcccCCceeEEEEcCC---CCEeeHHHHHhhc----ccccccccCCccccCCEEE
Confidence            57889999999884 45678999985   5566666665553    1235999999887554333


No 130
>PRK08173 DNA topoisomerase III; Validated
Probab=48.55  E-value=17  Score=34.72  Aligned_cols=26  Identities=19%  Similarity=0.575  Sum_probs=17.6

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~v   69 (122)
                      -.||.||+..+++  -+.|.|..|+.++
T Consensus       625 ~~CP~Cg~~~~~~--~~~~~Cs~C~f~~  650 (862)
T PRK08173        625 TPCPNCGGVVKEN--YRRFACTKCDFSI  650 (862)
T ss_pred             ccCCccccccccc--CceeEcCCCCccc
Confidence            4699999864322  3349998887653


No 131
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=48.52  E-value=6.8  Score=22.67  Aligned_cols=12  Identities=50%  Similarity=1.060  Sum_probs=6.5

Q ss_pred             hccccCCCCCCc
Q psy836           39 HAKYTCSFCGKD   50 (122)
Q Consensus        39 ~aky~Cp~Cgk~   50 (122)
                      .++|+||.|+..
T Consensus        11 ~~kY~Cp~C~~~   22 (30)
T PF04438_consen   11 PAKYRCPRCGAR   22 (30)
T ss_dssp             EESEE-TTT--E
T ss_pred             CCEEECCCcCCc
Confidence            467888888754


No 132
>PRK12495 hypothetical protein; Provisional
Probab=48.43  E-value=15  Score=30.50  Aligned_cols=30  Identities=23%  Similarity=0.519  Sum_probs=22.5

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCcceeeec
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAG   71 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAg   71 (122)
                      ..+.|+.||.+.++  --|.=.|+.|...+..
T Consensus        41 sa~hC~~CG~PIpa--~pG~~~Cp~CQ~~~~~   70 (226)
T PRK12495         41 TNAHCDECGDPIFR--HDGQEFCPTCQQPVTE   70 (226)
T ss_pred             chhhcccccCcccC--CCCeeECCCCCCcccc
Confidence            35779999999882  2688888888776543


No 133
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=48.11  E-value=19  Score=27.59  Aligned_cols=26  Identities=23%  Similarity=0.620  Sum_probs=14.0

Q ss_pred             cCCCCCCceeEe-EEe----------eeeeecCccee
Q psy836           43 TCSFCGKDSMKR-SCV----------GIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~mkR-~av----------GIW~C~~C~~~   68 (122)
                      .||.||+...-| .-+          =-+.|.+||.+
T Consensus         3 ~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGyk   39 (161)
T PF03367_consen    3 LCPNCGENGTTRILLTDIPYFKEVIIMSFECEHCGYK   39 (161)
T ss_dssp             E-TTTSSCCEEEEEEEEETTTEEEEEEEEE-TTT--E
T ss_pred             cCCCCCCCcEEEEEEEcCCCCceEEEEEeECCCCCCE
Confidence            599999985333 233          33788888775


No 134
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=47.34  E-value=16  Score=25.47  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=8.5

Q ss_pred             eeeeeecCcCeE
Q psy836           82 VGIWSCKRCKRI   93 (122)
Q Consensus        82 vtV~s~~rC~~~   93 (122)
                      ..+.+|.+||++
T Consensus        38 f~~itCk~CgYt   49 (68)
T COG3478          38 FIVITCKNCGYT   49 (68)
T ss_pred             EEEEEeccCCch
Confidence            446678888875


No 135
>PF01807 zf-CHC2:  CHC2 zinc finger;  InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents CycHisCysCys (CHC2) type zinc finger domains, which are found in bacteria and viruses. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0003896 DNA primase activity, 0008270 zinc ion binding, 0006260 DNA replication; PDB: 1D0Q_B 2AU3_A.
Probab=47.03  E-value=16  Score=25.45  Aligned_cols=31  Identities=23%  Similarity=0.441  Sum_probs=13.6

Q ss_pred             ecCcCeEEeccccccC-chHHHHHHHHHHHHHHh
Q psy836           87 CKRCKRIVAGGAWVYN-TTAATSVRSAIRRLREV  119 (122)
Q Consensus        87 ~~rC~~~~AGGAy~~~-T~~~~~~~~~i~rl~e~  119 (122)
                      |-.||.  .|.+..+- .--..+...|++.|.+.
T Consensus        57 Cf~Cg~--~Gd~i~~v~~~~~~~f~eAv~~l~~~   88 (97)
T PF01807_consen   57 CFGCGK--GGDVIDFVMKYEGCSFKEAVKWLAEE   88 (97)
T ss_dssp             ETTT----EE-HHHHHHHHHT--HHHHHHHHHHH
T ss_pred             ECCCCC--CCcHHhHHHHHhCCCHHHHHHHHHHH
Confidence            556653  35554441 22344566677766653


No 136
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=46.66  E-value=12  Score=29.51  Aligned_cols=23  Identities=30%  Similarity=0.731  Sum_probs=17.7

Q ss_pred             eeeecCcceeeecceeeeeccceeeeeeecCcC
Q psy836           59 IWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCK   91 (122)
Q Consensus        59 IW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~   91 (122)
                      +|.|+-||.++.|-|          -+.|+.||
T Consensus       134 ~~vC~vCGy~~~ge~----------P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTHEGEA----------PEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcccCCC----------CCcCCCCC
Confidence            899999999988733          12388887


No 137
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=46.39  E-value=21  Score=28.19  Aligned_cols=28  Identities=29%  Similarity=0.866  Sum_probs=20.7

Q ss_pred             HHhhccccCCCCCCceeEeEEeeeeeecCcce
Q psy836           36 ITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      +..-..|.|+.||-..-...    |.||.|+.
T Consensus       349 ~~~~p~~~c~~cg~~~~~~~----~~c~~c~~  376 (389)
T PRK11788        349 LKRKPRYRCRNCGFTARTLY----WHCPSCKA  376 (389)
T ss_pred             HhCCCCEECCCCCCCCccce----eECcCCCC
Confidence            45566788999998876654    78888864


No 138
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=46.35  E-value=13  Score=26.77  Aligned_cols=19  Identities=5%  Similarity=0.190  Sum_probs=10.0

Q ss_pred             ccccccChhhhHhHHHHHH
Q psy836           18 KYGTRYGASLRKMVKKMEI   36 (122)
Q Consensus        18 kyG~RYG~slRK~v~kie~   36 (122)
                      +-..-.|...++...++..
T Consensus        79 ~~~~~Hg~~fk~~~~~ig~   97 (157)
T PF10263_consen   79 GRRRGHGKEFKQWARRIGA   97 (157)
T ss_pred             CCCCCCCHHHHHHHHHHCC
Confidence            3334455655655555555


No 139
>PF02977 CarbpepA_inh:  Carboxypeptidase A inhibitor;  InterPro: IPR004231 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   This family is represented by the well-characterised metallocarboxypeptidase A inhibitor (MCPI) from potatoes, which belongs to the MEROPS inhibitor family I37, clan IE. It inhibits metallopeptidases belonging to MEROPS peptidase family M14, carboxypeptidase A. In Russet Burbank potatoes, it is a mixture of approximately equal amounts of two polypeptide chains containing 38 or 39 amino acid residues. The chains differ in their amino terminal sequence only [] and are resistant to fragmentation by proteases []. The structure of the complex between bovine carboxypeptidase A and the 39-amino-acid carboxypeptidase A inhibitor from potatoes has been determined at 2.5-A resolution []. The potato inhibitor is synthesised as a precursor, having a 29 residue N-terminal signal peptide, a 27 residue pro-peptide, the 39 residue mature inhibitor region and a 7 residue C-terminal extension. The 7 residue C-terminal extension is involved in inhibitor inactivation and may be required for targeting to the vacuole where the mature active inhibitor accumulates [].  The N-terminal region and the mature inhibitor are weakly related to other solananaceous proteins found in this entry, from potato, tomato and henbane, which have been incorrectly described as metallocarboxipeptidase inhibitors [].; GO: 0008191 metalloendopeptidase inhibitor activity; PDB: 4CPA_I 1H20_A 2HLG_A.
Probab=46.21  E-value=4.4  Score=26.26  Aligned_cols=34  Identities=26%  Similarity=0.495  Sum_probs=21.2

Q ss_pred             CCCCc-eeEeEEeeeeeecCc-ceeeecceeeeecc
Q psy836           46 FCGKD-SMKRSCVGIWSCKRC-KRIVAGGAWDSMKR   79 (122)
Q Consensus        46 ~Cgk~-~mkR~avGIW~C~~C-~~~vAggAy~~~t~   79 (122)
                      -|++. ...=...|+|-|.-| +++..++-|+.++-
T Consensus         7 tCn~~C~t~sDC~g~tlC~~C~k~~~t~~g~~~~~~   42 (46)
T PF02977_consen    7 TCNKYCNTNSDCSGITLCQWCWKLKKTCGGYVGSAC   42 (46)
T ss_dssp             TTT-B-SSSCCCTTSSSS-EE-CCCEBCC--EEEEE
T ss_pred             ccCCccccCccccceeehHHHHhcccCCCCccccee
Confidence            34444 344457899999999 88888888877653


No 140
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=45.06  E-value=28  Score=29.46  Aligned_cols=20  Identities=15%  Similarity=0.305  Sum_probs=12.2

Q ss_pred             HhhccccCCCCCCceeEeEE
Q psy836           37 TQHAKYTCSFCGKDSMKRSC   56 (122)
Q Consensus        37 ~~~aky~Cp~Cgk~~mkR~a   56 (122)
                      .....++||.||....--..
T Consensus       254 ~~t~~~~C~~C~~~~~~~~q  273 (299)
T TIGR01385       254 AVTDLFTCGKCKQKKCTYYQ  273 (299)
T ss_pred             CCcccccCCCCCCccceEEE
Confidence            33446888888876543333


No 141
>TIGR01391 dnaG DNA primase, catalytic core. This protein contains a CHC2 zinc finger (Pfam:PF01807) and a Toprim domain (Pfam:PF01751).
Probab=45.03  E-value=10  Score=32.67  Aligned_cols=33  Identities=24%  Similarity=0.389  Sum_probs=22.4

Q ss_pred             ccCCCCCCc--eeEeE-EeeeeeecCcceeeecceeee
Q psy836           42 YTCSFCGKD--SMKRS-CVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        42 y~Cp~Cgk~--~mkR~-avGIW~C~~C~~~vAggAy~~   76 (122)
                      ..||||+..  ++.-. .-++|+|-.|+.  .|++.++
T Consensus        35 ~~CPfh~ek~pSf~v~~~k~~~~Cf~Cg~--~Gd~i~f   70 (415)
T TIGR01391        35 GLCPFHHEKTPSFSVSPEKQFYHCFGCGA--GGDAIKF   70 (415)
T ss_pred             eeCCCCCCCCCeEEEEcCCCcEEECCCCC--CCCHHHH
Confidence            469999754  33333 457899988886  4666655


No 142
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=44.92  E-value=26  Score=24.32  Aligned_cols=14  Identities=21%  Similarity=0.494  Sum_probs=7.4

Q ss_pred             eeeeeecCcCeEEe
Q psy836           82 VGIWSCKRCKRIVA   95 (122)
Q Consensus        82 vtV~s~~rC~~~~A   95 (122)
                      .++-.|..||.++|
T Consensus        36 st~V~C~~CG~~l~   49 (67)
T COG2051          36 STVVTCLICGTTLA   49 (67)
T ss_pred             ceEEEecccccEEE
Confidence            33344666666554


No 143
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=44.20  E-value=8.2  Score=26.87  Aligned_cols=47  Identities=17%  Similarity=0.255  Sum_probs=20.3

Q ss_pred             ccccccChhhhHhHHHHHHHhhccccCCCCCCce-eEeEEeeeeeecCcce
Q psy836           18 KYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDS-MKRSCVGIWSCKRCKR   67 (122)
Q Consensus        18 kyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~-mkR~avGIW~C~~C~~   67 (122)
                      +...+||.+....- ++...  ....|+.|+++. ......-+=||-.+|.
T Consensus         2 ~~~~~Ygit~~~~~-~l~~~--q~~~C~iC~~~~~~~~~~~~vDHdH~tG~   49 (81)
T PF02945_consen    2 RLKRRYGITPEEYE-ALLEE--QGGRCAICGKPLPGESRKLVVDHDHKTGR   49 (81)
T ss_dssp             -----H-HHHHHHH-CCHHH--TTTE-TTT-SEEETTCGGCEEEE-TTTTB
T ss_pred             CcccccCCCHHHHH-HHHHH--hCCcCcCCCCCcccCCCcceecCCCCCCC
Confidence            35678999987665 33333  344899999832 1122223335555544


No 144
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=43.71  E-value=19  Score=28.93  Aligned_cols=59  Identities=22%  Similarity=0.405  Sum_probs=40.8

Q ss_pred             HHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEecccccc
Q psy836           36 ITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVY  101 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~  101 (122)
                      -..-+.+.|..||+     .-.|-|+|++.-.+=|--+--|.-.++-.-  |..||.-..|+.-.+
T Consensus        82 R~RD~~~~CiSCG~-----~~~~~~dagHy~s~g~~~~lRF~~~N~~~q--C~~CN~~~sgn~~~Y  140 (189)
T PF05766_consen   82 RLRDAGKPCISCGR-----KHGGQWDAGHYRSRGAAPELRFNEDNIHAQ--CKHCNRHLSGNIVEY  140 (189)
T ss_pred             HHHhcCCCcccCCC-----cCCCCcccccccccccCcccccChhhHhHc--CCccccccccCHHHH
Confidence            34446899999999     345889998887763444444444444444  999999988876543


No 145
>PRK04351 hypothetical protein; Provisional
Probab=43.59  E-value=17  Score=27.65  Aligned_cols=29  Identities=24%  Similarity=0.685  Sum_probs=18.7

Q ss_pred             ccccCCCCCCc--eeEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKD--SMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~--~mkR~avGIW~C~~C~~~   68 (122)
                      -.|.|..||..  +.+|...-.+.|..|+-.
T Consensus       111 y~Y~C~~Cg~~~~r~Rr~n~~~yrCg~C~g~  141 (149)
T PRK04351        111 YLYECQSCGQQYLRKRRINTKRYRCGKCRGK  141 (149)
T ss_pred             EEEECCCCCCEeeeeeecCCCcEEeCCCCcE
Confidence            45778888874  345555566777766644


No 146
>PLN03086 PRLI-interacting factor K; Provisional
Probab=43.49  E-value=5.9  Score=36.48  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=21.1

Q ss_pred             cCCC--CCCceeEeEEeeeeeecCcceeee
Q psy836           43 TCSF--CGKDSMKRSCVGIWSCKRCKRIVA   70 (122)
Q Consensus        43 ~Cp~--Cgk~~mkR~avGIW~C~~C~~~vA   70 (122)
                      .||.  ||..-.++.----|+|+.|++.+.
T Consensus       435 ~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~  464 (567)
T PLN03086        435 VCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ  464 (567)
T ss_pred             eCCcccccceeeccccccCccCCCCCCccc
Confidence            3653  888877777777888888888764


No 147
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=43.49  E-value=7.8  Score=29.42  Aligned_cols=12  Identities=8%  Similarity=0.157  Sum_probs=8.8

Q ss_pred             hccccCCCCCCc
Q psy836           39 HAKYTCSFCGKD   50 (122)
Q Consensus        39 ~aky~Cp~Cgk~   50 (122)
                      ..-|.||.|+..
T Consensus       107 ~~~Y~Cp~c~~r  118 (158)
T TIGR00373       107 NMFFICPNMCVR  118 (158)
T ss_pred             CCeEECCCCCcE
Confidence            456889999854


No 148
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=42.28  E-value=6.1  Score=34.17  Aligned_cols=59  Identities=22%  Similarity=0.522  Sum_probs=35.9

Q ss_pred             HHHHHhhccc----cCCCCCCc---eeEeEE---eee-----------e-----eecCcceeeecceeeeec--cceeee
Q psy836           33 KMEITQHAKY----TCSFCGKD---SMKRSC---VGI-----------W-----SCKRCKRIVAGGAWDSMK--RSCVGI   84 (122)
Q Consensus        33 kie~~~~aky----~Cp~Cgk~---~mkR~a---vGI-----------W-----~C~~C~~~vAggAy~~~t--~~AvtV   84 (122)
                      .|+.+.+.++    .||.||..   +|-+..   .|.           |     +|..|+.+=--+=|.+.+  -++|-.
T Consensus       173 ~i~~~~~~e~e~~~~CPvCGS~PvaSmV~~g~~~~GlRYL~CslC~teW~~VR~KC~nC~~t~~l~y~sl~s~E~A~vkA  252 (308)
T COG3058         173 GIPGKARVENESRQYCPVCGSMPVASMVQIGETEQGLRYLHCSLCETEWHYVRVKCSNCEQSKKLHYWSLESSELAAVKA  252 (308)
T ss_pred             cCCccccccccccccCCCcCCCCcceeeeecCccccchhhhhhhHHHHHHHHHHHhccccccCCccceeccchhhhHhhh
Confidence            4455555555    89999987   344433   222           3     367777765555555544  566666


Q ss_pred             eeecCcC
Q psy836           85 WSCKRCK   91 (122)
Q Consensus        85 ~s~~rC~   91 (122)
                      -+|..|+
T Consensus       253 EtC~~C~  259 (308)
T COG3058         253 ETCGDCN  259 (308)
T ss_pred             hcCCcHH
Confidence            7777774


No 149
>PRK14873 primosome assembly protein PriA; Provisional
Probab=42.03  E-value=16  Score=33.90  Aligned_cols=39  Identities=28%  Similarity=0.573  Sum_probs=23.4

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeE
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~   93 (122)
                      ..||.|+-.-.--...+.=.|..||..            + .-|.|..||-.
T Consensus       393 ~~C~~C~~~L~~h~~~~~l~Ch~CG~~------------~-~p~~Cp~Cgs~  431 (665)
T PRK14873        393 ARCRHCTGPLGLPSAGGTPRCRWCGRA------------A-PDWRCPRCGSD  431 (665)
T ss_pred             eECCCCCCceeEecCCCeeECCCCcCC------------C-cCccCCCCcCC
Confidence            356777655433345566778888764            1 13558888653


No 150
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=41.85  E-value=23  Score=31.91  Aligned_cols=39  Identities=23%  Similarity=0.362  Sum_probs=19.8

Q ss_pred             hhhhHhHHHHHHHhhccc--------cCCCCCCceeEeEEeeeeeecCccee
Q psy836           25 ASLRKMVKKMEITQHAKY--------TCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        25 ~slRK~v~kie~~~~aky--------~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|++.|+++.....-.|        .|+.||....     +.+.||.||..
T Consensus       467 ~al~~lv~~~~~~~~i~Y~~in~~~~~C~~CG~~~~-----~~~~CP~CGs~  513 (546)
T PF13597_consen  467 EALEKLVRYAMENTGIPYFTINPPIDICPDCGYIGG-----EGDKCPKCGSE  513 (546)
T ss_dssp             HHHHHHHHHHHH--H-SEEEEE--EEEETTT---S-------EEE-CCC---
T ss_pred             HHHHHHHHHHHHhCCCCeEEEecCcccccCCCcCCC-----CCCCCCCCCCc
Confidence            456777777777444444        4999997543     37899999987


No 151
>PRK06450 threonine synthase; Validated
Probab=41.66  E-value=9.6  Score=31.93  Aligned_cols=25  Identities=32%  Similarity=0.638  Sum_probs=17.8

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ++.|+.||+..-   ..-.|.|+.|+-.
T Consensus         3 ~~~C~~Cg~~~~---~~~~~~C~~cg~~   27 (338)
T PRK06450          3 KEVCMKCGKERE---SIYEIRCKKCGGP   27 (338)
T ss_pred             eeEECCcCCcCC---CcccccCCcCCCE
Confidence            478999998852   1335899999743


No 152
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=41.59  E-value=25  Score=19.76  Aligned_cols=21  Identities=19%  Similarity=0.586  Sum_probs=9.6

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcc
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCK   66 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~   66 (122)
                      .|..|++..-.-.   .++|..|+
T Consensus         2 ~C~~C~~~~~~~~---~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFY---FYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCE---eEEeCCCC
Confidence            4555544432222   45555555


No 153
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.56  E-value=20  Score=26.64  Aligned_cols=14  Identities=14%  Similarity=0.527  Sum_probs=8.4

Q ss_pred             eeeeeecCcceeee
Q psy836           57 VGIWSCKRCKRIVA   70 (122)
Q Consensus        57 vGIW~C~~C~~~vA   70 (122)
                      -..|.|+.||..+.
T Consensus        68 p~~~~C~~CG~~~~   81 (135)
T PRK03824         68 EAVLKCRNCGNEWS   81 (135)
T ss_pred             ceEEECCCCCCEEe
Confidence            35667777765543


No 154
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=40.92  E-value=30  Score=27.47  Aligned_cols=26  Identities=23%  Similarity=0.503  Sum_probs=15.4

Q ss_pred             cCCCCCCce-eEeEEe-----------eeeeecCccee
Q psy836           43 TCSFCGKDS-MKRSCV-----------GIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~-mkR~av-----------GIW~C~~C~~~   68 (122)
                      .||.||... .+=.-+           =-+.|++||.+
T Consensus         2 ~Cp~C~~~~~~~~~~~~~IP~F~evii~sf~C~~CGyr   39 (192)
T TIGR00310         2 DCPSCGGECETVMKTVNDIPYFGEVLETSTICEHCGYR   39 (192)
T ss_pred             cCCCCCCCCEEEEEEEcCCCCcceEEEEEEECCCCCCc
Confidence            599998652 222222           24778888764


No 155
>smart00355 ZnF_C2H2 zinc finger.
Probab=40.84  E-value=14  Score=18.03  Aligned_cols=9  Identities=56%  Similarity=1.257  Sum_probs=5.7

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      |.|+.|++.
T Consensus         1 ~~C~~C~~~    9 (26)
T smart00355        1 YRCPECGKV    9 (26)
T ss_pred             CCCCCCcch
Confidence            467777654


No 156
>smart00507 HNHc HNH nucleases.
Probab=40.46  E-value=22  Score=19.97  Aligned_cols=14  Identities=29%  Similarity=0.847  Sum_probs=10.6

Q ss_pred             HhhccccCCCCCCce
Q psy836           37 TQHAKYTCSFCGKDS   51 (122)
Q Consensus        37 ~~~aky~Cp~Cgk~~   51 (122)
                      .++. +.|++||...
T Consensus         7 ~~r~-~~C~~C~~~~   20 (52)
T smart00507        7 LHRD-GVCAYCGKPA   20 (52)
T ss_pred             HHHC-CCCcCCcCCC
Confidence            3445 8999999875


No 157
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=40.39  E-value=18  Score=27.26  Aligned_cols=23  Identities=26%  Similarity=0.862  Sum_probs=14.5

Q ss_pred             eeeeecCcCeEEeccccccCchHHHHHHHH
Q psy836           83 GIWSCKRCKRIVAGGAWVYNTTAATSVRSA  112 (122)
Q Consensus        83 tV~s~~rC~~~~AGGAy~~~T~~~~~~~~~  112 (122)
                      -||||..|       -|.++-..+..+.+.
T Consensus        61 ~VwSC~dC-------~~iH~ke~~~~ilr~   83 (112)
T COG2158          61 KVWSCSDC-------HWIHRKEGAEEILRE   83 (112)
T ss_pred             EEeecccc-------ceecccchHHHHHHH
Confidence            37778888       466666666555433


No 158
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=40.37  E-value=23  Score=30.13  Aligned_cols=31  Identities=16%  Similarity=0.440  Sum_probs=17.7

Q ss_pred             eecCcceeeecce-eeeec---cceeeeeeecCcCe
Q psy836           61 SCKRCKRIVAGGA-WDSMK---RSCVGIWSCKRCKR   92 (122)
Q Consensus        61 ~C~~C~~~vAggA-y~~~t---~~AvtV~s~~rC~~   92 (122)
                      .|+.|+.. -+-. |++..   ..++-+-+|..|+-
T Consensus       226 ~C~~Cg~~-~~l~y~~~e~~~~~~~~r~e~C~~C~~  260 (305)
T TIGR01562       226 KCSHCEES-KHLAYLSLEHDAEKAVLKAETCDSCQG  260 (305)
T ss_pred             cCCCCCCC-CceeeEeecCCCCCcceEEeecccccc
Confidence            37777764 1222 33322   35677778999963


No 159
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=40.07  E-value=17  Score=25.16  Aligned_cols=25  Identities=20%  Similarity=0.602  Sum_probs=12.3

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCccee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      +.| .||....-+..+---+| .||++
T Consensus         4 frC-~Cgr~lya~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen    4 FRC-DCGRYLYAKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EEE-TTS--EEEETT-SEEEE-TTTEE
T ss_pred             EEe-cCCCEEEecCCcceeEe-cCCCe
Confidence            345 46666655555555565 55554


No 160
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=39.77  E-value=25  Score=28.83  Aligned_cols=30  Identities=20%  Similarity=0.538  Sum_probs=17.8

Q ss_pred             ccccCCCCCCce-----------eEeEEeeeeeecCcceee
Q psy836           40 AKYTCSFCGKDS-----------MKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        40 aky~Cp~Cgk~~-----------mkR~avGIW~C~~C~~~v   69 (122)
                      ..-.||.||..-           +.+.-.--|.|.+||..-
T Consensus        13 ~~~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~   53 (201)
T COG1779          13 TRIDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRS   53 (201)
T ss_pred             eeecCCcccceeeEEEeeecCCccceEEEEEEEccccCCcc
Confidence            345699999841           133444556666666653


No 161
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=39.70  E-value=21  Score=21.40  Aligned_cols=14  Identities=29%  Similarity=0.593  Sum_probs=10.3

Q ss_pred             cCCCCCCceeEeEE
Q psy836           43 TCSFCGKDSMKRSC   56 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~a   56 (122)
                      .||.||..-+.|.+
T Consensus         3 ~CP~Cg~~lv~r~~   16 (39)
T PF01396_consen    3 KCPKCGGPLVLRRG   16 (39)
T ss_pred             CCCCCCceeEEEEC
Confidence            69999987655543


No 162
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=39.31  E-value=20  Score=24.70  Aligned_cols=15  Identities=20%  Similarity=0.782  Sum_probs=11.2

Q ss_pred             ccCCCCCCceeEeEE
Q psy836           42 YTCSFCGKDSMKRSC   56 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~a   56 (122)
                      ..||+||....-|.+
T Consensus         2 m~CP~Cg~~a~irtS   16 (72)
T PRK09678          2 FHCPLCQHAAHARTS   16 (72)
T ss_pred             ccCCCCCCccEEEEC
Confidence            479999999855544


No 163
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=38.69  E-value=14  Score=24.40  Aligned_cols=13  Identities=31%  Similarity=0.606  Sum_probs=7.3

Q ss_pred             cccCCCCCCceeE
Q psy836           41 KYTCSFCGKDSMK   53 (122)
Q Consensus        41 ky~Cp~Cgk~~mk   53 (122)
                      .+.|+.|++...+
T Consensus         4 eiRC~~CnklLa~   16 (51)
T PF10122_consen    4 EIRCGHCNKLLAK   16 (51)
T ss_pred             ceeccchhHHHhh
Confidence            4556666665444


No 164
>PRK06386 replication factor A; Reviewed
Probab=38.54  E-value=13  Score=32.33  Aligned_cols=20  Identities=30%  Similarity=0.454  Sum_probs=13.8

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ..||.|++.--+      |.|+.||.
T Consensus       237 ~rCP~C~R~l~~------g~C~~HG~  256 (358)
T PRK06386        237 TKCSVCNKIIED------GVCKDHPD  256 (358)
T ss_pred             ecCcCCCeEccC------CcCCCCCC
Confidence            568888765442      68888876


No 165
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=38.51  E-value=4.2  Score=26.03  Aligned_cols=26  Identities=38%  Similarity=0.907  Sum_probs=17.4

Q ss_pred             cCCCCCCce--eEe--EEeeeeeecCcceee
Q psy836           43 TCSFCGKDS--MKR--SCVGIWSCKRCKRIV   69 (122)
Q Consensus        43 ~Cp~Cgk~~--mkR--~avGIW~C~~C~~~v   69 (122)
                      .|+.||+..  +.|  .+=| |-|+.|.+++
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            499998873  332  4456 7877777664


No 166
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=38.44  E-value=14  Score=32.09  Aligned_cols=54  Identities=20%  Similarity=0.317  Sum_probs=39.9

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcceeeecceeee-eccceeeeeeecCcCeEEecccccc
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDS-MKRSCVGIWSCKRCKRIVAGGAWVY  101 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~-~t~~AvtV~s~~rC~~~~AGGAy~~  101 (122)
                      .-.||+||+.--   ..----|+.|-..    .+.. .+.-.+.|.-|..||..+-+|-|.-
T Consensus         6 ~~~C~~CGr~~~---~~~~~lC~dC~~~----~~~~~~ip~~~~v~~C~~Cga~~~~~~W~~   60 (355)
T COG1499           6 TILCVRCGRSVD---PLIDGLCGDCYVE----TTPLIEIPDEVNVEVCRHCGAYRIRGRWVD   60 (355)
T ss_pred             ccEeccCCCcCc---hhhccccHHHHhc----cCccccCCCceEEEECCcCCCccCCCccee
Confidence            457999999865   2222368899876    2333 3334788888999999999999988


No 167
>COG4640 Predicted membrane protein [Function unknown]
Probab=38.24  E-value=14  Score=33.55  Aligned_cols=27  Identities=19%  Similarity=0.495  Sum_probs=18.5

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecce
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGA   73 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggA   73 (122)
                      .||-||+..    +-+--+|+.||..+.++-
T Consensus         3 fC~kcG~qk----~Ed~~qC~qCG~~~t~~~   29 (465)
T COG4640           3 FCPKCGSQK----AEDDVQCTQCGHKFTSRQ   29 (465)
T ss_pred             ccccccccc----ccccccccccCCcCCchh
Confidence            588888765    344556888888776653


No 168
>smart00400 ZnF_CHCC zinc finger.
Probab=38.12  E-value=32  Score=21.35  Aligned_cols=26  Identities=27%  Similarity=0.516  Sum_probs=16.1

Q ss_pred             ccCCCCCCc--eeEeE-EeeeeeecCcce
Q psy836           42 YTCSFCGKD--SMKRS-CVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~--~mkR~-avGIW~C~~C~~   67 (122)
                      ..|||++..  ++.-. .-+.|+|-.|+.
T Consensus         3 ~~cPfh~d~~pSf~v~~~kn~~~Cf~cg~   31 (55)
T smart00400        3 GLCPFHGEKTPSFSVSPDKQFFHCFGCGA   31 (55)
T ss_pred             ccCcCCCCCCCCEEEECCCCEEEEeCCCC
Confidence            359999755  44333 347788766653


No 169
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=38.07  E-value=23  Score=26.58  Aligned_cols=30  Identities=13%  Similarity=0.276  Sum_probs=17.9

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecce
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGA   73 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggA   73 (122)
                      .||.|+..-..-.. ..|-|+.|+.-|+..+
T Consensus         4 ~CP~C~seytY~dg-~~~iCpeC~~EW~~~~   33 (109)
T TIGR00686         4 PCPKCNSEYTYHDG-TQLICPSCLYEWNENE   33 (109)
T ss_pred             cCCcCCCcceEecC-CeeECccccccccccc
Confidence            47777766444332 2577777776665543


No 170
>TIGR00617 rpa1 replication factor-a protein 1 (rpa1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.04  E-value=20  Score=32.68  Aligned_cols=13  Identities=15%  Similarity=0.348  Sum_probs=9.5

Q ss_pred             hhhHhHHHHHHHh
Q psy836           26 SLRKMVKKMEITQ   38 (122)
Q Consensus        26 slRK~v~kie~~~   38 (122)
                      .-||-+.+|...+
T Consensus       436 ~~~ktI~ei~~~~  448 (608)
T TIGR00617       436 AERKTIAEIQAEN  448 (608)
T ss_pred             cccccHHHHhhhc
Confidence            4688888887654


No 171
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=38.00  E-value=20  Score=21.17  Aligned_cols=14  Identities=36%  Similarity=0.821  Sum_probs=10.5

Q ss_pred             cccCCCCCCceeEe
Q psy836           41 KYTCSFCGKDSMKR   54 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR   54 (122)
                      +..||.||...+.+
T Consensus         2 ~~~Cp~Cg~~~~~~   15 (47)
T PF14690_consen    2 PPRCPHCGSPSVHR   15 (47)
T ss_pred             CccCCCcCCCceEC
Confidence            56799999887544


No 172
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=37.99  E-value=19  Score=21.60  Aligned_cols=12  Identities=25%  Similarity=0.908  Sum_probs=6.6

Q ss_pred             ecCcCeEEeccc
Q psy836           87 CKRCKRIVAGGA   98 (122)
Q Consensus        87 ~~rC~~~~AGGA   98 (122)
                      |..|++.+.++.
T Consensus        29 C~~C~~~l~~~~   40 (58)
T PF00412_consen   29 CSKCGKPLNDGD   40 (58)
T ss_dssp             ETTTTCBTTTSS
T ss_pred             cCCCCCccCCCe
Confidence            555555555554


No 173
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=37.85  E-value=27  Score=29.86  Aligned_cols=52  Identities=23%  Similarity=0.572  Sum_probs=29.4

Q ss_pred             ccccCCCCCCc---eeEeE--Eeee-----------e-----eecCcceeeeccee-eeecc-ceeeeeeecCcCe
Q psy836           40 AKYTCSFCGKD---SMKRS--CVGI-----------W-----SCKRCKRIVAGGAW-DSMKR-SCVGIWSCKRCKR   92 (122)
Q Consensus        40 aky~Cp~Cgk~---~mkR~--avGI-----------W-----~C~~C~~~vAggAy-~~~t~-~AvtV~s~~rC~~   92 (122)
                      .+..||.||..   +|-+.  ..|.           |     .|+.|+.. -+-.| ++..- .++-+-+|..|+-
T Consensus       186 ~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~-~~l~y~~~~~~~~~~r~e~C~~C~~  260 (309)
T PRK03564        186 QRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVRVKCSNCEQS-GKLHYWSLDSEQAAVKAESCGDCGT  260 (309)
T ss_pred             CCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccCccCCCCCCC-CceeeeeecCCCcceEeeecccccc
Confidence            46789999887   33221  1221           3     37777763 12222 22222 5778888999974


No 174
>PRK05667 dnaG DNA primase; Validated
Probab=37.53  E-value=16  Score=33.15  Aligned_cols=33  Identities=18%  Similarity=0.379  Sum_probs=22.0

Q ss_pred             ccCCCCCCc--eeE-eEEeeeeeecCcceeeecceeee
Q psy836           42 YTCSFCGKD--SMK-RSCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        42 y~Cp~Cgk~--~mk-R~avGIW~C~~C~~~vAggAy~~   76 (122)
                      ..||||+..  ++. -..-++|+|-.||.  .|++.++
T Consensus        37 ~~CPfH~ektpSf~V~~~k~~~~CF~Cg~--~Gd~i~f   72 (580)
T PRK05667         37 GLCPFHDEKTPSFTVSPDKQFYHCFGCGA--GGDVIKF   72 (580)
T ss_pred             ecCCCCCCCCCceEEECCCCeEEECCCCC--CCCHHHH
Confidence            359999854  332 23568999988886  3666555


No 175
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=37.46  E-value=19  Score=25.23  Aligned_cols=21  Identities=29%  Similarity=0.759  Sum_probs=16.3

Q ss_pred             cccCCCCCCceeEeEEeeeee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWS   61 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~   61 (122)
                      ||.||-||...+....-|.+-
T Consensus         1 K~~CPCCg~~Tl~~~~~~~yd   21 (78)
T PF14206_consen    1 KYPCPCCGYYTLEERGEGTYD   21 (78)
T ss_pred             CccCCCCCcEEeccCCCcCce
Confidence            689999999988777655443


No 176
>PHA02768 hypothetical protein; Provisional
Probab=37.34  E-value=14  Score=24.49  Aligned_cols=16  Identities=38%  Similarity=0.910  Sum_probs=11.7

Q ss_pred             cccCCCCCCceeEeEE
Q psy836           41 KYTCSFCGKDSMKRSC   56 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~a   56 (122)
                      -|.||.||+.-..+.+
T Consensus         5 ~y~C~~CGK~Fs~~~~   20 (55)
T PHA02768          5 GYECPICGEIYIKRKS   20 (55)
T ss_pred             ccCcchhCCeeccHHH
Confidence            5899999998655443


No 177
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=37.10  E-value=18  Score=27.64  Aligned_cols=54  Identities=19%  Similarity=0.288  Sum_probs=30.6

Q ss_pred             hHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeE
Q psy836           30 MVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        30 ~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~   93 (122)
                      +|.-.|..+..+|.=.+   .+=.-..-|...|..||..+.     + +. +..|-.|++|+.+
T Consensus        86 qvEw~el~~d~~h~g~Y---~sGE~~g~G~l~C~~Cg~~~~-----~-~~-~~~l~~Cp~C~~~  139 (146)
T PF07295_consen   86 QVEWAELAQDLEHHGVY---HSGEVVGPGTLVCENCGHEVE-----L-TH-PERLPPCPKCGHT  139 (146)
T ss_pred             HHHHHHHHHHHHhcCCe---ecCcEecCceEecccCCCEEE-----e-cC-CCcCCCCCCCCCC
Confidence            44444444444444211   123345778888999988742     2 22 3457789999754


No 178
>PRK07220 DNA topoisomerase I; Validated
Probab=37.00  E-value=29  Score=32.36  Aligned_cols=27  Identities=19%  Similarity=0.407  Sum_probs=18.2

Q ss_pred             cccCCCCCCceeEeEEee----eeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSCVG----IWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avG----IW~C~~C~~   67 (122)
                      ...||.||...++...-|    .|.|+.|..
T Consensus       635 ~~~Cp~Cg~~~~k~~~~g~~~~~~~Cp~C~~  665 (740)
T PRK07220        635 DKVCEAHGLNHIRIINGGKRPWDLGCPQCNF  665 (740)
T ss_pred             CCCCCCCCCceEEEEecCCccceeeCCCCCC
Confidence            467999987655444434    578877775


No 179
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=36.80  E-value=29  Score=19.22  Aligned_cols=23  Identities=22%  Similarity=0.541  Sum_probs=9.5

Q ss_pred             cCCCCCCce--eEeEEeeeeeecCc
Q psy836           43 TCSFCGKDS--MKRSCVGIWSCKRC   65 (122)
Q Consensus        43 ~Cp~Cgk~~--mkR~avGIW~C~~C   65 (122)
                      .||.|+...  +.-.+-...-|+.|
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rC   27 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRC   27 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTT
T ss_pred             cCccCCCcceEeEecCCCCeECcCC
Confidence            588888773  22222344555555


No 180
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=36.66  E-value=24  Score=25.91  Aligned_cols=16  Identities=6%  Similarity=0.200  Sum_probs=8.8

Q ss_pred             ccChhhhHhHHHHHHH
Q psy836           22 RYGASLRKMVKKMEIT   37 (122)
Q Consensus        22 RYG~slRK~v~kie~~   37 (122)
                      ..|...+..+.++...
T Consensus        80 ~Hg~~f~~~~~~~~~~   95 (146)
T smart00731       80 GHGDEWKRWMRQVNGL   95 (146)
T ss_pred             CcCHHHHHHHHHHcCC
Confidence            4555566655555443


No 181
>PHA00732 hypothetical protein
Probab=36.51  E-value=17  Score=24.99  Aligned_cols=13  Identities=46%  Similarity=0.445  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHH
Q psy836          106 ATSVRSAIRRLRE  118 (122)
Q Consensus       106 ~~~~~~~i~rl~e  118 (122)
                      .-.|+-+|.|--|
T Consensus        65 ~~~~~~~~~~~~~   77 (79)
T PHA00732         65 PYHVRLAIKRKLE   77 (79)
T ss_pred             hHHHHHHHHHHhc
Confidence            4456666766544


No 182
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=36.48  E-value=13  Score=19.62  Aligned_cols=9  Identities=44%  Similarity=1.272  Sum_probs=4.7

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      |+|+.|++.
T Consensus         2 ~~C~~C~~~   10 (27)
T PF13912_consen    2 FECDECGKT   10 (27)
T ss_dssp             EEETTTTEE
T ss_pred             CCCCccCCc
Confidence            455555543


No 183
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=36.33  E-value=15  Score=24.34  Aligned_cols=12  Identities=42%  Similarity=1.085  Sum_probs=4.5

Q ss_pred             hccccCCCCCCc
Q psy836           39 HAKYTCSFCGKD   50 (122)
Q Consensus        39 ~aky~Cp~Cgk~   50 (122)
                      ..+|+||.||.+
T Consensus        31 Lr~y~Cp~CgAt   42 (55)
T PF05741_consen   31 LRKYVCPICGAT   42 (55)
T ss_dssp             GGG---TTT---
T ss_pred             HhcCcCCCCcCc
Confidence            356999999976


No 184
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=36.31  E-value=26  Score=22.90  Aligned_cols=28  Identities=21%  Similarity=0.720  Sum_probs=15.3

Q ss_pred             cccCCCCCCce-eEeEEee-eeeecCccee
Q psy836           41 KYTCSFCGKDS-MKRSCVG-IWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~-mkR~avG-IW~C~~C~~~   68 (122)
                      .++||.||..- +.-...| |=.|+.||..
T Consensus         2 ~~~CP~CG~~iev~~~~~GeiV~Cp~CGae   31 (54)
T TIGR01206         2 QFECPDCGAEIELENPELGELVICDECGAE   31 (54)
T ss_pred             ccCCCCCCCEEecCCCccCCEEeCCCCCCE
Confidence            35789998862 2221112 4566666653


No 185
>KOG1986|consensus
Probab=36.19  E-value=18  Score=34.64  Aligned_cols=35  Identities=23%  Similarity=0.400  Sum_probs=28.2

Q ss_pred             HHHHhhccccCCCCCCce----eEeEEeeeeeecCccee
Q psy836           34 MEITQHAKYTCSFCGKDS----MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        34 ie~~~~aky~Cp~Cgk~~----mkR~avGIW~C~~C~~~   68 (122)
                      +-..++++..|..|+...    .-....++|.|+.|+..
T Consensus        46 ~~~~~y~P~~C~~C~AvlNPyc~vd~~a~~W~CpfC~qr   84 (745)
T KOG1986|consen   46 LPPIQYDPLRCSKCGAVLNPYCSVDFRAKSWICPFCNQR   84 (745)
T ss_pred             CCccCCCCchhccchhhcCcceeecccCceEeccccccC
Confidence            346788999999999873    56677889999999864


No 186
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=35.97  E-value=27  Score=32.40  Aligned_cols=39  Identities=26%  Similarity=0.330  Sum_probs=26.7

Q ss_pred             hhhhHhHHHHHHHhhccc--------cCCCCCCceeEeEEeeeeeecCccee
Q psy836           25 ASLRKMVKKMEITQHAKY--------TCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        25 ~slRK~v~kie~~~~aky--------~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|++.|+.+-....-.|        .|+.||... ..    .|.||.||+.
T Consensus       602 ~a~~~lv~~~~~~~~i~Y~~in~~~~~C~~CG~~~-g~----~~~CP~CG~~  648 (656)
T PRK08270        602 EACKKLVKKALENYRLPYITITPTFSICPKHGYLS-GE----HEFCPKCGEE  648 (656)
T ss_pred             HHHHHHHHHHHHhCCCceEEeCCCCcccCCCCCcC-CC----CCCCcCCcCc
Confidence            577888888865433333        599999742 22    4999999864


No 187
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=35.73  E-value=34  Score=27.79  Aligned_cols=27  Identities=22%  Similarity=0.615  Sum_probs=17.3

Q ss_pred             ccccCCCCCCceeEeEEe---eeeeecCcce
Q psy836           40 AKYTCSFCGKDSMKRSCV---GIWSCKRCKR   67 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~av---GIW~C~~C~~   67 (122)
                      ..-.||.||.+- .+..+   +.|-|+.|-+
T Consensus       244 ~g~pC~~Cg~~I-~~~~~~gR~t~~CP~CQ~  273 (274)
T PRK01103        244 EGEPCRRCGTPI-EKIKQGGRSTFFCPRCQK  273 (274)
T ss_pred             CCCCCCCCCCee-EEEEECCCCcEECcCCCC
Confidence            445699999774 44444   3677777743


No 188
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=35.47  E-value=13  Score=32.61  Aligned_cols=26  Identities=35%  Similarity=1.011  Sum_probs=18.4

Q ss_pred             ccCCCCCCce--eEeEEee--eeeecCcce
Q psy836           42 YTCSFCGKDS--MKRSCVG--IWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~--mkR~avG--IW~C~~C~~   67 (122)
                      ..|+|||+..  +.+.-.|  .+-|..|-.
T Consensus         8 ~~c~fc~~~~~~~~~~~~~~~~~ic~~c~~   37 (413)
T TIGR00382         8 LYCSFCGKSQDEVRKLIAGPGVYICDECIE   37 (413)
T ss_pred             eecCCCCCChhhcccccCCCCCcCCCchHH
Confidence            3799999974  5555555  678888753


No 189
>PF04071 zf-like:  Cysteine-rich small domain;  InterPro: IPR007212 This is a probable metal-binding domain. It is found in a probable precorrin-3B C17-methyltransferase from Methanobacterium thermoautotrophicum, that catalyses the methylation of C-17 in precorrin-3B to form precorrin-4.
Probab=35.02  E-value=26  Score=25.02  Aligned_cols=19  Identities=26%  Similarity=0.777  Sum_probs=11.7

Q ss_pred             ceeeeeccceeeeeeecCcC
Q psy836           72 GAWDSMKRSCVGIWSCKRCK   91 (122)
Q Consensus        72 gAy~~~t~~AvtV~s~~rC~   91 (122)
                      |-|.... +-..||+|..|.
T Consensus        40 G~~~~~~-~G~~vw~C~~C~   58 (86)
T PF04071_consen   40 GNFIYTK-NGSKVWDCSDCT   58 (86)
T ss_pred             ccEEEcC-CCCeeeECccCC
Confidence            5555533 223688899993


No 190
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=34.73  E-value=17  Score=34.18  Aligned_cols=37  Identities=24%  Similarity=0.538  Sum_probs=22.9

Q ss_pred             hhhhHhHHHHHHHhhccc--------cCCCCCCceeEeEEeeeeeecCcce
Q psy836           25 ASLRKMVKKMEITQHAKY--------TCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        25 ~slRK~v~kie~~~~aky--------~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ..+.+-|+.+.. ..-.|        .|+.||-....     -|.||.||.
T Consensus       657 eal~~lvk~~~~-~~i~Y~sin~~~~~C~~CG~~~~~-----~~~CP~CG~  701 (735)
T PRK07111        657 EAFEIIVKAMKN-TNIGYGSINHPVDRCPVCGYLGVI-----EDKCPKCGS  701 (735)
T ss_pred             HHHHHHHHHHHh-CCCceEEeCCCCeecCCCCCCCCc-----CccCcCCCC
Confidence            355666665432 23334        69999964432     299999986


No 191
>PRK10445 endonuclease VIII; Provisional
Probab=34.42  E-value=27  Score=28.35  Aligned_cols=26  Identities=19%  Similarity=0.581  Sum_probs=15.6

Q ss_pred             hccccCCCCCCceeEeEEe---eeeeecCc
Q psy836           39 HAKYTCSFCGKDSMKRSCV---GIWSCKRC   65 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~av---GIW~C~~C   65 (122)
                      +..-.||.||..- .+..+   +.|-|+.|
T Consensus       233 r~g~~Cp~Cg~~I-~~~~~~gR~t~~CP~C  261 (263)
T PRK10445        233 RDGEACERCGGII-EKTTLSSRPFYWCPGC  261 (263)
T ss_pred             CCCCCCCCCCCEe-EEEEECCCCcEECCCC
Confidence            3456799999663 33333   35666665


No 192
>KOG4623|consensus
Probab=34.35  E-value=15  Score=34.22  Aligned_cols=43  Identities=23%  Similarity=0.600  Sum_probs=34.3

Q ss_pred             ChhhhHhHHHHHHHhh-ccccCCCCCCc-eeEeEEeeeeeecCcc
Q psy836           24 GASLRKMVKKMEITQH-AKYTCSFCGKD-SMKRSCVGIWSCKRCK   66 (122)
Q Consensus        24 G~slRK~v~kie~~~~-aky~Cp~Cgk~-~mkR~avGIW~C~~C~   66 (122)
                      |+.|=+-++-|..... +.-.|=||.+. .+.+..-.-|+|++|-
T Consensus        10 ~a~l~~ly~~Irsr~k~t~VnCwFCnk~t~vpyq~rNswTCpsCE   54 (611)
T KOG4623|consen   10 GAGLGNLYDGIRSRFKDTTVNCWFCNKKTEVPYQGRNSWTCPSCE   54 (611)
T ss_pred             hhcchHHHHHHHhhcCCceEEEEEecCcceeccCCCCCCcCCcHH
Confidence            5666666777776666 77789999766 6999999999999994


No 193
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=34.25  E-value=28  Score=32.11  Aligned_cols=36  Identities=22%  Similarity=0.436  Sum_probs=25.6

Q ss_pred             hhhhHhHHHHHHHhhccc--------cCCCCCCceeEeEEee-e-eeecCcce
Q psy836           25 ASLRKMVKKMEITQHAKY--------TCSFCGKDSMKRSCVG-I-WSCKRCKR   67 (122)
Q Consensus        25 ~slRK~v~kie~~~~aky--------~Cp~Cgk~~mkR~avG-I-W~C~~C~~   67 (122)
                      ..+++.|+.+... +-.|        .|+.||..      .| . +.||.||.
T Consensus       509 ea~~~lv~~~~~~-~i~Y~tin~~~siC~~CGy~------~g~~~~~CP~CGs  554 (586)
T TIGR02827       509 DGYRKLLRVAADT-GCNYFCFNIKITICNDCHHI------DKRTLHRCPVCGS  554 (586)
T ss_pred             HHHHHHHHHHHhc-CCceEEeCCCCeecCCCCCc------CCCcCCcCcCCCC
Confidence            4688888888653 4444        49999972      23 2 99999986


No 194
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=34.18  E-value=17  Score=32.92  Aligned_cols=23  Identities=30%  Similarity=0.642  Sum_probs=19.5

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCcc
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCK   66 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~   66 (122)
                      ..|.|..||...-|+..    +|+.|+
T Consensus         6 t~f~C~~CG~~s~KW~G----kCp~Cg   28 (456)
T COG1066           6 TAFVCQECGYVSPKWLG----KCPACG   28 (456)
T ss_pred             cEEEcccCCCCCccccc----cCCCCC
Confidence            57999999999998764    788886


No 195
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=34.06  E-value=21  Score=28.28  Aligned_cols=48  Identities=19%  Similarity=0.472  Sum_probs=32.1

Q ss_pred             cccccChhhhHhHHHHHHHhhccccCCCCCCc--eeEeEEeee----eeecCccee
Q psy836           19 YGTRYGASLRKMVKKMEITQHAKYTCSFCGKD--SMKRSCVGI----WSCKRCKRI   68 (122)
Q Consensus        19 yG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~--~mkR~avGI----W~C~~C~~~   68 (122)
                      ||.||-.++-.-++.+.. ..-.|.|. |+..  +.+|...-.    +.|.+|+-+
T Consensus        96 ~~l~~~~~h~~~~~~v~~-~~~~Y~C~-C~q~~l~~RRhn~~~~g~~YrC~~C~gk  149 (156)
T COG3091          96 LGLRFCRTHQFEVQSVRR-TTYPYRCQ-CQQHYLRIRRHNTVRRGEVYRCGKCGGK  149 (156)
T ss_pred             CCCCCCccchHHHhhccc-cceeEEee-cCCccchhhhcccccccceEEeccCCce
Confidence            677777776665555433 34579999 9986  455555555    898888754


No 196
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=33.97  E-value=24  Score=30.22  Aligned_cols=24  Identities=29%  Similarity=0.486  Sum_probs=19.7

Q ss_pred             hccccCCCCCCc-eeEeEEeeeeee
Q psy836           39 HAKYTCSFCGKD-SMKRSCVGIWSC   62 (122)
Q Consensus        39 ~aky~Cp~Cgk~-~mkR~avGIW~C   62 (122)
                      ..+|.||.|+.. .+|.-...+||=
T Consensus        28 ~~~~~CP~C~~~v~lk~G~~k~~HF   52 (375)
T PF06054_consen   28 KGKYFCPGCGEPVILKKGKKKIPHF   52 (375)
T ss_pred             CCcEECCCCCCeeEEEEcCccccee
Confidence            789999999888 577777778883


No 197
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=33.93  E-value=15  Score=27.16  Aligned_cols=25  Identities=32%  Similarity=0.994  Sum_probs=17.4

Q ss_pred             cCCCCCCce-eEeEEee-eeeecCcce
Q psy836           43 TCSFCGKDS-MKRSCVG-IWSCKRCKR   67 (122)
Q Consensus        43 ~Cp~Cgk~~-mkR~avG-IW~C~~C~~   67 (122)
                      .|=|||+.+ +...... -|.|++|.-
T Consensus         2 ~C~fC~~~s~~~~~~~~~~w~C~~C~q   28 (131)
T PF09779_consen    2 NCWFCGQNSKVPYDNRNSNWTCPHCEQ   28 (131)
T ss_pred             eeccCCCCCCCCCCCCCCeeECCCCCC
Confidence            588999874 4444434 499999964


No 198
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=33.80  E-value=41  Score=24.08  Aligned_cols=29  Identities=31%  Similarity=0.472  Sum_probs=16.1

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCcceee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~~v   69 (122)
                      ..+.|..|+++.--=...| =.|..|...|
T Consensus        53 ~~~~C~~C~~~fg~l~~~~-~~C~~C~~~V   81 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRG-RVCVDCKHRV   81 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTC-EEETTTTEEE
T ss_pred             CCcchhhhCCcccccCCCC-CcCCcCCccc
Confidence            5678999988621111223 4788887764


No 199
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=33.63  E-value=35  Score=26.40  Aligned_cols=22  Identities=14%  Similarity=0.487  Sum_probs=16.0

Q ss_pred             HHHhhccccCCCCCCceeEeEE
Q psy836           35 EITQHAKYTCSFCGKDSMKRSC   56 (122)
Q Consensus        35 e~~~~aky~Cp~Cgk~~mkR~a   56 (122)
                      .+....--.||+||...+.|.-
T Consensus        26 ~Q~~~glv~CP~Cgs~~V~K~l   47 (148)
T PF06676_consen   26 RQQARGLVSCPVCGSTEVSKAL   47 (148)
T ss_pred             HHHHcCCccCCCCCCCeEeeec
Confidence            3444455789999999988763


No 200
>COG4643 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.52  E-value=15  Score=32.44  Aligned_cols=29  Identities=28%  Similarity=0.809  Sum_probs=22.0

Q ss_pred             hhccccCCCCCCc-eeE---eEEeeeeeecCcc
Q psy836           38 QHAKYTCSFCGKD-SMK---RSCVGIWSCKRCK   66 (122)
Q Consensus        38 ~~aky~Cp~Cgk~-~mk---R~avGIW~C~~C~   66 (122)
                      +-..|.||.||+. +++   |..-|-|.|..|+
T Consensus        29 ~~~~~~cpvcg~k~RFr~dD~kGrGtw~c~y~~   61 (366)
T COG4643          29 KPGGHPCPVCGGKDRFRFDDRKGRGTWFCNYCG   61 (366)
T ss_pred             cCCCCCCCccCCccccccCCccCCccEEEEeec
Confidence            3445699999866 443   6678999998888


No 201
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.45  E-value=24  Score=32.32  Aligned_cols=40  Identities=15%  Similarity=0.303  Sum_probs=23.2

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeE
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRI   93 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~   93 (122)
                      ..||.|+-.-.--...+.=.|..||.+            ...-+.|..||..
T Consensus       391 ~~C~~C~~~l~~h~~~~~l~Ch~Cg~~------------~~~~~~Cp~Cg~~  430 (679)
T PRK05580        391 AECPHCDASLTLHRFQRRLRCHHCGYQ------------EPIPKACPECGST  430 (679)
T ss_pred             cCCCCCCCceeEECCCCeEECCCCcCC------------CCCCCCCCCCcCC
Confidence            357777665433334455678888875            1122458888654


No 202
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=33.30  E-value=16  Score=32.06  Aligned_cols=13  Identities=23%  Similarity=0.396  Sum_probs=8.3

Q ss_pred             EeeeeeecCccee
Q psy836           56 CVGIWSCKRCKRI   68 (122)
Q Consensus        56 avGIW~C~~C~~~   68 (122)
                      ....|.|.-|+..
T Consensus       422 ~~~~~~c~~c~~~  434 (479)
T PRK05452        422 LGPRMQCSVCQWI  434 (479)
T ss_pred             CCCeEEECCCCeE
Confidence            3456777777765


No 203
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.17  E-value=18  Score=28.72  Aligned_cols=27  Identities=22%  Similarity=0.660  Sum_probs=16.8

Q ss_pred             ccCCCCCCcee--Ee-------------EEeeeeeecCccee
Q psy836           42 YTCSFCGKDSM--KR-------------SCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~m--kR-------------~avGIW~C~~C~~~   68 (122)
                      -.||.|+....  .+             .+.--|.|+.|++.
T Consensus        98 ~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~Cgki  139 (165)
T COG1656          98 SRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKI  139 (165)
T ss_pred             ccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCccc
Confidence            45999987742  22             33337777666664


No 204
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=33.05  E-value=61  Score=24.44  Aligned_cols=40  Identities=15%  Similarity=0.362  Sum_probs=23.3

Q ss_pred             hHhHHHHHHHhhcccc-CCCCCCc--eeEeEEeeee--eecCccee
Q psy836           28 RKMVKKMEITQHAKYT-CSFCGKD--SMKRSCVGIW--SCKRCKRI   68 (122)
Q Consensus        28 RK~v~kie~~~~aky~-Cp~Cgk~--~mkR~avGIW--~C~~C~~~   68 (122)
                      .+.+..+...=-.+|. ||.|+.+  .+.+. -.+|  +|.-||..
T Consensus        83 ~~~i~~~L~~yI~~yVlC~~C~sPdT~l~k~-~r~~~l~C~ACGa~  127 (133)
T TIGR00311        83 HFLLNERIEDYVRKYVICRECNRPDTRIIKE-GRVSLLKCEACGAK  127 (133)
T ss_pred             HHHHHHHHHHHHhheEECCCCCCCCcEEEEe-CCeEEEecccCCCC
Confidence            3445555544455564 9999998  34443 2344  67777653


No 205
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=33.01  E-value=58  Score=29.35  Aligned_cols=73  Identities=15%  Similarity=0.294  Sum_probs=43.6

Q ss_pred             cccCCCCCCce-eE----------eEEeeeeeecCcceeeecceeeeeccceeeeeeecCc--CeEEec----cccccCc
Q psy836           41 KYTCSFCGKDS-MK----------RSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRC--KRIVAG----GAWVYNT  103 (122)
Q Consensus        41 ky~Cp~Cgk~~-mk----------R~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC--~~~~AG----GAy~~~T  103 (122)
                      -..||.||... ++          ....-.+.|++||-.|-..-..-+.  +-+.|-+...  ....+|    +.|+|..
T Consensus       200 ~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~e~~k~~m~--~~G~Wv~~~~~~~~~~~gf~i~~l~Sp~~  277 (557)
T PF05876_consen  200 YVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIEEHDKRRMV--RRGRWVATNPDRRPRHVGFHINALYSPFV  277 (557)
T ss_pred             EccCCCCCCCccccccceeecCCCCccceEEECCCCcCCCCHHHHhhcc--CCeEEEeccccCCCCEEEEEeeeeecccC
Confidence            34699999874 33          2234578899999887764444433  3355556655  444444    6677766


Q ss_pred             hHHHHHHHHHHH
Q psy836          104 TAATSVRSAIRR  115 (122)
Q Consensus       104 ~~~~~~~~~i~r  115 (122)
                      +-+..++.-++-
T Consensus       278 sw~~ia~~~l~A  289 (557)
T PF05876_consen  278 SWAEIAREFLEA  289 (557)
T ss_pred             CHHHHHHHHHhh
Confidence            666555554443


No 206
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=32.83  E-value=19  Score=18.65  Aligned_cols=8  Identities=38%  Similarity=1.227  Sum_probs=3.7

Q ss_pred             ccCCCCCC
Q psy836           42 YTCSFCGK   49 (122)
Q Consensus        42 y~Cp~Cgk   49 (122)
                      |.|++|.-
T Consensus         1 y~C~~C~y    8 (24)
T PF13909_consen    1 YKCPHCSY    8 (24)
T ss_dssp             EE-SSSS-
T ss_pred             CCCCCCCC
Confidence            55666653


No 207
>PHA00733 hypothetical protein
Probab=32.57  E-value=12  Score=27.62  Aligned_cols=12  Identities=25%  Similarity=0.700  Sum_probs=8.5

Q ss_pred             hccccCCCCCCc
Q psy836           39 HAKYTCSFCGKD   50 (122)
Q Consensus        39 ~aky~Cp~Cgk~   50 (122)
                      ..+|.|+.||+.
T Consensus        71 ~kPy~C~~Cgk~   82 (128)
T PHA00733         71 VSPYVCPLCLMP   82 (128)
T ss_pred             CCCccCCCCCCc
Confidence            456778888765


No 208
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.32  E-value=14  Score=26.76  Aligned_cols=7  Identities=29%  Similarity=0.899  Sum_probs=3.3

Q ss_pred             ccCCCCC
Q psy836           42 YTCSFCG   48 (122)
Q Consensus        42 y~Cp~Cg   48 (122)
                      ..|+.||
T Consensus        72 ~~C~~Cg   78 (117)
T PRK00564         72 LECKDCS   78 (117)
T ss_pred             EEhhhCC
Confidence            3455554


No 209
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=32.07  E-value=30  Score=28.22  Aligned_cols=26  Identities=27%  Similarity=0.694  Sum_probs=16.5

Q ss_pred             cccCCCCCCceeEeEEe---eeeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSCV---GIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~av---GIW~C~~C~~   67 (122)
                      .-.||.||.+- .+..+   +.|-|+.|-+
T Consensus       235 g~pC~~Cg~~I-~~~~~~gR~ty~Cp~CQ~  263 (269)
T PRK14811        235 GQPCPRCGTPI-EKIVVGGRGTHFCPQCQP  263 (269)
T ss_pred             cCCCCcCCCee-EEEEECCCCcEECCCCcC
Confidence            44799999764 33433   3677776654


No 210
>KOG1311|consensus
Probab=31.58  E-value=18  Score=29.22  Aligned_cols=24  Identities=25%  Similarity=0.422  Sum_probs=21.2

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCcce
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      .-+.|+.|...+..|.    |||+-|++
T Consensus       112 ~~~~C~~C~~~rPpRs----~HCsvC~~  135 (299)
T KOG1311|consen  112 EWKYCDTCQLYRPPRS----SHCSVCNN  135 (299)
T ss_pred             ceEEcCcCcccCCCCc----ccchhhcc
Confidence            4688999999999997    79999988


No 211
>KOG2463|consensus
Probab=31.27  E-value=35  Score=30.29  Aligned_cols=22  Identities=23%  Similarity=0.552  Sum_probs=18.8

Q ss_pred             ccccCCCCCCceeEeEEeeeee
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWS   61 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~   61 (122)
                      .+..||.||-..+.+.+|.|=.
T Consensus       256 ~k~FCp~CG~~TL~K~aVsv~~  277 (376)
T KOG2463|consen  256 PKDFCPSCGHKTLTKCAVSVDE  277 (376)
T ss_pred             chhcccccCCCeeeEEEEEecC
Confidence            4778999999999999997754


No 212
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=30.93  E-value=23  Score=35.23  Aligned_cols=17  Identities=24%  Similarity=0.178  Sum_probs=11.6

Q ss_pred             CchHHHHHHHHHHHHHH
Q psy836          102 NTTAATSVRSAIRRLRE  118 (122)
Q Consensus       102 ~T~~~~~~~~~i~rl~e  118 (122)
                      .-+....+++|+.+|.+
T Consensus       656 ~i~l~~~~~~A~~~lg~  672 (1095)
T TIGR00354       656 KVDLRELYEEAIANLGE  672 (1095)
T ss_pred             EecHHHHHHHHHHHhCC
Confidence            45666777778777744


No 213
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=30.66  E-value=23  Score=23.59  Aligned_cols=7  Identities=57%  Similarity=1.730  Sum_probs=6.1

Q ss_pred             CCCCCCc
Q psy836           44 CSFCGKD   50 (122)
Q Consensus        44 Cp~Cgk~   50 (122)
                      |||||+.
T Consensus        42 CPfC~~~   48 (55)
T PF14447_consen   42 CPFCGTP   48 (55)
T ss_pred             CCCCCCc
Confidence            9999975


No 214
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=30.41  E-value=24  Score=20.88  Aligned_cols=8  Identities=25%  Similarity=1.186  Sum_probs=4.2

Q ss_pred             ecCcCeEE
Q psy836           87 CKRCKRIV   94 (122)
Q Consensus        87 ~~rC~~~~   94 (122)
                      |.+|+.+|
T Consensus        28 C~~C~~~f   35 (36)
T PF13717_consen   28 CSKCGHVF   35 (36)
T ss_pred             CCCCCCEe
Confidence            55555544


No 215
>PRK02935 hypothetical protein; Provisional
Probab=30.31  E-value=29  Score=26.13  Aligned_cols=29  Identities=24%  Similarity=0.579  Sum_probs=18.9

Q ss_pred             HHhhccccCCCCCCce--eEeEEeeeeeecCccee
Q psy836           36 ITQHAKYTCSFCGKDS--MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~~--mkR~avGIW~C~~C~~~   68 (122)
                      +.+-..-.||.|+|..  +.|.-    -|.+|+.-
T Consensus        65 StkavqV~CP~C~K~TKmLGrvD----~CM~C~~P   95 (110)
T PRK02935         65 STKAVQVICPSCEKPTKMLGRVD----ACMHCNQP   95 (110)
T ss_pred             cccceeeECCCCCchhhhcccee----ecCcCCCc
Confidence            3444455899999984  45543    67777653


No 216
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=30.30  E-value=24  Score=22.89  Aligned_cols=9  Identities=33%  Similarity=1.291  Sum_probs=7.1

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      +.||+||..
T Consensus         1 i~CPyCge~    9 (52)
T PF14255_consen    1 IQCPYCGEP    9 (52)
T ss_pred             CCCCCCCCe
Confidence            468999876


No 217
>PRK07591 threonine synthase; Validated
Probab=30.25  E-value=18  Score=31.08  Aligned_cols=25  Identities=24%  Similarity=0.513  Sum_probs=17.7

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      .+.|+.||+..---   ..|.|+.|+--
T Consensus        18 ~l~C~~Cg~~~~~~---~~~~C~~cg~~   42 (421)
T PRK07591         18 ALKCRECGAEYPLG---PIHVCEECFGP   42 (421)
T ss_pred             EEEeCCCCCcCCCC---CCccCCCCCCe
Confidence            58899999875321   22999999743


No 218
>KOG4198|consensus
Probab=30.22  E-value=22  Score=30.20  Aligned_cols=52  Identities=25%  Similarity=0.460  Sum_probs=36.9

Q ss_pred             cCCCCCCceeEeE-------EeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchH
Q psy836           43 TCSFCGKDSMKRS-------CVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTA  105 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~-------avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~  105 (122)
                      .||.|.-..+-|.       -.|.|.|+.|+..      -|..+.+     |-+|+..-.=.|+.-++++
T Consensus       117 ~~~~~~g~~~~~n~~~~r~~~~GDW~Cp~C~fh------Nfarn~~-----C~rC~~~r~~~a~~~~~~s  175 (280)
T KOG4198|consen  117 LCPRCPGLGFSRNNKPKRPWRSGDWECPGCNFH------NFARNSE-----CFRCGAKRPLAALLGNQAS  175 (280)
T ss_pred             CCCCCCCCcccccccccCCccccCcccCCCCce------eccccch-----hhhcCCcCccccccccccc
Confidence            4888877776665       7899999988874      3333322     9999988877777655554


No 219
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=30.21  E-value=45  Score=27.31  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=16.3

Q ss_pred             ccccCCCCCCceeEeEEee---eeeecCcc
Q psy836           40 AKYTCSFCGKDSMKRSCVG---IWSCKRCK   66 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avG---IW~C~~C~   66 (122)
                      ..-.||.||.+-. +..+|   .|-|+.|-
T Consensus       253 ~g~pC~~Cg~~I~-~~~~~gR~t~~CP~CQ  281 (282)
T PRK13945        253 TGKPCRKCGTPIE-RIKLAGRSTHWCPNCQ  281 (282)
T ss_pred             CcCCCCcCCCeeE-EEEECCCccEECCCCc
Confidence            3457999997643 34433   67776663


No 220
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=29.70  E-value=36  Score=27.79  Aligned_cols=25  Identities=24%  Similarity=0.591  Sum_probs=15.6

Q ss_pred             ccccCCCCCCceeEeEEee---eeeecCc
Q psy836           40 AKYTCSFCGKDSMKRSCVG---IWSCKRC   65 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avG---IW~C~~C   65 (122)
                      ..-.||.||.. +.+..+|   .|-|+.|
T Consensus       243 ~g~pCprCG~~-I~~~~~~gR~t~~CP~C  270 (272)
T PRK14810        243 TGEPCLNCKTP-IRRVVVAGRSSHYCPHC  270 (272)
T ss_pred             CCCcCCCCCCe-eEEEEECCCccEECcCC
Confidence            34579999954 4555544   5666655


No 221
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=29.40  E-value=27  Score=26.95  Aligned_cols=11  Identities=45%  Similarity=0.996  Sum_probs=5.2

Q ss_pred             cccCCCCCCce
Q psy836           41 KYTCSFCGKDS   51 (122)
Q Consensus        41 ky~Cp~Cgk~~   51 (122)
                      ..+||.|+...
T Consensus        18 ~~~C~~C~~~~   28 (188)
T PF08996_consen   18 KLTCPSCGTEF   28 (188)
T ss_dssp             EEE-TTT--EE
T ss_pred             EeECCCCCCCc
Confidence            45688887663


No 222
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=29.33  E-value=27  Score=23.18  Aligned_cols=13  Identities=31%  Similarity=0.881  Sum_probs=9.5

Q ss_pred             hhccccCCCCCCc
Q psy836           38 QHAKYTCSFCGKD   50 (122)
Q Consensus        38 ~~aky~Cp~Cgk~   50 (122)
                      .+..|.||.||-+
T Consensus        11 ~~v~~~Cp~cGip   23 (55)
T PF13824_consen   11 AHVNFECPDCGIP   23 (55)
T ss_pred             cccCCcCCCCCCc
Confidence            4567888888754


No 223
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=29.21  E-value=19  Score=23.36  Aligned_cols=15  Identities=33%  Similarity=0.972  Sum_probs=10.1

Q ss_pred             HHHhhccccCCCCCC
Q psy836           35 EITQHAKYTCSFCGK   49 (122)
Q Consensus        35 e~~~~aky~Cp~Cgk   49 (122)
                      |+-..-.|.||+||.
T Consensus        38 ~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen   38 EEFEEIQYRCPYCGA   52 (54)
T ss_pred             ccCCceEEEcCCCCC
Confidence            334445788888875


No 224
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=29.20  E-value=28  Score=19.06  Aligned_cols=8  Identities=38%  Similarity=1.427  Sum_probs=4.4

Q ss_pred             cCCCCCCc
Q psy836           43 TCSFCGKD   50 (122)
Q Consensus        43 ~Cp~Cgk~   50 (122)
                      .||.||+.
T Consensus         4 ~C~~CgR~   11 (25)
T PF13913_consen    4 PCPICGRK   11 (25)
T ss_pred             cCCCCCCE
Confidence            46666553


No 225
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=29.08  E-value=15  Score=27.96  Aligned_cols=16  Identities=19%  Similarity=0.517  Sum_probs=12.2

Q ss_pred             cccCCCCCCceeEeEE
Q psy836           41 KYTCSFCGKDSMKRSC   56 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~a   56 (122)
                      .-.||.||+...++.+
T Consensus       105 ~~~cp~c~s~~t~~~s  120 (146)
T TIGR02159       105 SVQCPRCGSADTTITS  120 (146)
T ss_pred             CCcCCCCCCCCcEeec
Confidence            3579999998766654


No 226
>PF09180 ProRS-C_1:  Prolyl-tRNA synthetase, C-terminal;  InterPro: IPR016061 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Prolyl tRNA synthetase (6.1.1.15 from EC) exists in two forms, which are loosely related. The first form is present in the majority of eubacteria species. The second one, present in some eubacteria, is essentially present in archaea and eukaryota. Prolyl-tRNA synthetase belongs to class IIa.  This domain is found at the C-terminal in archaeal and eukaryotic enzymes, as well as in certain bacterial ones.; GO: 0000166 nucleotide binding, 0004827 proline-tRNA ligase activity, 0005524 ATP binding, 0006433 prolyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1NJ6_A 1NJ2_A 1NJ5_A 1NJ1_A 1H4T_C 1H4S_A 1HC7_C 1H4Q_B 3IAL_B.
Probab=28.93  E-value=37  Score=22.40  Aligned_cols=21  Identities=24%  Similarity=0.404  Sum_probs=11.4

Q ss_pred             hhccccCCCCCCceeEeEEee
Q psy836           38 QHAKYTCSFCGKDSMKRSCVG   58 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~mkR~avG   58 (122)
                      ....-+|++||+++..+.-.|
T Consensus        45 ~~~~~~Ci~cgk~a~~~~~fa   65 (68)
T PF09180_consen   45 EPEGGKCIVCGKPAKKWVLFA   65 (68)
T ss_dssp             EBTT-B-TTT-SB-SCEEEEE
T ss_pred             CCCCCeeecCCChhhEEEEEE
Confidence            345667999999987665443


No 227
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=28.60  E-value=31  Score=21.65  Aligned_cols=10  Identities=40%  Similarity=1.188  Sum_probs=2.8

Q ss_pred             ccccCCCCCC
Q psy836           40 AKYTCSFCGK   49 (122)
Q Consensus        40 aky~Cp~Cgk   49 (122)
                      ..+.||.|++
T Consensus        40 ~~W~CPiC~~   49 (50)
T PF02891_consen   40 PKWKCPICNK   49 (50)
T ss_dssp             ---B-TTT--
T ss_pred             CCeECcCCcC
Confidence            3466777765


No 228
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=28.60  E-value=22  Score=30.62  Aligned_cols=23  Identities=22%  Similarity=0.252  Sum_probs=16.9

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcc
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCK   66 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~   66 (122)
                      .+.|+.||+..-  .. ..|.|+.|+
T Consensus         2 ~l~C~~Cg~~~~--~~-~~~~C~~c~   24 (398)
T TIGR03844         2 TLRCPGCGEVLP--DH-YTLSCPLDC   24 (398)
T ss_pred             EEEeCCCCCccC--Cc-cccCCCCCC
Confidence            468999998853  23 269998886


No 229
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=28.36  E-value=43  Score=17.13  Aligned_cols=9  Identities=22%  Similarity=0.907  Sum_probs=4.9

Q ss_pred             eeecCccee
Q psy836           60 WSCKRCKRI   68 (122)
Q Consensus        60 W~C~~C~~~   68 (122)
                      |.|.-|+++
T Consensus         1 ~~C~~C~~~    9 (25)
T PF12874_consen    1 FYCDICNKS    9 (25)
T ss_dssp             EEETTTTEE
T ss_pred             CCCCCCCCC
Confidence            555555554


No 230
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=28.29  E-value=75  Score=24.08  Aligned_cols=39  Identities=15%  Similarity=0.485  Sum_probs=21.8

Q ss_pred             HhHHHHHHHhhcccc-CCCCCCc--eeEeE-EeeeeeecCcce
Q psy836           29 KMVKKMEITQHAKYT-CSFCGKD--SMKRS-CVGIWSCKRCKR   67 (122)
Q Consensus        29 K~v~kie~~~~aky~-Cp~Cgk~--~mkR~-avGIW~C~~C~~   67 (122)
                      +.+..+...=-..|. ||.||.+  .+.+. .+=.=+|..||.
T Consensus        89 ~~i~~~L~~yI~~yVlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988         89 RVINEKIDRYVKEYVICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             HHHHHHHHHHHHhcEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            445555544455554 9999998  34432 222345655554


No 231
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=28.09  E-value=45  Score=30.05  Aligned_cols=26  Identities=31%  Similarity=0.756  Sum_probs=19.8

Q ss_pred             ecCcCeEE-eccccccCchHHHHHHHH
Q psy836           87 CKRCKRIV-AGGAWVYNTTAATSVRSA  112 (122)
Q Consensus        87 ~~rC~~~~-AGGAy~~~T~~~~~~~~~  112 (122)
                      |.|||.+. .||-|.++.+++-++..-
T Consensus        41 CPRC~~~l~~~~~~sl~r~~a~A~s~L   67 (418)
T COG2995          41 CPRCGHTLTRGGDWSLQRPAAYALAAL   67 (418)
T ss_pred             CCCCCCccccCCCCCccchHHHHHHHH
Confidence            88888775 578888888888766543


No 232
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=28.02  E-value=54  Score=19.28  Aligned_cols=8  Identities=38%  Similarity=0.899  Sum_probs=5.1

Q ss_pred             cCCCCCCc
Q psy836           43 TCSFCGKD   50 (122)
Q Consensus        43 ~Cp~Cgk~   50 (122)
                      +||.|+..
T Consensus         4 ~CP~C~~~   11 (37)
T PF13719_consen    4 TCPNCQTR   11 (37)
T ss_pred             ECCCCCce
Confidence            47777654


No 233
>PRK05978 hypothetical protein; Provisional
Probab=27.94  E-value=27  Score=27.01  Aligned_cols=19  Identities=21%  Similarity=0.503  Sum_probs=13.8

Q ss_pred             HHhhccccCCCCCCceeEe
Q psy836           36 ITQHAKYTCSFCGKDSMKR   54 (122)
Q Consensus        36 ~~~~aky~Cp~Cgk~~mkR   54 (122)
                      +..-..-.||.||+-.|=+
T Consensus        28 ~~rGl~grCP~CG~G~LF~   46 (148)
T PRK05978         28 MWRGFRGRCPACGEGKLFR   46 (148)
T ss_pred             HHHHHcCcCCCCCCCcccc
Confidence            3444567799999998754


No 234
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=27.89  E-value=45  Score=20.31  Aligned_cols=25  Identities=36%  Similarity=0.836  Sum_probs=16.1

Q ss_pred             hccccCCCCCCceeEeEEeeeeeecCcc
Q psy836           39 HAKYTCSFCGKDSMKRSCVGIWSCKRCK   66 (122)
Q Consensus        39 ~aky~Cp~Cgk~~mkR~avGIW~C~~C~   66 (122)
                      |..+.|..|+...+...   .|+|..|-
T Consensus         2 h~~~~C~~C~~~~i~g~---Ry~C~~C~   26 (46)
T PF00569_consen    2 HHGYTCDGCGTDPIIGV---RYHCLVCP   26 (46)
T ss_dssp             CSSCE-SSS-SSSEESS---EEEESSSS
T ss_pred             CCCeECcCCCCCcCcCC---eEECCCCC
Confidence            67889999998544332   39988774


No 235
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=27.50  E-value=37  Score=18.24  Aligned_cols=8  Identities=25%  Similarity=1.107  Sum_probs=3.9

Q ss_pred             ecCcCeEE
Q psy836           87 CKRCKRIV   94 (122)
Q Consensus        87 ~~rC~~~~   94 (122)
                      |..|+..+
T Consensus        30 C~~C~~~L   37 (39)
T smart00132       30 CSKCGKPL   37 (39)
T ss_pred             CcccCCcC
Confidence            55555443


No 236
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=27.37  E-value=42  Score=19.60  Aligned_cols=25  Identities=16%  Similarity=0.453  Sum_probs=12.1

Q ss_pred             eeeeeccce--eeeeeecCcCeEEecc
Q psy836           73 AWDSMKRSC--VGIWSCKRCKRIVAGG   97 (122)
Q Consensus        73 Ay~~~t~~A--vtV~s~~rC~~~~AGG   97 (122)
                      .|.+++...  ...-.|.-|++.+.++
T Consensus         3 vW~~F~~~~~~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen    3 VWKHFTKIPGDKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CCCCCEE--GCSS-EEETTTTEE----
T ss_pred             ccccEEEccCCcCeEEeCCCCeEEeeC
Confidence            355555555  5556688888888887


No 237
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=27.35  E-value=42  Score=24.05  Aligned_cols=26  Identities=31%  Similarity=0.636  Sum_probs=13.3

Q ss_pred             ccccCCCCCCce-eEeEEeeeeeecCccee
Q psy836           40 AKYTCSFCGKDS-MKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        40 aky~Cp~Cgk~~-mkR~avGIW~C~~C~~~   68 (122)
                      ....|+.||... +....   ..||.|+..
T Consensus        69 ~~~~C~~Cg~~~~~~~~~---~~CP~Cgs~   95 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEFD---FSCPRCGSP   95 (113)
T ss_dssp             -EEEETTTS-EEECHHCC---HH-SSSSSS
T ss_pred             CcEECCCCCCEEecCCCC---CCCcCCcCC
Confidence            455677777763 22222   557777763


No 238
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=27.35  E-value=25  Score=32.68  Aligned_cols=38  Identities=24%  Similarity=0.449  Sum_probs=24.1

Q ss_pred             hhhhHhHHHHHHHhhccc--------cCCCCCCceeEeEEeeeeeecCcce
Q psy836           25 ASLRKMVKKMEITQHAKY--------TCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        25 ~slRK~v~kie~~~~aky--------~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ..+++.|+.+.. ..-.|        .|+.||... .+.   .|.||.||.
T Consensus       543 eal~~lv~~~~~-~~i~Yf~in~~~~iC~~CG~~~-~g~---~~~CP~CGs  588 (623)
T PRK08271        543 EGYRKLLNIAAK-TGCNYFAFNVKITICNDCHHID-KRT---GKRCPICGS  588 (623)
T ss_pred             HHHHHHHHHHHH-cCCceEEeCCCCccCCCCCCcC-CCC---CcCCcCCCC
Confidence            467777777754 33333        489999751 111   488888875


No 239
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=26.99  E-value=35  Score=29.70  Aligned_cols=25  Identities=32%  Similarity=0.598  Sum_probs=13.3

Q ss_pred             CCCCCCce-eEeEEeee-eeecCccee
Q psy836           44 CSFCGKDS-MKRSCVGI-WSCKRCKRI   68 (122)
Q Consensus        44 Cp~Cgk~~-mkR~avGI-W~C~~C~~~   68 (122)
                      ||.||..- ..+.+.|- -+|++||.+
T Consensus        16 C~~Cd~l~~~~~l~~g~~a~CpRCg~~   42 (403)
T TIGR00155        16 CSQCDMLVALPRIESGQKAACPRCGTT   42 (403)
T ss_pred             CCCCCCcccccCCCCCCeeECCCCCCC
Confidence            89998763 44434443 454444433


No 240
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=26.89  E-value=27  Score=32.22  Aligned_cols=39  Identities=21%  Similarity=0.439  Sum_probs=22.1

Q ss_pred             hhhhHhHHHHHHH-------hhccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           25 ASLRKMVKKMEIT-------QHAKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        25 ~slRK~v~kie~~-------~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|.+-|+.+...       -+.--.|+.||....-     .|.||.||..
T Consensus       536 ~Al~~lvk~~~~~~i~Y~sin~~~~~C~~CGy~g~~-----~~~CP~CG~~  581 (618)
T PRK14704        536 KALKQIVQAMAEHGVGYGSINHPVDRCKCCSYHGVI-----GNECPSCGNE  581 (618)
T ss_pred             HHHHHHHHHHHhcCCceEEeCCCCeecCCCCCCCCc-----CccCcCCCCC
Confidence            4556666665431       1122359999963221     1899998863


No 241
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=26.86  E-value=35  Score=22.96  Aligned_cols=25  Identities=32%  Similarity=0.890  Sum_probs=18.6

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCcce
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      |.|..||.++.. .-.|.|+|..|.-
T Consensus         1 ~~C~VC~~~~~g-~hygv~sC~aC~~   25 (77)
T cd06956           1 HICAICGDRASG-KHYGVYSCEGCKG   25 (77)
T ss_pred             CCCcccCCcCcc-eEECceeehhHHH
Confidence            569999976543 5788888888763


No 242
>PHA02998 RNA polymerase subunit; Provisional
Probab=26.76  E-value=65  Score=26.40  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=7.7

Q ss_pred             cccCCCCCCcee
Q psy836           41 KYTCSFCGKDSM   52 (122)
Q Consensus        41 ky~Cp~Cgk~~m   52 (122)
                      .-+||.||....
T Consensus       143 ~v~CPkCg~~~A  154 (195)
T PHA02998        143 NTPCPNCKSKNT  154 (195)
T ss_pred             CCCCCCCCCCce
Confidence            346888876643


No 243
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=26.74  E-value=33  Score=22.96  Aligned_cols=9  Identities=33%  Similarity=1.121  Sum_probs=6.9

Q ss_pred             ccCCCCCCc
Q psy836           42 YTCSFCGKD   50 (122)
Q Consensus        42 y~Cp~Cgk~   50 (122)
                      ..||.||..
T Consensus         5 i~CP~CgnK   13 (55)
T PF14205_consen    5 ILCPICGNK   13 (55)
T ss_pred             EECCCCCCc
Confidence            469999954


No 244
>PRK04860 hypothetical protein; Provisional
Probab=26.58  E-value=17  Score=28.03  Aligned_cols=29  Identities=24%  Similarity=0.842  Sum_probs=17.3

Q ss_pred             ccccCCCCCCcee--EeEE-----eeeeeecCcceee
Q psy836           40 AKYTCSFCGKDSM--KRSC-----VGIWSCKRCKRIV   69 (122)
Q Consensus        40 aky~Cp~Cgk~~m--kR~a-----vGIW~C~~C~~~v   69 (122)
                      -.|.|+ |++...  +|-.     ...+.|+.|+..+
T Consensus       118 ~~Y~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~l  153 (160)
T PRK04860        118 FPYRCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGETL  153 (160)
T ss_pred             EEEEcC-CCCeeCHHHHHHHHhcCCccEECCCCCcee
Confidence            468888 876432  3322     3457877777653


No 245
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=26.45  E-value=66  Score=24.76  Aligned_cols=26  Identities=23%  Similarity=0.612  Sum_probs=15.4

Q ss_pred             cCCCCCCce---eEe--------EEeeeeeecCccee
Q psy836           43 TCSFCGKDS---MKR--------SCVGIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp~Cgk~~---mkR--------~avGIW~C~~C~~~   68 (122)
                      .||.||...   |.-        .-.=-..|++||.+
T Consensus         2 ~Cp~C~~~~~~~~~~~~IP~F~evii~sf~C~~CGyk   38 (160)
T smart00709        2 DCPSCGGNGTTRMLLTSIPYFREVIIMSFECEHCGYR   38 (160)
T ss_pred             cCCCCCCCCEEEEEEecCCCcceEEEEEEECCCCCCc
Confidence            499997653   222        22234678888765


No 246
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=26.36  E-value=45  Score=19.93  Aligned_cols=9  Identities=44%  Similarity=1.084  Sum_probs=6.2

Q ss_pred             eeecCccee
Q psy836           60 WSCKRCKRI   68 (122)
Q Consensus        60 W~C~~C~~~   68 (122)
                      |.|+.||++
T Consensus         2 r~C~~Cg~~   10 (36)
T PF05191_consen    2 RICPKCGRI   10 (36)
T ss_dssp             EEETTTTEE
T ss_pred             cCcCCCCCc
Confidence            567777765


No 247
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=26.00  E-value=22  Score=30.91  Aligned_cols=27  Identities=33%  Similarity=0.938  Sum_probs=17.4

Q ss_pred             ccccCCCCCCce--eEeEEe--eeeeecCcc
Q psy836           40 AKYTCSFCGKDS--MKRSCV--GIWSCKRCK   66 (122)
Q Consensus        40 aky~Cp~Cgk~~--mkR~av--GIW~C~~C~   66 (122)
                      ....|+|||+..  +.+.-.  +.+-|..|-
T Consensus         8 ~~~~CSFCGr~~~ev~~li~g~~~~IC~~Ci   38 (412)
T PRK05342          8 KLLYCSFCGKSQHEVRKLIAGPGVYICDECI   38 (412)
T ss_pred             CccccCCCCCChhhccccccCCCCcccchHH
Confidence            345799999974  444322  457777773


No 248
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=25.96  E-value=49  Score=22.27  Aligned_cols=13  Identities=15%  Similarity=0.511  Sum_probs=6.8

Q ss_pred             eeeeeecCcCeEE
Q psy836           82 VGIWSCKRCKRIV   94 (122)
Q Consensus        82 vtV~s~~rC~~~~   94 (122)
                      .++-.|..|+.+.
T Consensus        28 ~t~V~C~~Cg~~L   40 (59)
T PRK00415         28 STVVRCLVCGKTL   40 (59)
T ss_pred             CcEEECcccCCCc
Confidence            3344466666554


No 249
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=25.92  E-value=47  Score=23.95  Aligned_cols=14  Identities=14%  Similarity=0.218  Sum_probs=7.5

Q ss_pred             EEeeeeeecCccee
Q psy836           55 SCVGIWSCKRCKRI   68 (122)
Q Consensus        55 ~avGIW~C~~C~~~   68 (122)
                      .--+...|+.|+..
T Consensus        66 ~vp~~~~C~~Cg~~   79 (113)
T PRK12380         66 YKPAQAWCWDCSQV   79 (113)
T ss_pred             eeCcEEEcccCCCE
Confidence            33445566666644


No 250
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=25.70  E-value=56  Score=19.74  Aligned_cols=22  Identities=27%  Similarity=0.690  Sum_probs=11.2

Q ss_pred             hHhHHHHHHHhhccccCCCCCCc
Q psy836           28 RKMVKKMEITQHAKYTCSFCGKD   50 (122)
Q Consensus        28 RK~v~kie~~~~aky~Cp~Cgk~   50 (122)
                      ||.+-+...+.| +..||.|.+.
T Consensus         1 Rr~~lelll~~H-~~dC~~C~~~   22 (41)
T PF10588_consen    1 RRTVLELLLANH-PLDCPTCDKN   22 (41)
T ss_dssp             -HHHHHHHHTT-----TTT-TTG
T ss_pred             CHHHHHHHHhCC-CCcCcCCCCC
Confidence            556666666666 6779999864


No 251
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=25.39  E-value=46  Score=21.08  Aligned_cols=26  Identities=35%  Similarity=0.925  Sum_probs=11.4

Q ss_pred             ccccCCCCCCce--eEeEEeeeeeecCcceee
Q psy836           40 AKYTCSFCGKDS--MKRSCVGIWSCKRCKRIV   69 (122)
Q Consensus        40 aky~Cp~Cgk~~--mkR~avGIW~C~~C~~~v   69 (122)
                      ..-.|+.|++.-  ++|.    .+|..||..|
T Consensus         8 ~~~~C~~C~~~F~~~~rr----hhCr~CG~~v   35 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRR----HHCRNCGRVV   35 (69)
T ss_dssp             G-SB-TTT--B-BSSS-E----EE-TTT--EE
T ss_pred             CCCcCcCcCCcCCCceee----EccCCCCCEE
Confidence            345688888873  3333    5888888875


No 252
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=25.34  E-value=50  Score=18.81  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=8.3

Q ss_pred             ccCCCCCCce
Q psy836           42 YTCSFCGKDS   51 (122)
Q Consensus        42 y~Cp~Cgk~~   51 (122)
                      +.|++||...
T Consensus        12 ~~C~~c~~~~   21 (57)
T cd00085          12 GLCPYCGKPG   21 (57)
T ss_pred             CcCccCCCcC
Confidence            8899998864


No 253
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=25.13  E-value=38  Score=21.44  Aligned_cols=13  Identities=23%  Similarity=0.828  Sum_probs=7.3

Q ss_pred             hccccCCCCCCce
Q psy836           39 HAKYTCSFCGKDS   51 (122)
Q Consensus        39 ~aky~Cp~Cgk~~   51 (122)
                      -..+.||.|+..+
T Consensus        32 p~~w~CP~C~a~K   44 (47)
T PF00301_consen   32 PDDWVCPVCGAPK   44 (47)
T ss_dssp             -TT-B-TTTSSBG
T ss_pred             CCCCcCcCCCCcc
Confidence            4678899998653


No 254
>PRK06260 threonine synthase; Validated
Probab=25.05  E-value=27  Score=29.56  Aligned_cols=25  Identities=28%  Similarity=0.555  Sum_probs=16.4

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      .+.|+.||+..--  ..-.|.|+.|+-
T Consensus         3 ~~~C~~cg~~~~~--~~~~~~Cp~cg~   27 (397)
T PRK06260          3 WLKCIECGKEYDP--DEIIYTCPECGG   27 (397)
T ss_pred             EEEECCCCCCCCC--CCccccCCCCCC
Confidence            4789999877421  112588988874


No 255
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=24.99  E-value=32  Score=21.09  Aligned_cols=10  Identities=30%  Similarity=0.770  Sum_probs=4.8

Q ss_pred             cccCCCCCCc
Q psy836           41 KYTCSFCGKD   50 (122)
Q Consensus        41 ky~Cp~Cgk~   50 (122)
                      +|.||.||--
T Consensus         1 ~hlcpkcgvg   10 (36)
T PF09151_consen    1 QHLCPKCGVG   10 (36)
T ss_dssp             --B-TTTSSS
T ss_pred             CccCCccCce
Confidence            3678888754


No 256
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=24.92  E-value=53  Score=25.76  Aligned_cols=57  Identities=25%  Similarity=0.573  Sum_probs=35.7

Q ss_pred             hHhHHHHHHHhhccccCCCCCCce-eEeEEe-eeeeecCcceeeecceeeeeccceeeeeeecCcCe
Q psy836           28 RKMVKKMEITQHAKYTCSFCGKDS-MKRSCV-GIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKR   92 (122)
Q Consensus        28 RK~v~kie~~~~aky~Cp~Cgk~~-mkR~av-GIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~   92 (122)
                      .+.|..-+.=+-.-|.|.+|..+. +-=... ..-.|+.|+...--.=|.       . .+|.+|.+
T Consensus       139 ~~HV~~C~lC~~kGfiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~~C~~-------~-~~CpkC~R  197 (202)
T PF13901_consen  139 EKHVYSCELCQQKGFICEICNSDDIIFPFQIDTTVRCPKCKSVFHKSCFR-------K-KSCPKCAR  197 (202)
T ss_pred             HHHHHHhHHHHhCCCCCccCCCCCCCCCCCCCCeeeCCcCccccchhhcC-------C-CCCCCcHh
Confidence            455566666677789999998653 222233 667899998864333333       2 45888754


No 257
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=24.81  E-value=36  Score=21.74  Aligned_cols=14  Identities=21%  Similarity=0.750  Sum_probs=10.6

Q ss_pred             hhccccCCCCCCce
Q psy836           38 QHAKYTCSFCGKDS   51 (122)
Q Consensus        38 ~~aky~Cp~Cgk~~   51 (122)
                      .-..+.||.||..+
T Consensus        31 Lp~~w~CP~C~a~K   44 (50)
T cd00730          31 LPDDWVCPVCGAGK   44 (50)
T ss_pred             CCCCCCCCCCCCcH
Confidence            45678999998764


No 258
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.80  E-value=49  Score=26.96  Aligned_cols=25  Identities=28%  Similarity=0.650  Sum_probs=15.7

Q ss_pred             ccccCCCCCCceeEeEEee---eeeecCc
Q psy836           40 AKYTCSFCGKDSMKRSCVG---IWSCKRC   65 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avG---IW~C~~C   65 (122)
                      +.-.||.||..- ++..+|   .|-|+.|
T Consensus       244 ~g~pC~~Cg~~I-~~~~~~gR~t~~CP~C  271 (272)
T TIGR00577       244 KGEPCRRCGTPI-EKIKVGGRGTHFCPQC  271 (272)
T ss_pred             CCCCCCCCCCee-EEEEECCCCCEECCCC
Confidence            345799999763 444444   5666666


No 259
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=24.50  E-value=50  Score=23.83  Aligned_cols=25  Identities=16%  Similarity=0.181  Sum_probs=12.7

Q ss_pred             CCceeEeEEeeeeeecCcceeeecc
Q psy836           48 GKDSMKRSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        48 gk~~mkR~avGIW~C~~C~~~vAgg   72 (122)
                      |....--..-+...|+.|+..+.-.
T Consensus        59 ga~L~I~~~p~~~~C~~Cg~~~~~~   83 (115)
T TIGR00100        59 GAKLNIEDEPVECECEDCSEEVSPE   83 (115)
T ss_pred             CCEEEEEeeCcEEEcccCCCEEecC
Confidence            4443333344556677777554443


No 260
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=24.11  E-value=42  Score=22.15  Aligned_cols=11  Identities=27%  Similarity=0.751  Sum_probs=7.2

Q ss_pred             ccCCCCCCcee
Q psy836           42 YTCSFCGKDSM   52 (122)
Q Consensus        42 y~Cp~Cgk~~m   52 (122)
                      .+|+.||...+
T Consensus         6 r~C~~CgvYTL   16 (56)
T PRK13130          6 RKCPKCGVYTL   16 (56)
T ss_pred             eECCCCCCEEc
Confidence            35777776666


No 261
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=23.73  E-value=38  Score=21.85  Aligned_cols=16  Identities=19%  Similarity=0.405  Sum_probs=11.9

Q ss_pred             HHHhhccccCCCCCCc
Q psy836           35 EITQHAKYTCSFCGKD   50 (122)
Q Consensus        35 e~~~~aky~Cp~Cgk~   50 (122)
                      ..-+...|.||.||+.
T Consensus        46 ~~~kd~~H~Cp~C~~~   61 (67)
T smart00714       46 DSFKDVNHYCPNCGAF   61 (67)
T ss_pred             ccccCccEECCCCCCE
Confidence            3446678899999875


No 262
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=23.65  E-value=46  Score=22.57  Aligned_cols=21  Identities=29%  Similarity=0.749  Sum_probs=12.9

Q ss_pred             ccCCCCCCceeEeEEeeeeeecCccee
Q psy836           42 YTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        42 y~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      +.||.||...++ .     .|+.||..
T Consensus         6 rkC~~cg~YTLk-e-----~Cp~CG~~   26 (59)
T COG2260           6 RKCPKCGRYTLK-E-----KCPVCGGD   26 (59)
T ss_pred             hcCcCCCceeec-c-----cCCCCCCc
Confidence            357777777766 2     46666553


No 263
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=23.44  E-value=1e+02  Score=24.34  Aligned_cols=41  Identities=20%  Similarity=0.387  Sum_probs=24.8

Q ss_pred             hHhHHHHHHHhhcccc-CCCCCCc--eeEeE-EeeeeeecCccee
Q psy836           28 RKMVKKMEITQHAKYT-CSFCGKD--SMKRS-CVGIWSCKRCKRI   68 (122)
Q Consensus        28 RK~v~kie~~~~aky~-Cp~Cgk~--~mkR~-avGIW~C~~C~~~   68 (122)
                      .+.+..+...=-.+|. ||.|+.+  .+.+. .+=.=+|.-||..
T Consensus        84 ~~~i~~~l~~yi~~yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa~  128 (201)
T PRK12336         84 EEDIQAAIDAYVDEYVICSECGLPDTRLVKEDRVLMLRCDACGAH  128 (201)
T ss_pred             HHHHHHHHHHHHHheEECCCCCCCCcEEEEcCCeEEEEcccCCCC
Confidence            4555555555555664 9999998  34433 2223468888765


No 264
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=23.36  E-value=81  Score=20.82  Aligned_cols=15  Identities=20%  Similarity=0.530  Sum_probs=7.4

Q ss_pred             eeeeeeecCcCeEEe
Q psy836           81 CVGIWSCKRCKRIVA   95 (122)
Q Consensus        81 AvtV~s~~rC~~~~A   95 (122)
                      |.++-.|..|+.+.+
T Consensus        23 a~t~V~C~~Cg~~L~   37 (55)
T PF01667_consen   23 AQTVVKCVVCGTVLA   37 (55)
T ss_dssp             -SS-EE-SSSTSEEE
T ss_pred             CCeEEEcccCCCEec
Confidence            444445777777663


No 265
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=23.32  E-value=1.3e+02  Score=20.56  Aligned_cols=14  Identities=21%  Similarity=0.363  Sum_probs=9.0

Q ss_pred             eeeeeecCcCeEEe
Q psy836           82 VGIWSCKRCKRIVA   95 (122)
Q Consensus        82 vtV~s~~rC~~~~A   95 (122)
                      +-+..|..||+.-.
T Consensus        28 ve~vECV~CGy~e~   41 (71)
T PF09526_consen   28 VEYVECVECGYTER   41 (71)
T ss_pred             ceEEEecCCCCeec
Confidence            45556888877643


No 266
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=23.21  E-value=44  Score=23.61  Aligned_cols=27  Identities=30%  Similarity=0.737  Sum_probs=20.4

Q ss_pred             ccccCCCCCCceeEeEEeeeeeecCcce
Q psy836           40 AKYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        40 aky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      ....|..||.++.. .-.|.|+|..|.-
T Consensus         4 ~~~~C~VCg~~~~g-~hyGv~sC~aC~~   30 (95)
T cd06968           4 EVIPCKICGDKSSG-IHYGVITCEGCKG   30 (95)
T ss_pred             cccCCcccCCcCcc-eEECceeehhhHH
Confidence            44579999987644 4589999988874


No 267
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs. This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.
Probab=23.19  E-value=1.2e+02  Score=23.02  Aligned_cols=53  Identities=26%  Similarity=0.634  Sum_probs=31.5

Q ss_pred             hhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcc---eeeecceeeeeccceeeeeeecCcCe
Q psy836           27 LRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK---RIVAGGAWDSMKRSCVGIWSCKRCKR   92 (122)
Q Consensus        27 lRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~---~~vAggAy~~~t~~AvtV~s~~rC~~   92 (122)
                      |++.++.+. .+.....|.-||-..+       =.|..|+   |.+..++.     ....+..|..||+
T Consensus        86 L~~lL~~~~-~~~~~~~C~~Cgg~rf-------v~C~~C~Gs~k~~~~~~~-----~~~~~~rC~~Cne  141 (147)
T cd03031          86 LRKLLKGIR-ARAGGGVCEGCGGARF-------VPCSECNGSCKVFAENAT-----AAGGFLRCPECNE  141 (147)
T ss_pred             HHHHHhhcc-cccCCCCCCCCCCcCe-------EECCCCCCcceEEeccCc-----ccccEEECCCCCc
Confidence            566666663 3445678999985432       3566554   44443322     3455677888886


No 268
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.18  E-value=46  Score=24.34  Aligned_cols=11  Identities=27%  Similarity=0.899  Sum_probs=7.2

Q ss_pred             ccCCCCCCcee
Q psy836           42 YTCSFCGKDSM   52 (122)
Q Consensus        42 y~Cp~Cgk~~m   52 (122)
                      +.||.||...+
T Consensus        93 ~~CP~Cgs~~~  103 (124)
T PRK00762         93 IECPVCGNKRA  103 (124)
T ss_pred             CcCcCCCCCCC
Confidence            46887776544


No 269
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=22.78  E-value=15  Score=32.69  Aligned_cols=30  Identities=27%  Similarity=0.651  Sum_probs=19.4

Q ss_pred             cCCCCCCc-eeEeEEeeeeeecCcceeeecc
Q psy836           43 TCSFCGKD-SMKRSCVGIWSCKRCKRIVAGG   72 (122)
Q Consensus        43 ~Cp~Cgk~-~mkR~avGIW~C~~C~~~vAgg   72 (122)
                      .|..|... ++.=.-.+-|.|++||.+|--|
T Consensus       248 AC~rC~t~y~le~A~~~~wrCpkCGg~ikKG  278 (403)
T COG1379         248 ACSRCYTRYSLEEAKSLRWRCPKCGGKIKKG  278 (403)
T ss_pred             HHHHhhhccCcchhhhhcccCcccccchhhh
Confidence            48888744 3443344579998888765433


No 270
>PHA02540 61 DNA primase; Provisional
Probab=22.70  E-value=71  Score=27.58  Aligned_cols=34  Identities=21%  Similarity=0.585  Sum_probs=20.4

Q ss_pred             cccCCCCCCce----eEeEE------eeeeeecCcceeeecceeee
Q psy836           41 KYTCSFCGKDS----MKRSC------VGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        41 ky~Cp~Cgk~~----mkR~a------vGIW~C~~C~~~vAggAy~~   76 (122)
                      +..|||||-..    --|-.      .++|+|=.||.-  |++-.|
T Consensus        27 ~~~CPf~~ds~~~~~kpsF~V~p~k~~~~yhCFgCGa~--Gd~i~F   70 (337)
T PHA02540         27 NFRCPICGDSQKDKNKARGWIYEKKDGGVFKCHNCGYH--RPFGNF   70 (337)
T ss_pred             EecCCCCCCccccCcCCcEEEeccCCceEEEecCCCCC--CCHHHH
Confidence            56799998632    11222      349998888763  444443


No 271
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=22.53  E-value=44  Score=17.84  Aligned_cols=8  Identities=38%  Similarity=1.153  Sum_probs=4.2

Q ss_pred             ccCCCCCC
Q psy836           42 YTCSFCGK   49 (122)
Q Consensus        42 y~Cp~Cgk   49 (122)
                      |.|+.|++
T Consensus         2 ~~C~~C~k    9 (27)
T PF12171_consen    2 FYCDACDK    9 (27)
T ss_dssp             CBBTTTTB
T ss_pred             CCcccCCC
Confidence            45555554


No 272
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=22.46  E-value=64  Score=18.81  Aligned_cols=14  Identities=36%  Similarity=0.990  Sum_probs=10.2

Q ss_pred             eeeecCcceeeecc
Q psy836           59 IWSCKRCKRIVAGG   72 (122)
Q Consensus        59 IW~C~~C~~~vAgg   72 (122)
                      +|.|.-||.+.-|.
T Consensus         2 ~~~C~~CG~i~~g~   15 (34)
T cd00729           2 VWVCPVCGYIHEGE   15 (34)
T ss_pred             eEECCCCCCEeECC
Confidence            58888888776654


No 273
>PLN00209 ribosomal protein S27; Provisional
Probab=22.40  E-value=91  Score=22.51  Aligned_cols=14  Identities=14%  Similarity=0.593  Sum_probs=8.2

Q ss_pred             eeeeeeecCcCeEE
Q psy836           81 CVGIWSCKRCKRIV   94 (122)
Q Consensus        81 AvtV~s~~rC~~~~   94 (122)
                      |.++-.|..|+.+.
T Consensus        52 A~t~V~C~~Cg~~L   65 (86)
T PLN00209         52 SQTVVVCGSCQTVL   65 (86)
T ss_pred             CceEEEccccCCEe
Confidence            44444567776665


No 274
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=22.39  E-value=45  Score=21.48  Aligned_cols=24  Identities=33%  Similarity=0.832  Sum_probs=18.1

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcce
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      .|..||..+.. ...|.++|..|..
T Consensus         2 ~C~VCg~~~~~-~~ygv~sC~~C~~   25 (70)
T PF00105_consen    2 KCKVCGDPASG-YHYGVLSCNACKM   25 (70)
T ss_dssp             BSTTTSSBESE-EETTEEEEHHHHH
T ss_pred             CCeECCCccCc-cccccccccccee
Confidence            58999986533 4688999888864


No 275
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=22.26  E-value=1.9e+02  Score=17.33  Aligned_cols=26  Identities=15%  Similarity=0.360  Sum_probs=15.8

Q ss_pred             cCC--CCCCceeEeE--EeeeeeecCccee
Q psy836           43 TCS--FCGKDSMKRS--CVGIWSCKRCKRI   68 (122)
Q Consensus        43 ~Cp--~Cgk~~mkR~--avGIW~C~~C~~~   68 (122)
                      .||  .|+.....=.  ....=.|+.|+..
T Consensus        20 ~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~   49 (64)
T smart00647       20 WCPAPDCSAAIIVTEEEGCNRVTCPKCGFS   49 (64)
T ss_pred             CCCCCCCcceEEecCCCCCCeeECCCCCCe
Confidence            499  9977654321  3445567777764


No 276
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=22.13  E-value=30  Score=20.97  Aligned_cols=32  Identities=25%  Similarity=0.487  Sum_probs=17.4

Q ss_pred             cCCCCCCceeEeEEeeeeeecCcceeeecceeee
Q psy836           43 TCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDS   76 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~   76 (122)
                      .|+.|++.-.-  ....-+|..||+.+=+.....
T Consensus         4 ~C~~C~~~F~~--~~rk~~Cr~Cg~~~C~~C~~~   35 (57)
T cd00065           4 SCMGCGKPFTL--TRRRHHCRNCGRIFCSKCSSN   35 (57)
T ss_pred             cCcccCccccC--CccccccCcCcCCcChHHcCC
Confidence            47777764211  223357777777765544433


No 277
>KOG4317|consensus
Probab=22.10  E-value=36  Score=30.19  Aligned_cols=11  Identities=9%  Similarity=0.220  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHh
Q psy836          109 VRSAIRRLREV  119 (122)
Q Consensus       109 ~~~~i~rl~e~  119 (122)
                      +-+.++|+++.
T Consensus        68 m~e~lkr~~q~   78 (383)
T KOG4317|consen   68 MGEELKRKMQK   78 (383)
T ss_pred             HHHHHHHHHhh
Confidence            34556666665


No 278
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=22.06  E-value=37  Score=24.47  Aligned_cols=33  Identities=27%  Similarity=0.398  Sum_probs=24.5

Q ss_pred             HHHHhhccccCCCCCCceeEeEEeeeeeecCcceeee
Q psy836           34 MEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVA   70 (122)
Q Consensus        34 ie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vA   70 (122)
                      -+........|+.|...+.-|.    .||+.|++-|.
T Consensus        41 ~~~~~~~~~~C~~C~~~kp~Rs----~HC~~C~~CV~   73 (174)
T PF01529_consen   41 EDDENGELKYCSTCKIIKPPRS----HHCRVCNRCVL   73 (174)
T ss_pred             ccccCCCCEECcccCCcCCCcc----eeccccccccc
Confidence            3445566778999998888875    69998887543


No 279
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=22.01  E-value=41  Score=21.97  Aligned_cols=14  Identities=21%  Similarity=0.413  Sum_probs=11.1

Q ss_pred             HhhccccCCCCCCc
Q psy836           37 TQHAKYTCSFCGKD   50 (122)
Q Consensus        37 ~~~aky~Cp~Cgk~   50 (122)
                      -+...|.||.|++.
T Consensus        54 ~kd~~H~Cp~C~~~   67 (73)
T PF10601_consen   54 CKDVYHYCPNCGAF   67 (73)
T ss_pred             ccCceEECCCCCCE
Confidence            45678899999875


No 280
>PRK05638 threonine synthase; Validated
Probab=21.99  E-value=37  Score=29.23  Aligned_cols=24  Identities=29%  Similarity=0.564  Sum_probs=16.6

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCccee
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      |+.|+.||+..-  .. -.|.| .|+-.
T Consensus         1 ~l~C~~Cg~~~~--~~-~~~~C-~c~~~   24 (442)
T PRK05638          1 KMKCPKCGREYN--SY-IPPFC-ICGEL   24 (442)
T ss_pred             CeEeCCCCCCCC--CC-Cceec-CCCCc
Confidence            578999998853  12 23899 89743


No 281
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=21.89  E-value=54  Score=19.54  Aligned_cols=16  Identities=31%  Similarity=0.638  Sum_probs=10.4

Q ss_pred             eecCcCeEEecccccc
Q psy836           86 SCKRCKRIVAGGAWVY  101 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~  101 (122)
                      .|..|++.|+.+-|-+
T Consensus         6 ~C~nC~R~v~a~RfA~   21 (33)
T PF08209_consen    6 ECPNCGRPVAASRFAP   21 (33)
T ss_dssp             E-TTTSSEEEGGGHHH
T ss_pred             ECCCCcCCcchhhhHH
Confidence            3777777777776644


No 283
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=21.73  E-value=80  Score=23.47  Aligned_cols=39  Identities=21%  Similarity=0.492  Sum_probs=22.9

Q ss_pred             hHhHHHHHHHhhcccc-CCCCCCce--eEeEEeeee--eecCcce
Q psy836           28 RKMVKKMEITQHAKYT-CSFCGKDS--MKRSCVGIW--SCKRCKR   67 (122)
Q Consensus        28 RK~v~kie~~~~aky~-Cp~Cgk~~--mkR~avGIW--~C~~C~~   67 (122)
                      .+++.++...=-.+|. ||.|+.+-  +.+. -++|  +|..||.
T Consensus        79 ~~~i~~~L~~fI~~yVlC~~C~spdT~l~k~-~r~~~l~C~aCGa  122 (125)
T PF01873_consen   79 SKQIQDLLDKFIKEYVLCPECGSPDTELIKE-GRLIFLKCKACGA  122 (125)
T ss_dssp             CCHHHHHHHHHHCHHSSCTSTSSSSEEEEEE-TTCCEEEETTTSC
T ss_pred             HHHHHHHHHHHHHHEEEcCCCCCCccEEEEc-CCEEEEEecccCC
Confidence            3455555555556654 99999983  4443 3444  4555554


No 284
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=21.69  E-value=38  Score=30.54  Aligned_cols=40  Identities=23%  Similarity=0.379  Sum_probs=24.8

Q ss_pred             hhhhHhHHHHHHH--h-----hccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           25 ASLRKMVKKMEIT--Q-----HAKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        25 ~slRK~v~kie~~--~-----~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|.+.|+.+-..  .     .....|+.||.... +.   .|.||.||+.
T Consensus       495 ~al~~lv~~a~~~~~~y~~~~~p~~~C~~CG~~~~-~~---~~~CP~CGs~  541 (555)
T cd01675         495 EALEALVKKAAKRGVIYFGINTPIDICNDCGYIGE-GE---GFKCPKCGSE  541 (555)
T ss_pred             HHHHHHHHHHHHcCCceEEEecCCccCCCCCCCCc-CC---CCCCcCCCCc
Confidence            4566666666543  1     12348999997432 11   3999999975


No 285
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=21.39  E-value=35  Score=31.00  Aligned_cols=40  Identities=20%  Similarity=0.319  Sum_probs=22.4

Q ss_pred             hhhhHhHHHHHHHh-------hccccCCCCCCceeEeEEeeeeeecCccee
Q psy836           25 ASLRKMVKKMEITQ-------HAKYTCSFCGKDSMKRSCVGIWSCKRCKRI   68 (122)
Q Consensus        25 ~slRK~v~kie~~~-------~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~   68 (122)
                      ..|++-|+.+...-       +.--.|+.||.. -++.   .|.||.||..
T Consensus       501 eal~~lv~~a~~~~i~Y~~~n~~~~~C~~CG~~-g~~~---~~~CP~Cgs~  547 (579)
T TIGR02487       501 EALKDITKKAMKNGIGYFGINPPVDVCEDCGYT-GEGL---NDKCPKCGSH  547 (579)
T ss_pred             HHHHHHHHHHHhcCCceEEeccCCccCCCCCCC-CCCC---CCcCcCCCCc
Confidence            34566666664431       122259999863 1111   2889999864


No 286
>COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis]
Probab=21.32  E-value=37  Score=23.44  Aligned_cols=21  Identities=33%  Similarity=0.745  Sum_probs=14.1

Q ss_pred             ccCCCCCCce--------eEeEEeeeeee
Q psy836           42 YTCSFCGKDS--------MKRSCVGIWSC   62 (122)
Q Consensus        42 y~Cp~Cgk~~--------mkR~avGIW~C   62 (122)
                      ++|.|||+.-        +++.+.=.|-|
T Consensus         4 ~~CsFcG~~I~PGtG~m~Vr~Dg~v~~Fc   32 (66)
T COG2075           4 RVCSFCGKKIEPGTGIMYVRNDGKVLRFC   32 (66)
T ss_pred             eEecCcCCccCCCceEEEEecCCeEEEEe
Confidence            6799998863        45555556665


No 287
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=21.02  E-value=59  Score=20.32  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=8.5

Q ss_pred             hccccCCCCCC
Q psy836           39 HAKYTCSFCGK   49 (122)
Q Consensus        39 ~aky~Cp~Cgk   49 (122)
                      ..-..||.||+
T Consensus        44 ~~i~~Cp~CgR   54 (56)
T PF02591_consen   44 DEIVFCPNCGR   54 (56)
T ss_pred             CCeEECcCCCc
Confidence            56678999886


No 288
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.91  E-value=26  Score=27.76  Aligned_cols=64  Identities=20%  Similarity=0.354  Sum_probs=37.2

Q ss_pred             HhHHHHH-HHhhccccCCCCCCc-eeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEeccccccCchHH
Q psy836           29 KMVKKME-ITQHAKYTCSFCGKD-SMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAA  106 (122)
Q Consensus        29 K~v~kie-~~~~aky~Cp~Cgk~-~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~AGGAy~~~T~~~  106 (122)
                      +-...+| ..+..-|.||.|.-. ++-..-.--..                         |.+||...   -|.=+++.-
T Consensus       100 ~Lk~~le~~~~~~~y~C~~~~~r~sfdeA~~~~F~-------------------------Cp~Cg~~L---~~~d~s~~i  151 (176)
T COG1675         100 KLKRKLEKETENNYYVCPNCHVKYSFDEAMELGFT-------------------------CPKCGEDL---EEYDSSEEI  151 (176)
T ss_pred             HHHHHHHhhccCCceeCCCCCCcccHHHHHHhCCC-------------------------CCCCCchh---hhccchHHH
Confidence            3333444 567788999888644 22222222244                         55665433   234467777


Q ss_pred             HHHHHHHHHHHHhh
Q psy836          107 TSVRSAIRRLREVN  120 (122)
Q Consensus       107 ~~~~~~i~rl~e~~  120 (122)
                      .-..+.|++|.+.-
T Consensus       152 ~~l~~~i~~l~~~l  165 (176)
T COG1675         152 EELESELDELEEEL  165 (176)
T ss_pred             HHHHHHHHHHHHHH
Confidence            77888888888763


No 289
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=20.65  E-value=44  Score=22.16  Aligned_cols=25  Identities=20%  Similarity=0.259  Sum_probs=10.4

Q ss_pred             cccCCCCCCceeEeEEeeeeeecCcce
Q psy836           41 KYTCSFCGKDSMKRSCVGIWSCKRCKR   67 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGIW~C~~C~~   67 (122)
                      +..||.||+...-...-  =.-++|.+
T Consensus         2 ~v~CP~C~k~~~~~~~n--~~rPFCS~   26 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPEN--PFRPFCSE   26 (57)
T ss_dssp             EEE-TTT--EEE-SSSS--S--SSSSH
T ss_pred             cccCCCCCCeecccCCC--CcCCcccH
Confidence            35799998876542221  13456654


No 290
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=20.59  E-value=1.1e+02  Score=20.02  Aligned_cols=20  Identities=20%  Similarity=0.297  Sum_probs=14.9

Q ss_pred             eEEeeeeeecCcceeeecce
Q psy836           54 RSCVGIWSCKRCKRIVAGGA   73 (122)
Q Consensus        54 R~avGIW~C~~C~~~vAggA   73 (122)
                      +..+|+|.|.+....+.-..
T Consensus         6 ~~~~g~w~~~pg~~~~~~~~   25 (74)
T PF05899_consen    6 VFSAGVWECTPGKFPWPYPE   25 (74)
T ss_dssp             SEEEEEEEEECEEEEEEESS
T ss_pred             CEEEEEEEECCceeEeeCCC
Confidence            46899999999877655443


No 291
>PRK11032 hypothetical protein; Provisional
Probab=20.28  E-value=54  Score=25.65  Aligned_cols=14  Identities=36%  Similarity=0.842  Sum_probs=11.4

Q ss_pred             cCCCCCCceeEeEE
Q psy836           43 TCSFCGKDSMKRSC   56 (122)
Q Consensus        43 ~Cp~Cgk~~mkR~a   56 (122)
                      .||.||.+.+.|.+
T Consensus       144 pCp~C~~~~F~R~~  157 (160)
T PRK11032        144 LCPKCGHDQFQRRP  157 (160)
T ss_pred             CCCCCCCCeeeeCC
Confidence            58999988888864


No 292
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=20.27  E-value=65  Score=19.60  Aligned_cols=12  Identities=33%  Similarity=0.994  Sum_probs=6.1

Q ss_pred             eeeeecCcceee
Q psy836           58 GIWSCKRCKRIV   69 (122)
Q Consensus        58 GIW~C~~C~~~v   69 (122)
                      .++.|..||..|
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            367777777764


No 293
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=20.10  E-value=1.1e+02  Score=22.05  Aligned_cols=14  Identities=14%  Similarity=0.406  Sum_probs=8.5

Q ss_pred             eeeeeeecCcCeEE
Q psy836           81 CVGIWSCKRCKRIV   94 (122)
Q Consensus        81 AvtV~s~~rC~~~~   94 (122)
                      |.++-.|..|+.+.
T Consensus        51 A~t~V~C~~Cg~~L   64 (85)
T PTZ00083         51 AQTVVLCGGCSSQL   64 (85)
T ss_pred             CceEEEccccCCEe
Confidence            44455577777665


No 294
>PRK14724 DNA topoisomerase III; Provisional
Probab=20.08  E-value=78  Score=30.87  Aligned_cols=21  Identities=24%  Similarity=0.678  Sum_probs=14.9

Q ss_pred             cccCCCCCCceeEeEEeee-eeecC
Q psy836           41 KYTCSFCGKDSMKRSCVGI-WSCKR   64 (122)
Q Consensus        41 ky~Cp~Cgk~~mkR~avGI-W~C~~   64 (122)
                      --.||.||...+.   .|. |.|..
T Consensus       755 ~g~CPkCg~~v~e---~gk~y~Cs~  776 (987)
T PRK14724        755 LGPCPKCGAPVFE---HGSNYVCEK  776 (987)
T ss_pred             ccCCCCCCCceEe---ecceEEcCC
Confidence            4579999887554   455 88875


No 295
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=20.01  E-value=73  Score=25.54  Aligned_cols=13  Identities=31%  Similarity=0.698  Sum_probs=10.3

Q ss_pred             hccccCCCCCCce
Q psy836           39 HAKYTCSFCGKDS   51 (122)
Q Consensus        39 ~aky~Cp~Cgk~~   51 (122)
                      .....||.||...
T Consensus       151 ~~~~~Cp~CG~~~  163 (177)
T COG1439         151 EPKDFCPICGSPL  163 (177)
T ss_pred             CCCCcCCCCCCce
Confidence            4677899999884


Done!