Query         psy8369
Match_columns 82
No_of_seqs    114 out of 1005
Neff          8.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:52:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8369.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8369hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0694|consensus               99.9 6.4E-24 1.4E-28  149.3   4.0   81    2-82    602-687 (694)
  2 KOG0695|consensus               99.8 1.1E-19 2.3E-24  121.9   3.9   81    2-82    493-579 (593)
  3 KOG0696|consensus               99.8 7.1E-20 1.5E-24  125.0   2.6   81    2-82    584-669 (683)
  4 KOG0690|consensus               99.8   1E-19 2.2E-24  121.4   2.3   69    2-70    402-471 (516)
  5 KOG0616|consensus               99.7 1.1E-18 2.3E-23  114.6   2.7   80    2-82    275-355 (355)
  6 KOG0598|consensus               99.7 1.8E-17 3.9E-22  110.4   3.7   66    2-68    260-326 (357)
  7 KOG0986|consensus               99.7 6.7E-18 1.5E-22  115.8   1.5   79    1-82    423-503 (591)
  8 KOG0605|consensus               99.7 6.4E-17 1.4E-21  112.0   4.0   60    2-66    426-485 (550)
  9 KOG0614|consensus               99.7 6.7E-17 1.4E-21  112.4   3.8   65    2-66    655-719 (732)
 10 KOG0612|consensus               99.5 2.1E-14 4.6E-19  106.2   4.5   51    4-58    320-370 (1317)
 11 KOG0610|consensus               99.5 2.1E-14 4.6E-19   97.5   2.0   47    2-51    371-417 (459)
 12 KOG0608|consensus               99.4 1.3E-13 2.7E-18   98.4   4.0   62    3-68    909-970 (1034)
 13 KOG0603|consensus               99.3 6.6E-13 1.4E-17   93.6   2.0   81    2-82    221-304 (612)
 14 PTZ00263 protein kinase A cata  99.3 1.1E-11 2.4E-16   81.8   5.8   81    2-82    249-329 (329)
 15 cd05570 STKc_PKC Catalytic dom  99.2 2.4E-11 5.3E-16   79.7   5.8   81    2-82    230-315 (318)
 16 cd05589 STKc_PKN Catalytic dom  99.2 3.5E-11 7.7E-16   79.0   5.7   81    2-82    235-321 (324)
 17 cd05617 STKc_aPKC_zeta Catalyt  99.2 4.3E-11 9.3E-16   78.9   6.1   81    2-82    237-323 (327)
 18 cd05590 STKc_nPKC_eta Catalyti  99.2 4.4E-11 9.5E-16   78.7   5.7   81    2-82    230-316 (320)
 19 PTZ00426 cAMP-dependent protei  99.2 7.3E-11 1.6E-15   78.5   5.9   79    2-82    262-340 (340)
 20 smart00133 S_TK_X Extension to  99.2 4.8E-11   1E-15   62.1   3.7   55   28-82      1-60  (64)
 21 cd05588 STKc_aPKC Catalytic do  99.1 1.2E-10 2.6E-15   76.8   5.9   81    2-82    239-325 (329)
 22 cd05619 STKc_nPKC_theta Cataly  99.1 8.7E-11 1.9E-15   77.2   5.0   77    2-82    230-311 (316)
 23 cd05591 STKc_nPKC_epsilon Cata  99.1 1.4E-10   3E-15   76.1   5.8   81    2-82    230-317 (321)
 24 cd05587 STKc_cPKC Catalytic do  99.1 2.2E-10 4.7E-15   75.3   5.7   81    2-82    235-320 (324)
 25 cd05616 STKc_cPKC_beta Catalyt  99.1 2.8E-10 6.1E-15   74.8   5.6   80    2-82    235-319 (323)
 26 cd05615 STKc_cPKC_alpha Cataly  99.1 3.9E-10 8.5E-15   74.2   5.8   80    2-82    235-319 (323)
 27 cd05571 STKc_PKB Catalytic dom  99.0 9.1E-10   2E-14   72.4   5.7   69    2-70    229-298 (323)
 28 cd05592 STKc_nPKC_theta_delta   99.0 1.2E-09 2.6E-14   71.7   5.4   77    2-82    230-311 (316)
 29 cd05612 STKc_PRKX_like Catalyt  99.0 9.4E-10   2E-14   71.3   4.7   59    2-60    232-290 (291)
 30 cd05618 STKc_aPKC_iota Catalyt  99.0 2.4E-09 5.2E-14   70.7   6.2   67    2-68    239-307 (329)
 31 cd05620 STKc_nPKC_delta Cataly  98.9 2.5E-09 5.3E-14   70.3   5.1   77    2-82    230-311 (316)
 32 cd05593 STKc_PKB_gamma Catalyt  98.9   4E-09 8.7E-14   69.6   5.9   68    2-69    229-297 (328)
 33 cd05585 STKc_YPK1_like Catalyt  98.9 7.3E-09 1.6E-13   67.8   5.8   79    2-82    227-310 (312)
 34 cd05586 STKc_Sck1_like Catalyt  98.9 6.1E-09 1.3E-13   68.5   5.4   62    2-64    232-294 (330)
 35 cd05604 STKc_SGK3 Catalytic do  98.8 8.6E-09 1.9E-13   67.8   5.7   63    2-65    230-293 (325)
 36 cd05595 STKc_PKB_beta Catalyti  98.8 7.3E-09 1.6E-13   68.2   5.4   69    2-70    229-298 (323)
 37 cd05614 STKc_MSK2_N N-terminal  98.8 1.3E-08 2.9E-13   66.9   5.9   81    2-82    245-327 (332)
 38 cd05631 STKc_GRK4 Catalytic do  98.8 3.5E-09 7.6E-14   68.4   2.6   46    2-47    239-284 (285)
 39 cd05584 STKc_p70S6K Catalytic   98.7 2.5E-08 5.5E-13   65.6   5.8   81    2-82    234-318 (323)
 40 cd05575 STKc_SGK Catalytic dom  98.7 2.2E-08 4.7E-13   65.8   5.3   63    2-65    230-293 (323)
 41 cd05625 STKc_LATS1 Catalytic d  98.7 1.9E-08 4.1E-13   67.5   5.1   57    4-63    287-343 (382)
 42 cd05582 STKc_RSK_N N-terminal   98.7 4.1E-08 8.9E-13   64.3   5.5   81    2-82    232-315 (318)
 43 cd05594 STKc_PKB_alpha Catalyt  98.7 3.6E-08 7.9E-13   64.8   4.8   65    2-66    230-295 (325)
 44 cd05580 STKc_PKA Catalytic dom  98.7 3.3E-08 7.1E-13   63.8   4.1   59    2-60    232-290 (290)
 45 cd05602 STKc_SGK1 Catalytic do  98.6   8E-08 1.7E-12   63.2   5.4   63    2-65    230-293 (325)
 46 cd05627 STKc_NDR2 Catalytic do  98.6 1.3E-07 2.9E-12   63.0   5.9   56    5-64    276-331 (360)
 47 cd05603 STKc_SGK2 Catalytic do  98.6 1.3E-07 2.9E-12   62.0   5.7   63    2-65    230-293 (321)
 48 KOG0592|consensus               98.5 7.8E-08 1.7E-12   67.8   3.4   32    2-38    321-352 (604)
 49 cd05630 STKc_GRK6 Catalytic do  98.5 9.9E-08 2.1E-12   61.7   2.7   46    2-47    239-284 (285)
 50 KOG0606|consensus               98.4 8.8E-08 1.9E-12   71.7   1.6   54    1-58    294-347 (1205)
 51 cd05573 STKc_ROCK_NDR_like Cat  98.4 4.2E-07 9.1E-12   60.0   4.4   57    2-65    268-324 (350)
 52 cd05608 STKc_GRK1 Catalytic do  98.4 1.9E-07 4.1E-12   60.2   2.6   46    2-47    235-280 (280)
 53 cd05599 STKc_NDR_like Catalyti  98.4 6.5E-07 1.4E-11   59.6   5.2   56    5-64    279-334 (364)
 54 cd05628 STKc_NDR1 Catalytic do  98.4 1.1E-06 2.4E-11   58.7   6.1   56    5-64    276-331 (363)
 55 cd05605 STKc_GRK4_like Catalyt  98.4 3.4E-07 7.4E-12   59.1   3.4   46    2-47    239-284 (285)
 56 cd05607 STKc_GRK7 Catalytic do  98.4 2.7E-07 5.8E-12   59.4   2.5   45    2-47    233-277 (277)
 57 cd05621 STKc_ROCK2 Catalytic d  98.3 1.7E-06 3.6E-11   58.3   5.4   55    6-62    288-342 (370)
 58 cd05626 STKc_LATS2 Catalytic d  98.3 2.2E-06 4.8E-11   57.7   5.6   54    7-63    290-343 (381)
 59 cd05632 STKc_GRK5 Catalytic do  98.3 6.5E-07 1.4E-11   57.8   2.8   46    2-47    239-284 (285)
 60 cd05629 STKc_NDR_like_fungal C  98.2 3.2E-06   7E-11   56.7   5.3   52    2-58    286-337 (377)
 61 cd05622 STKc_ROCK1 Catalytic d  98.2   4E-06 8.6E-11   56.5   5.7   56    3-61    286-341 (371)
 62 cd05633 STKc_GRK3 Catalytic do  98.2 1.2E-06 2.6E-11   56.4   3.1   46    2-47    233-278 (279)
 63 cd05598 STKc_LATS Catalytic do  98.2 2.2E-06 4.9E-11   57.4   4.3   57    4-63    283-339 (376)
 64 cd05577 STKc_GRK Catalytic dom  98.2 1.4E-06 3.1E-11   55.8   2.8   46    2-47    232-277 (277)
 65 cd05596 STKc_ROCK Catalytic do  98.2 4.8E-06   1E-10   56.0   5.3   58    2-62    285-342 (370)
 66 cd05601 STKc_CRIK Catalytic do  98.1 5.7E-06 1.2E-10   54.4   4.9   50    2-59    247-296 (330)
 67 cd05583 STKc_MSK_N N-terminal   98.0 4.8E-06   1E-10   53.5   2.5   43    2-46    246-288 (288)
 68 cd05624 STKc_MRCK_beta Catalyt  97.9 2.6E-05 5.6E-10   51.6   5.5   48    7-58    251-298 (331)
 69 cd05613 STKc_MSK1_N N-terminal  97.9 9.7E-06 2.1E-10   52.2   3.1   45    2-46    246-290 (290)
 70 cd05606 STKc_beta_ARK Catalyti  97.9 1.1E-05 2.3E-10   52.0   2.7   45    2-46    233-277 (278)
 71 cd05623 STKc_MRCK_alpha Cataly  97.9 5.9E-05 1.3E-09   49.8   6.1   48    7-58    251-298 (332)
 72 cd05600 STKc_Sid2p_Dbf2p Catal  97.7 3.8E-05 8.3E-10   50.6   3.7   51    3-60    241-291 (333)
 73 cd05597 STKc_DMPK_like Catalyt  97.7 0.00017 3.6E-09   47.7   5.8   49    6-58    250-298 (331)
 74 KOG0606|consensus               97.6 4.2E-05 9.2E-10   57.9   2.8   58    2-63   1072-1130(1205)
 75 cd05574 STKc_phototropin_like   97.4 0.00011 2.3E-09   47.9   2.4   45    2-49    268-312 (316)
 76 cd05609 STKc_MAST Catalytic do  97.4 0.00024 5.2E-09   46.2   3.7   53    2-58    253-305 (305)
 77 cd05610 STKc_MASTL Catalytic d  97.4 0.00015 3.2E-09   52.7   2.9   50    2-58    617-666 (669)
 78 cd05572 STKc_cGK_PKG Catalytic  97.2 0.00015 3.2E-09   45.9   1.3   32    2-33    230-261 (262)
 79 PF00433 Pkinase_C:  Protein ki  96.9 0.00026 5.7E-09   34.9   0.4   35   48-82      2-42  (48)
 80 cd05611 STKc_Rim15_like Cataly  96.9 0.00028 6.2E-09   44.5   0.6   30    2-33    231-260 (260)
 81 cd05579 STKc_MAST_like Catalyt  96.5  0.0014   3E-08   41.1   1.7   29    2-32    237-265 (265)
 82 cd07869 STKc_PFTAIRE1 Catalyti  96.0  0.0038 8.2E-08   40.5   1.6   27    2-33    271-297 (303)
 83 PLN03225 Serine/threonine-prot  94.8   0.019 4.2E-07   41.3   2.0   27    2-33    433-459 (566)
 84 PTZ00284 protein kinase; Provi  94.2   0.027 5.8E-07   39.1   1.6   23    2-29    421-443 (467)
 85 PHA03210 serine/threonine kina  94.2   0.028 6.1E-07   39.6   1.6   31    2-37    437-467 (501)
 86 PHA03207 serine/threonine kina  94.1   0.027 5.9E-07   38.2   1.4   30    2-36    358-387 (392)
 87 cd07873 STKc_PCTAIRE1 Catalyti  93.9   0.037 8.1E-07   35.8   1.6   25    2-31    269-293 (301)
 88 cd07875 STKc_JNK1 Catalytic do  93.8   0.029 6.3E-07   37.5   1.1   22    2-28    301-322 (364)
 89 cd07859 STKc_TDY_MAPK_plant Ca  93.7   0.037   8E-07   36.2   1.4   26    2-32    273-298 (338)
 90 cd07872 STKc_PCTAIRE2 Catalyti  93.6   0.036 7.7E-07   36.1   1.2   24    2-30    269-292 (309)
 91 PTZ00036 glycogen synthase kin  93.5   0.024 5.3E-07   39.2   0.3   26    2-32    334-359 (440)
 92 cd07853 STKc_NLK Catalytic dom  93.2     0.1 2.2E-06   35.0   2.9   27    2-33    271-297 (372)
 93 cd06644 STKc_STK10_LOK Catalyt  92.9   0.061 1.3E-06   34.6   1.5   30    2-36    252-281 (292)
 94 KOG0615|consensus               92.7   0.053 1.1E-06   38.1   1.0   26    2-32    420-445 (475)
 95 cd06616 PKc_MKK4 Catalytic dom  92.3    0.06 1.3E-06   34.4   0.9   29    2-35    250-278 (288)
 96 KOG0585|consensus               92.1   0.047   1E-06   39.1   0.2   22    2-28    355-376 (576)
 97 cd07879 STKc_p38delta_MAPK13 C  91.9   0.089 1.9E-06   34.9   1.4   28    2-34    280-307 (342)
 98 cd05061 PTKc_InsR Catalytic do  91.7    0.12 2.6E-06   33.2   1.8   30    2-32    257-288 (288)
 99 cd07845 STKc_CDK10 Catalytic d  91.6   0.095 2.1E-06   34.0   1.2   23    2-29    273-295 (309)
100 cd07854 STKc_MAPK4_6 Catalytic  91.2    0.14   3E-06   34.0   1.7   25    2-31    283-307 (342)
101 cd07876 STKc_JNK2 Catalytic do  91.0    0.13 2.7E-06   34.4   1.3   23    2-29    298-320 (359)
102 PHA03212 serine/threonine kina  90.9    0.11 2.4E-06   35.4   1.0   24    2-30    359-382 (391)
103 cd07878 STKc_p38beta_MAPK11 Ca  90.9    0.14 3.1E-06   33.8   1.5   25    2-31    281-305 (343)
104 cd07880 STKc_p38gamma_MAPK12 C  90.8    0.12 2.5E-06   34.4   1.0   24    2-30    281-304 (343)
105 KOG0603|consensus               90.0   0.095   2E-06   38.3   0.1   22    1-27    545-566 (612)
106 PLN00009 cyclin-dependent kina  90.0    0.11 2.3E-06   33.5   0.3   25    2-31    267-291 (294)
107 cd08216 PK_STRAD Pseudokinase   89.7    0.15 3.2E-06   33.1   0.8   25    2-31    278-302 (314)
108 cd08227 PK_STRAD_alpha Pseudok  89.6    0.15 3.2E-06   33.6   0.7   24    3-31    291-314 (327)
109 cd07858 STKc_TEY_MAPK_plant Ca  89.4    0.15 3.2E-06   33.7   0.6   24    2-30    274-297 (337)
110 PLN00034 mitogen-activated pro  89.3    0.31 6.6E-06   32.5   2.1   24    2-30    311-334 (353)
111 cd06649 PKc_MEK2 Catalytic dom  89.1    0.14 3.1E-06   33.8   0.4   26    2-32    284-309 (331)
112 PTZ00024 cyclin-dependent prot  89.1    0.26 5.6E-06   32.4   1.6   24    2-30    296-319 (335)
113 cd07851 STKc_p38 Catalytic dom  88.8    0.32 6.9E-06   32.3   1.9   23    2-29    281-303 (343)
114 cd07874 STKc_JNK3 Catalytic do  88.5    0.26 5.6E-06   32.8   1.3   22    2-28    294-315 (355)
115 cd06617 PKc_MKK3_6 Catalytic d  88.3     0.2 4.4E-06   31.8   0.7   27    2-33    244-270 (283)
116 cd07849 STKc_ERK1_2_like Catal  88.2     0.3 6.6E-06   32.2   1.5   24    2-30    275-298 (336)
117 KOG0671|consensus               87.5    0.23 4.9E-06   34.7   0.6   24    2-30    389-412 (415)
118 cd07841 STKc_CDK7 Catalytic do  87.0    0.36 7.7E-06   31.0   1.3   24    2-30    265-288 (298)
119 KOG0583|consensus               86.7    0.34 7.4E-06   33.3   1.1   24    2-30    258-281 (370)
120 cd06619 PKc_MKK5 Catalytic dom  86.6    0.43 9.4E-06   30.5   1.5   25    2-31    236-260 (279)
121 KOG0599|consensus               86.5    0.21 4.5E-06   33.9  -0.0   24    2-30    266-289 (411)
122 cd06611 STKc_SLK_like Catalyti  86.0    0.47   1E-05   30.2   1.4   27    2-33    245-271 (280)
123 cd07877 STKc_p38alpha_MAPK14 C  85.9    0.41   9E-06   31.8   1.2   23    2-29    283-305 (345)
124 cd07855 STKc_ERK5 Catalytic do  85.7    0.41   9E-06   31.5   1.1   24    2-30    277-300 (334)
125 KOG0604|consensus               85.6    0.34 7.4E-06   33.2   0.7   23    2-29    305-327 (400)
126 cd07834 STKc_MAPK Catalytic do  85.6    0.33 7.1E-06   31.7   0.6   24    2-30    272-295 (330)
127 cd06650 PKc_MEK1 Catalytic dom  85.4    0.33 7.1E-06   32.2   0.5   24    2-30    282-305 (333)
128 KOG0593|consensus               85.1    0.23 4.9E-06   34.1  -0.4   24    2-30    267-290 (396)
129 KOG0575|consensus               85.1    0.43 9.3E-06   34.9   1.0   22    2-28    252-273 (592)
130 cd06615 PKc_MEK Catalytic doma  85.0    0.48   1E-05   30.8   1.1   23    2-29    270-292 (308)
131 cd07850 STKc_JNK Catalytic dom  84.7    0.44 9.5E-06   31.7   0.9   22    2-28    294-315 (353)
132 KOG0581|consensus               84.7    0.41   9E-06   33.0   0.8   23    3-30    319-341 (364)
133 cd08226 PK_STRAD_beta Pseudoki  84.5    0.19   4E-06   33.1  -1.0   23    2-29    291-313 (328)
134 cd06621 PKc_MAPKK_Pek1_like Ca  84.4    0.69 1.5E-05   29.6   1.7   24    2-30    249-272 (287)
135 cd07856 STKc_Sty1_Hog1 Catalyt  84.3     0.6 1.3E-05   30.9   1.4   22    2-28    271-292 (328)
136 cd06609 STKc_MST3_like Catalyt  83.8    0.61 1.3E-05   29.5   1.2   25    2-31    234-258 (274)
137 KOG0665|consensus               83.1    0.63 1.4E-05   32.0   1.1   36    2-46    293-328 (369)
138 cd07857 STKc_MPK1 Catalytic do  82.8    0.76 1.7E-05   30.2   1.4   22    2-28    275-296 (332)
139 KOG0597|consensus               82.7    0.39 8.4E-06   35.5  -0.0   23    2-29    234-256 (808)
140 cd06658 STKc_PAK5 Catalytic do  81.9    0.69 1.5E-05   29.9   0.9   24    2-30    255-278 (292)
141 KOG0582|consensus               81.4    0.61 1.3E-05   33.3   0.5   26    3-33    277-302 (516)
142 cd06917 STKc_NAK1_like Catalyt  81.2    0.81 1.8E-05   29.0   1.1   25    2-31    238-262 (277)
143 cd06622 PKc_MAPKK_PBS2_like Ca  80.8    0.88 1.9E-05   29.0   1.1   24    2-30    245-268 (286)
144 KOG0588|consensus               80.6    0.97 2.1E-05   33.9   1.4   26    3-33    247-272 (786)
145 KOG0032|consensus               80.6     1.3 2.8E-05   30.7   1.9   24    2-30    276-299 (382)
146 cd06643 STKc_SLK Catalytic dom  80.3    0.96 2.1E-05   28.8   1.2   23    2-29    245-267 (282)
147 cd06656 STKc_PAK3 Catalytic do  79.8     1.1 2.5E-05   28.9   1.4   23    2-29    252-274 (297)
148 cd07852 STKc_MAPK15 Catalytic   77.9     1.1 2.4E-05   29.5   0.9   24    2-30    278-301 (337)
149 cd06647 STKc_PAK_I Catalytic d  76.9       1 2.2E-05   29.1   0.6   25    2-31    252-276 (293)
150 cd06657 STKc_PAK4 Catalytic do  76.7     1.1 2.3E-05   29.1   0.6   23    2-29    253-275 (292)
151 KOG1027|consensus               76.5     2.3   5E-05   32.6   2.3   25    2-33    750-774 (903)
152 KOG1167|consensus               75.9     1.5 3.3E-05   30.9   1.2   25    2-31    364-388 (418)
153 cd06633 STKc_TAO3 Catalytic do  75.6       2 4.3E-05   28.0   1.7   26    2-32    256-281 (313)
154 cd06648 STKc_PAK_II Catalytic   75.6     1.9 4.1E-05   27.7   1.5   24    2-30    252-275 (285)
155 KOG0662|consensus               74.2     2.4 5.1E-05   27.4   1.6   24    2-30    266-289 (292)
156 cd06618 PKc_MKK7 Catalytic dom  73.9     1.7 3.6E-05   28.0   1.0   22    2-28    256-277 (296)
157 cd06614 STKc_PAK Catalytic dom  73.7     1.5 3.2E-05   28.0   0.7   27    2-33    253-279 (286)
158 cd06640 STKc_MST4 Catalytic do  72.9     1.7 3.6E-05   27.7   0.7   26    2-32    236-261 (277)
159 cd06655 STKc_PAK2 Catalytic do  72.8     1.4 2.9E-05   28.6   0.3   24    2-30    252-275 (296)
160 KOG0669|consensus               72.7     1.6 3.4E-05   29.6   0.6   23    2-29    298-320 (376)
161 KOG0663|consensus               71.9     2.4 5.1E-05   29.6   1.3   24    2-30    344-367 (419)
162 cd06641 STKc_MST3 Catalytic do  69.9     1.8 3.8E-05   27.6   0.4   24    2-30    236-259 (277)
163 KOG4717|consensus               69.1     2.8 6.1E-05   31.1   1.3   27    2-33    253-279 (864)
164 KOG0660|consensus               68.7     2.4 5.2E-05   29.3   0.8   24    2-30    293-316 (359)
165 cd06659 STKc_PAK6 Catalytic do  68.6     2.8 6.1E-05   27.1   1.1   24    2-30    254-277 (297)
166 PLN03224 probable serine/threo  67.4       4 8.6E-05   29.4   1.8   12   17-28    493-504 (507)
167 KOG0607|consensus               67.4     1.7 3.6E-05   30.3  -0.1   27    2-33    344-370 (463)
168 cd06654 STKc_PAK1 Catalytic do  67.0     3.5 7.6E-05   26.6   1.3   23    2-29    253-275 (296)
169 cd06620 PKc_MAPKK_Byr1_like Ca  66.3     3.3 7.2E-05   26.4   1.1   22    2-28    249-270 (284)
170 KOG0666|consensus               65.3     3.7 8.1E-05   28.5   1.2   25    2-31    320-344 (438)
171 cd06642 STKc_STK25-YSK1 Cataly  64.8     1.2 2.6E-05   28.3  -1.2   27    2-33    236-262 (277)
172 KOG0033|consensus               64.0     3.7 8.1E-05   27.7   1.0   22    3-29    251-272 (355)
173 cd06634 STKc_TAO2 Catalytic do  63.9       5 0.00011   26.1   1.6   24    2-30    250-273 (308)
174 cd06607 STKc_TAO Catalytic dom  63.6     3.6 7.8E-05   26.6   0.9   22    3-29    251-272 (307)
175 KOG0667|consensus               62.2     4.2 9.2E-05   29.9   1.1   26    2-32    485-510 (586)
176 KOG0579|consensus               61.3     5.8 0.00013   30.3   1.7   27    3-34    273-299 (1187)
177 PLN00181 protein SPA1-RELATED;  60.2     4.7  0.0001   30.2   1.1   24    2-30    248-271 (793)
178 KOG0658|consensus               59.5     3.2 6.8E-05   28.8   0.1   24    2-30    289-312 (364)
179 KOG0594|consensus               57.6     6.2 0.00013   27.0   1.2   25    2-31    285-309 (323)
180 PHA03209 serine/threonine kina  56.4     7.1 0.00015   26.1   1.4   16   15-30    342-357 (357)
181 KOG0659|consensus               55.8     4.9 0.00011   27.2   0.5   23    2-29    264-286 (318)
182 KOG0578|consensus               49.5     7.6 0.00016   28.4   0.7   21    3-28    507-527 (550)
183 KOG0661|consensus               48.6      10 0.00022   27.6   1.2   23    2-29    274-296 (538)
184 KOG0668|consensus               46.5     5.5 0.00012   26.7  -0.3   24    2-30    305-328 (338)
185 cd06635 STKc_TAO1 Catalytic do  45.0      11 0.00024   24.6   0.9   22    2-28    260-281 (317)
186 KOG0590|consensus               44.2      10 0.00022   28.0   0.6   25    2-31    568-592 (601)
187 KOG1290|consensus               42.6      16 0.00035   26.8   1.4   24    3-31    534-557 (590)
188 PTZ00283 serine/threonine prot  40.7      10 0.00022   26.9   0.2   24    2-30    280-303 (496)
189 KOG0600|consensus               39.8      18 0.00039   26.5   1.3   23    2-29    383-405 (560)
190 KOG0596|consensus               37.0      22 0.00047   26.6   1.4   25    3-32    611-635 (677)
191 cd06651 STKc_MEKK3 Catalytic d  35.3      24 0.00052   22.1   1.3   14   15-28    252-265 (266)
192 PHA03390 pk1 serine/threonine-  34.5      24 0.00051   22.4   1.2   12   18-29    256-267 (267)
193 KOG0201|consensus               32.8      11 0.00025   27.0  -0.5   24    2-30    246-269 (467)
194 PF03790 KNOX1:  KNOX1 domain ;  25.6      22 0.00047   17.3  -0.1   25   19-43      5-29  (45)
195 cd07837 STKc_CdkB_plant Cataly  25.1      51  0.0011   20.9   1.5   14   15-28    282-295 (295)
196 KOG0198|consensus               25.0      43 0.00094   22.8   1.2   22    3-29    260-281 (313)
197 smart00750 KIND kinase non-cat  24.9      19 0.00041   21.1  -0.5   20    3-27    149-168 (176)
198 PF04663 Phenol_monoox:  Phenol  23.7      22 0.00048   18.7  -0.3   16   20-35     49-64  (67)
199 KOG0983|consensus               23.7      48   0.001   22.9   1.2   23    3-30    333-355 (391)
200 PTZ00267 NIMA-related protein   23.5      21 0.00046   25.1  -0.5   24    2-30    306-329 (478)
201 PHA03211 serine/threonine kina  23.0      56  0.0012   23.2   1.5   15   15-29    446-460 (461)
202 PF14623 Vint:  Hint-domain      22.8      30 0.00066   21.4   0.1   11   19-29    118-128 (162)
203 PF03720 UDPG_MGDP_dh_C:  UDP-g  22.6      37  0.0008   18.9   0.5   29   21-49     73-101 (106)
204 cd06605 PKc_MAPKK Catalytic do  22.0      51  0.0011   20.4   1.1   15   15-29    248-262 (265)
205 cd06639 STKc_myosinIIIB Cataly  22.0      62  0.0013   20.5   1.5   14   15-28    278-291 (291)
206 cd07832 STKc_CCRK Catalytic do  21.7      61  0.0013   20.3   1.4   14   15-28    273-286 (286)
207 cd06623 PKc_MAPKK_plant_like C  20.6      40 0.00086   20.8   0.3   17   15-31    247-263 (264)
208 KOG0574|consensus               20.2      32 0.00069   24.1  -0.2   22    3-29    267-288 (502)

No 1  
>KOG0694|consensus
Probab=99.89  E-value=6.4e-24  Score=149.27  Aligned_cols=81  Identities=36%  Similarity=0.649  Sum_probs=76.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      ||.++|++|||++.+++++|+.||||++|||+.|++|+++|||+|.++++.|.+||| +|+.+.+.+++.    ++.++|
T Consensus       602 ll~k~p~kRLG~~e~d~~~i~~hpFFr~i~w~~L~~r~i~PPf~P~i~~~~D~snFd~eFt~e~p~Lt~~~~~~l~~~~q  681 (694)
T KOG0694|consen  602 LLRKNPEKRLGSGERDAEDIKKHPFFRSIDWDDLLNRRIKPPFVPTIKGPEDVSNFDEEFTSEKPALTPSDPRPLTEEEQ  681 (694)
T ss_pred             HhccCcccccCCCCCCchhhhhCCccccCCHHHHhhccCCCCCCcccCChhhhcccchhhhcCCCccCCCCccccchhhH
Confidence            789999999999989999999999999999999999999999999999999999999 999999998864    456789


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|.+|
T Consensus       682 ~~F~~F  687 (694)
T KOG0694|consen  682 EAFRDF  687 (694)
T ss_pred             HHhcCc
Confidence            999987


No 2  
>KOG0695|consensus
Probab=99.78  E-value=1.1e-19  Score=121.90  Aligned_cols=81  Identities=25%  Similarity=0.463  Sum_probs=74.4

Q ss_pred             CCCCCccccCCCC-CCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCCC----Cccc
Q psy8369           2 ARTKLRDNQFLKL-RNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPSV----GETE   75 (82)
Q Consensus         2 lL~~~p~~RLG~~-~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~~----~~~~   75 (82)
                      .|++||.+||||. ..|..+|+.|+||+.|||+.+.++.+.|||.|.+.+..+..||| .|+++.+.++|..    ...+
T Consensus       493 flnkdp~erlgc~~~~g~~dik~h~ffr~idwd~leqk~v~ppf~p~i~~d~~l~~fd~qft~e~~qltpdd~d~i~rid  572 (593)
T KOG0695|consen  493 FLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEQKQVLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRID  572 (593)
T ss_pred             hhcCCcHHhcCCCcccchhhhhcchhhhhCCHHHHhhcccCCCCCCccccccCccccccccccCCcccCCCCHHHHHhcc
Confidence            4899999999996 55999999999999999999999999999999999999999999 9999999998773    3567


Q ss_pred             ccccCCC
Q psy8369          76 QSLFDDF   82 (82)
Q Consensus        76 ~~~F~~F   82 (82)
                      |..|+||
T Consensus       573 qsefegf  579 (593)
T KOG0695|consen  573 QSEFEGF  579 (593)
T ss_pred             hhhcCcc
Confidence            9999998


No 3  
>KOG0696|consensus
Probab=99.78  E-value=7.1e-20  Score=125.01  Aligned_cols=81  Identities=26%  Similarity=0.513  Sum_probs=75.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      ||.+.|.+||||+..|..+|+.||||+.|||+.++.+.++|||.|.++...+.+||| .|+.+.+.++|+    ....+|
T Consensus       584 ~ltK~P~kRLGcg~~ge~di~~H~FFR~iDWek~E~~eiqPPfkPk~k~~r~~eNFD~~Ft~~~~~lTPpD~~v~~nldq  663 (683)
T KOG0696|consen  584 LLTKHPGKRLGCGPEGERDIREHPFFRRIDWEKLERREIQPPFKPKIKCGRDAENFDKFFTREPTDLTPPDKLVMMNLDQ  663 (683)
T ss_pred             HhhcCCccccCCCCccccchhhCcchhhccHHHHhhccCCCCCCCccccCCchhhhhHHHhcCCCCCCCchHHHHhcCch
Confidence            688999999999988999999999999999999999999999999999999999999 899999998887    346788


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      +.|.||
T Consensus       664 ~eF~gF  669 (683)
T KOG0696|consen  664 SEFEGF  669 (683)
T ss_pred             hhcCce
Confidence            999987


No 4  
>KOG0690|consensus
Probab=99.77  E-value=1e-19  Score=121.36  Aligned_cols=69  Identities=30%  Similarity=0.585  Sum_probs=66.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS   70 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~   70 (82)
                      ||.++|.+|||.+..++.+|++|+||++|||++++.+++.|||.|++.+..|+++|| +|+.+.+.++|+
T Consensus       402 LL~kdP~kRLGgGpdDakEi~~h~FF~~v~W~~~~~Kki~PPfKPqVtSetDTryFD~EFT~q~v~lTPP  471 (516)
T KOG0690|consen  402 LLKKDPKKRLGGGPDDAKEIMRHRFFASVDWEATYRKKIEPPFKPQVTSETDTRYFDEEFTSQPVTLTPP  471 (516)
T ss_pred             HhhcChHhhcCCCchhHHHHHhhhhhccCCHHHHHHhccCCCCCCCcccccchhhhhhhhhcceeEecCC
Confidence            799999999998888899999999999999999999999999999999999999999 999999988877


No 5  
>KOG0616|consensus
Probab=99.73  E-value=1.1e-18  Score=114.57  Aligned_cols=80  Identities=40%  Similarity=0.753  Sum_probs=68.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeec-ccCCCCCCCCCCCCCCCCCCCCCCCCcccccccC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVP-EVHYDGDTRNFDEYPETDWKAAPSVGETEQSLFD   80 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P-~~~~~~d~~~f~~~~~~~~~~~~~~~~~~~~~F~   80 (82)
                      ||++|-++|+|++++|..+||.||||++++|+++++|++.|||+| ....+.|+++|+.+.++.. .....+....+.|.
T Consensus       275 LL~vD~t~R~gnlknG~~dIk~H~wF~~v~W~~i~~r~ie~P~~pp~~~~~gdtsnfd~y~e~~~-~~~~~~~~~~~~f~  353 (355)
T KOG0616|consen  275 LLQVDLTKRFGNLKNGVEDIKNHPWFKGVDWEAILQRKIEPPFEPPNIHGPGDTSNFDDYEEEDT-LGISEDQKCAKLFA  353 (355)
T ss_pred             HHhhhhHhhhcCcCCCccccccCcccccccHHHHhhccccCCCCCccccCCcccccccccccccc-ccccCCHHHHHHHh
Confidence            789999999999999999999999999999999999999999998 6778999999998888775 33334445567777


Q ss_pred             CC
Q psy8369          81 DF   82 (82)
Q Consensus        81 ~F   82 (82)
                      +|
T Consensus       354 ef  355 (355)
T KOG0616|consen  354 EF  355 (355)
T ss_pred             cC
Confidence            65


No 6  
>KOG0598|consensus
Probab=99.69  E-value=1.8e-17  Score=110.42  Aligned_cols=66  Identities=27%  Similarity=0.518  Sum_probs=60.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAA   68 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~   68 (82)
                      ||+++|++||| ..+++.+|++||||++|||+.|.++++.|||+|.+.+..|+++|| +|+...+..+
T Consensus       260 LL~rdp~~RLg-~~~d~~~ik~HpfF~~inW~~l~~k~l~PpF~P~~~~~~~~~~Fd~eft~~~~~~~  326 (357)
T KOG0598|consen  260 LLKRDPRQRLG-GPGDAEEIKRHPFFKGINWEKLLAKKLSPPFKPNVTGLEDTSNFDNEFTSYTVDYS  326 (357)
T ss_pred             HhccCHHHhcC-CCCChHHhhcCcccccCCHHHHHhcCCCCCeecCCCCccccccccHHHHhccccCC
Confidence            79999999999 477999999999999999999999999999999999999999999 8777754433


No 7  
>KOG0986|consensus
Probab=99.68  E-value=6.7e-18  Score=115.82  Aligned_cols=79  Identities=22%  Similarity=0.478  Sum_probs=61.5

Q ss_pred             CCCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccC--CCCCCCCCCCCCCCCCCCCCCCCcccccc
Q psy8369           1 MARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVH--YDGDTRNFDEYPETDWKAAPSVGETEQSL   78 (82)
Q Consensus         1 ~lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~--~~~d~~~f~~~~~~~~~~~~~~~~~~~~~   78 (82)
                      +||++||.+||||...|+++||+||||+++||..|+...+.|||+|...  ...|.-.++.|...+...   ....++++
T Consensus       423 ~LL~Kdp~~RLGcrg~ga~evk~HpfFk~lnw~rleagml~PPfiPdp~aVyakDv~DIeqFs~VKGV~---ld~~D~~f  499 (591)
T KOG0986|consen  423 GLLTKDPEKRLGCRGEGAQEVKEHPFFKDLNWRRLEAGMLEPPFIPDPGAVYAKDVLDIEQFSTVKGVK---LDDTDTDF  499 (591)
T ss_pred             HHHccCHHHhccCCCcCcchhhhCcccccCCHhHHhccCCCCCCCCCccccchhhhhhhhhccccccee---cccccHHH
Confidence            5899999999999778999999999999999999999999999999876  344555555666554322   33445555


Q ss_pred             cCCC
Q psy8369          79 FDDF   82 (82)
Q Consensus        79 F~~F   82 (82)
                      |.+|
T Consensus       500 y~~F  503 (591)
T KOG0986|consen  500 YKNF  503 (591)
T ss_pred             HHhc
Confidence            5554


No 8  
>KOG0605|consensus
Probab=99.66  E-value=6.4e-17  Score=111.96  Aligned_cols=60  Identities=37%  Similarity=0.718  Sum_probs=53.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWK   66 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~   66 (82)
                      ||+ ||.+|||  .+|++|||.||||++|+|+.|+  ...|||+|.+.+..|+.||++|+++...
T Consensus       426 ll~-d~~~RLG--~~G~~EIK~HPfF~~v~W~~l~--~~~apfvP~v~~~~DT~yFddF~e~~~~  485 (550)
T KOG0605|consen  426 LLC-DPENRLG--SKGAEEIKKHPFFKGVDWDHLR--EMPAPFVPQVNSELDTQYFDDFPEEDSM  485 (550)
T ss_pred             Hhc-CHHHhcC--cccHHHHhcCCccccCCcchhh--cCCCCCCCCCCCcccccccccCcccccC
Confidence            566 9999999  4899999999999999999995  4559999999999999999998887654


No 9  
>KOG0614|consensus
Probab=99.66  E-value=6.7e-17  Score=112.37  Aligned_cols=65  Identities=32%  Similarity=0.697  Sum_probs=59.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWK   66 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~   66 (82)
                      |..-+|++|||+..+|..+|+.|.||.++||+.|..+.+.||++|.+.++.|++|||.|+.+.-.
T Consensus       655 LCr~~P~ERLG~~~~gI~DIkkH~Wf~gfdweglr~~~L~pPi~~~va~ptD~s~Fd~~p~dnd~  719 (732)
T KOG0614|consen  655 LCRDNPTERLGYQKGGINDIKKHRWFEGFDWEGLRSRTLPPPIIPSVANPTDVSNFDNFPPDNDE  719 (732)
T ss_pred             HHhcCcHhhhccccCChHHHHhhhhhhcCChhhhhhccCCCCccccCCCcccchhccCCCcccCC
Confidence            34558999999999999999999999999999999999999999999999999999988887643


No 10 
>KOG0612|consensus
Probab=99.50  E-value=2.1e-14  Score=106.17  Aligned_cols=51  Identities=47%  Similarity=0.923  Sum_probs=47.4

Q ss_pred             CCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           4 TKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         4 ~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      -.+|..|||  ++|+++||.||||.|++|+.|  |...|||+|.++++.|++||+
T Consensus       320 l~~~e~RLg--rngiedik~HpFF~g~~W~~i--R~~~pP~vPevssd~DTsnFd  370 (1317)
T KOG0612|consen  320 LCDREVRLG--RNGIEDIKNHPFFEGIDWDNI--RESVPPVVPEVSSDDDTSNFD  370 (1317)
T ss_pred             hcChhhhcc--cccHHHHHhCccccCCChhhh--hhcCCCCCCcCCCCCcccccc
Confidence            357999999  799999999999999999887  888999999999999999996


No 11 
>KOG0610|consensus
Probab=99.46  E-value=2.1e-14  Score=97.54  Aligned_cols=47  Identities=30%  Similarity=0.583  Sum_probs=41.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYD   51 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~   51 (82)
                      ||+|||.+|||+ ..|+.|||+||||++|+|..  -|...||++|.....
T Consensus       371 LLvKdP~kRlg~-~rGA~eIK~HpFF~gVnWaL--ir~~~PP~iP~~~d~  417 (459)
T KOG0610|consen  371 LLVKDPSKRLGS-KRGAAEIKRHPFFEGVNWAL--IRCARPPEIPKPVDG  417 (459)
T ss_pred             HhccChhhhhcc-ccchHHhhcCccccCCChhh--eeccCCCcCCCcccc
Confidence            799999999999 77999999999999999993  388999999987543


No 12 
>KOG0608|consensus
Probab=99.42  E-value=1.3e-13  Score=98.42  Aligned_cols=62  Identities=34%  Similarity=0.582  Sum_probs=54.4

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWKAA   68 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~~~   68 (82)
                      |+.++..|||  ++|+++||.||||++|||..|  |+..+||+|.++.+.|++|||.+..++.+..
T Consensus       909 Lc~sad~RLG--kng~d~vKaHpfFkgIDfssl--Rkq~ApYIP~ItHptDTSNFdpvdpeklwnd  970 (1034)
T KOG0608|consen  909 LCCSADSRLG--KNGADQVKAHPFFKGIDFSSL--RKQRAPYIPRITHPTDTSNFDPVDPEKLWND  970 (1034)
T ss_pred             HhcChhhhhc--ccchhhhhcCccccccchHhh--hhccCCcCccccCCCccccCCcCCccccccc
Confidence            6788999999  689999999999999999995  7778889999999999999997777665543


No 13 
>KOG0603|consensus
Probab=99.31  E-value=6.6e-13  Score=93.59  Aligned_cols=81  Identities=22%  Similarity=0.500  Sum_probs=70.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCCCC--cccccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPSVG--ETEQSL   78 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~~~--~~~~~~   78 (82)
                      ++.++|..|||++..++.+|++|+||..++|+.+..++++|||+|......|+.+|+ +|+...+...+...  ..+..+
T Consensus       221 l~~r~p~nrLg~~~~~~~eik~h~f~~~i~~~~l~~r~~~~~fkp~~~~e~~~~~fd~eft~~~P~dsp~~~~~~s~~~i  300 (612)
T KOG0603|consen  221 LFKRNPENRLGAGPDGVDEIKQHEFFQSIDWNELEARSRPPPFKPGSITERDVAQFDPEFTSQVPADSPLLSASGSDHTI  300 (612)
T ss_pred             HHhhCHHHHhccCcchhHHHhccchheeeeHhhHhhcCCCCCCCCcccchhhhhhcCchhccCCcccCCCCCCCccccch
Confidence            467899999998778999999999999999999999999999999999999999999 89999888776533  233466


Q ss_pred             cCCC
Q psy8369          79 FDDF   82 (82)
Q Consensus        79 F~~F   82 (82)
                      |.||
T Consensus       301 f~g~  304 (612)
T KOG0603|consen  301 FSGP  304 (612)
T ss_pred             hcCC
Confidence            7665


No 14 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=99.27  E-value=1.1e-11  Score=81.76  Aligned_cols=81  Identities=31%  Similarity=0.605  Sum_probs=68.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCCCCCCCCcccccccCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWKAAPSVGETEQSLFDD   81 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~~~~~~~~~~~~~F~~   81 (82)
                      +|+.||.+|+++....+.+|+.||||.+++|+.+..+.+.+|+.+......+..+|..+++......++.+...+..|.|
T Consensus       249 ~L~~dP~~R~~~~~~~~~~ll~hp~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~  328 (329)
T PTZ00263        249 LLQTDHTKRLGTLKGGVADVKNHPYFHGANWDKLYARYYPAPIPVRVKSPGDTSNFEKYPDSPVDRLPPLTAAQQAEFAG  328 (329)
T ss_pred             HhhcCHHHcCCCCCCCHHHHhcCCccCCCCHHHHHhCCCCCCcCCCCCCcccchhccCCcccccccCCCCchhhhhhcCC
Confidence            58899999998777789999999999999999999999999988888888888999877665554445566667888988


Q ss_pred             C
Q psy8369          82 F   82 (82)
Q Consensus        82 F   82 (82)
                      |
T Consensus       329 ~  329 (329)
T PTZ00263        329 F  329 (329)
T ss_pred             C
Confidence            7


No 15 
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=99.22  E-value=2.4e-11  Score=79.71  Aligned_cols=81  Identities=28%  Similarity=0.530  Sum_probs=69.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      +|.++|.+|+++......++..||||+.++|..+..+.+.||+.|......+.++|+ .|..+.+..++.    ..+..|
T Consensus       230 ~l~~dP~~R~s~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  309 (318)
T cd05570         230 FLTKNPEKRLGCLPTGEQDIKGHPFFREIDWDKLERKEIKPPFKPKIKGRFDVSNFDDEFTKEKPVLTPPDEAIIRNIDQ  309 (318)
T ss_pred             HccCCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCchhccCcccCCCCcccccccccc
Confidence            588999999986555679999999999999999999999999999999988999998 777777766654    345678


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      +.|+||
T Consensus       310 ~~~~~~  315 (318)
T cd05570         310 EEFRGF  315 (318)
T ss_pred             cccCCC
Confidence            899998


No 16 
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=99.20  E-value=3.5e-11  Score=79.05  Aligned_cols=81  Identities=31%  Similarity=0.591  Sum_probs=67.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC-----CCccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS-----VGETE   75 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~-----~~~~~   75 (82)
                      +|+++|.+|+++....+.+++.|+||++++|..+..+.+.||+.|......|.++|+ .+....+..+++     .++..
T Consensus       235 ~L~~dP~~R~~~~~~~~~~l~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (324)
T cd05589         235 LLRRNPERRLGSGEKDAEDVKKQPFFRDINWDDLLARKIKPPFVPTIKGPEDVSNFDEEFTSEAPVLTPPREPRLLTEEE  314 (324)
T ss_pred             HhhcCHhHcCCCCCCCHHHHhhCCCcCCCCHHHHHhCCCCcCccCCCCCcchhhhcCccccccccccCCCccccccchhh
Confidence            578999999987666899999999999999999999999999999998888999988 666665554443     44567


Q ss_pred             ccccCCC
Q psy8369          76 QSLFDDF   82 (82)
Q Consensus        76 ~~~F~~F   82 (82)
                      |+.|.+|
T Consensus       315 ~~~~~~~  321 (324)
T cd05589         315 QELFRGF  321 (324)
T ss_pred             hcccCCc
Confidence            8889887


No 17 
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=99.20  E-value=4.3e-11  Score=78.89  Aligned_cols=81  Identities=25%  Similarity=0.501  Sum_probs=63.2

Q ss_pred             CCCCCccccCCCC-CCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCccc
Q psy8369           2 ARTKLRDNQFLKL-RNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETE   75 (82)
Q Consensus         2 lL~~~p~~RLG~~-~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~   75 (82)
                      +|+++|.+|+++. ..+..+|+.|+||.+++|+.+..+.+.+||.|......+.++|+ .+..+....++.    ...++
T Consensus       237 ~L~~dP~~R~~~~~~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (327)
T cd05617         237 FLNKDPKERLGCQPQTGFSDIKSHTFFRSIDWDLLEKKQVTPPFKPQITDDYGLENFDTQFTSEPVQLTPDDEDVIKRID  316 (327)
T ss_pred             HhccCHHHcCCCCCCCCHHHHHcCCCCCCCCHHHHHhCCCCCCccCCCCCCcchhhcCCccccCcccCCCCCcccccccc
Confidence            5889999999863 34789999999999999999999999999999998888888887 555554333322    22345


Q ss_pred             ccccCCC
Q psy8369          76 QSLFDDF   82 (82)
Q Consensus        76 ~~~F~~F   82 (82)
                      +..|.||
T Consensus       317 ~~~~~~~  323 (327)
T cd05617         317 QSEFEGF  323 (327)
T ss_pred             ccccCCC
Confidence            6677776


No 18 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=99.19  E-value=4.4e-11  Score=78.65  Aligned_cols=81  Identities=28%  Similarity=0.511  Sum_probs=64.1

Q ss_pred             CCCCCccccCCCC-CCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCccc
Q psy8369           2 ARTKLRDNQFLKL-RNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETE   75 (82)
Q Consensus         2 lL~~~p~~RLG~~-~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~   75 (82)
                      +|+++|.+|+++. -.+.++++.||||.+++|+.+..+.+.||+.|...+..+.++|+ ++..+....++.    .....
T Consensus       230 ~L~~dP~~R~~~~~~~~~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  309 (320)
T cd05590         230 FMTKNPTMRLGSLTLGGEEAILRHPFFKELDWEKLNRRQIEPPFRPRIKSREDVSNFDPDFIKEDPVLTPIEESLLPMIN  309 (320)
T ss_pred             HcccCHHHCCCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCcccccCCccCCCCccccccccc
Confidence            5789999999863 24679999999999999999999999999999999999999998 666665444432    22234


Q ss_pred             ccccCCC
Q psy8369          76 QSLFDDF   82 (82)
Q Consensus        76 ~~~F~~F   82 (82)
                      ++.|++|
T Consensus       310 ~~~~~~~  316 (320)
T cd05590         310 QDEFRNF  316 (320)
T ss_pred             ccCcCCC
Confidence            5677775


No 19 
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=99.17  E-value=7.3e-11  Score=78.52  Aligned_cols=79  Identities=25%  Similarity=0.407  Sum_probs=62.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCCCCCCCCCcccccccCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDWKAAPSVGETEQSLFDD   81 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~~~~~~~~~~~~~~F~~   81 (82)
                      +|+.+|.+|++..+.++++++.||||.+++|..+..+.+.+|++|......+.++|..+.++.....  .....++.|.+
T Consensus       262 ~l~~dp~~R~~~~~~~~~~~~~hp~f~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~  339 (340)
T PTZ00426        262 LLSHDLTKRYGNLKKGAQNVKEHPWFGNIDWVSLLHKNVEVPYKPKYKNVFDSSNFERVQEDLTIAD--KITNENDPFFD  339 (340)
T ss_pred             HcccCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCCcchhhcCCCcccccccC--CCccccCcccC
Confidence            5789999999876778999999999999999999999999999999988888888875444432111  11234577887


Q ss_pred             C
Q psy8369          82 F   82 (82)
Q Consensus        82 F   82 (82)
                      |
T Consensus       340 ~  340 (340)
T PTZ00426        340 W  340 (340)
T ss_pred             C
Confidence            6


No 20 
>smart00133 S_TK_X Extension to Ser/Thr-type protein kinases.
Probab=99.16  E-value=4.8e-11  Score=62.12  Aligned_cols=55  Identities=33%  Similarity=0.661  Sum_probs=43.5

Q ss_pred             CCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCCCCcc----cccccCCC
Q psy8369          28 KGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPSVGET----EQSLFDDF   82 (82)
Q Consensus        28 ~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~~~~~----~~~~F~~F   82 (82)
                      ++|||+.|++|+++|||+|.+.+..|+++|+ +|+.+....++.....    .+..|.||
T Consensus         1 ~~idW~~l~~r~~~pP~~P~~~~~~d~s~fd~~~~~~~~~~s~~~~~~~~~~~~~~F~gf   60 (64)
T smart00133        1 RGIDWDKLENKEIEPPFVPKIKSPTDTSNFDDEFTEETPVLTPVDSPASGGSQQEPFRGF   60 (64)
T ss_pred             CCCCHHHHHhCCCCCCcccccCCccHHhHcCCcCCCCCCCCCCCCccccccccccccCCC
Confidence            4799999999999999999999999999999 5888876655432211    14678876


No 21 
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=99.14  E-value=1.2e-10  Score=76.81  Aligned_cols=81  Identities=26%  Similarity=0.528  Sum_probs=64.8

Q ss_pred             CCCCCccccCCCC-CCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCccc
Q psy8369           2 ARTKLRDNQFLKL-RNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETE   75 (82)
Q Consensus         2 lL~~~p~~RLG~~-~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~   75 (82)
                      +|+++|.+|+++. ..+..+++.||||..++|+.+..+.+.||+.|......+..+|+ .+.++.....|.    ....+
T Consensus       239 ~L~~dP~~R~~~~~~~~~~~i~~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~  318 (329)
T cd05588         239 FLNKDPKERLGCHPQTGFRDIKSHPFFRNIDWDLLEQKQVLPPYKPNIESDRDLDNFDPQFTDEPVQLTPDDPDVIARID  318 (329)
T ss_pred             HhccCHHHcCCCCCCCCHHHHhcCCCCCCCCHHHHHhCCCCCCccccCCCcchhhhcCCccccCccccCCCCcccccccc
Confidence            5889999999863 24689999999999999999998899999999988888888888 666665554433    23556


Q ss_pred             ccccCCC
Q psy8369          76 QSLFDDF   82 (82)
Q Consensus        76 ~~~F~~F   82 (82)
                      +..|.+|
T Consensus       319 ~~~~~~~  325 (329)
T cd05588         319 QSEFEGF  325 (329)
T ss_pred             ccccCCC
Confidence            7788886


No 22 
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=99.13  E-value=8.7e-11  Score=77.21  Aligned_cols=77  Identities=23%  Similarity=0.555  Sum_probs=64.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      +|+++|.+|++.    ..+++.||||..++|..+..+.+.+|+.|......+.++|+ ++.++.......    +..+++
T Consensus       230 ~l~~~P~~R~~~----~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (316)
T cd05619         230 LFVREPERRLGV----KGDIRQHPFFREIDWSALEEREIEPPFKPKVKSANDCSNFDKEFLNEKPRLSVTDRMLINSMDQ  305 (316)
T ss_pred             HhccCHhhcCCC----hHHHHcCcccCCCCHHHHHhCCCCCCcCCCCCCccchhhcChhhhcCCcccCCCcccccccccc
Confidence            578899999964    35899999999999999999999999999999999999998 777766554422    445788


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      +.|++|
T Consensus       306 ~~~~~~  311 (316)
T cd05619         306 NMFENF  311 (316)
T ss_pred             cccCCC
Confidence            889886


No 23 
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=99.13  E-value=1.4e-10  Score=76.13  Aligned_cols=81  Identities=28%  Similarity=0.547  Sum_probs=63.4

Q ss_pred             CCCCCccccCCCCCC--CHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcc
Q psy8369           2 ARTKLRDNQFLKLRN--GADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGET   74 (82)
Q Consensus         2 lL~~~p~~RLG~~~~--~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~   74 (82)
                      +|+++|.+|+++...  .+.+++.||||.+++|..+..+.+.+|+.|......+..+|+ ++....+...+.    ....
T Consensus       230 ~L~~dp~~R~~~~~~~~~~~~~~~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  309 (321)
T cd05591         230 FMTKNPNKRLGCVASQGGEDAIKQHPFFKEIDWVLLEQRKIKPPFKPKIKTKRDVNNFDQDFTKEEPVLTPVDPAVIKQI  309 (321)
T ss_pred             HhccCHHHcCCCCCCCCCHHHHhcCCccCCCCHHHHHhCCCCCCCCCCCCCcchhhhcCCccccCccccCCCCccccccc
Confidence            588999999987432  789999999999999999999999999999988878888887 666655444432    2334


Q ss_pred             cccccCCC
Q psy8369          75 EQSLFDDF   82 (82)
Q Consensus        75 ~~~~F~~F   82 (82)
                      .++.|.||
T Consensus       310 ~~~~~~~~  317 (321)
T cd05591         310 NQEEFRGF  317 (321)
T ss_pred             cccccCCC
Confidence            56667776


No 24 
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=99.10  E-value=2.2e-10  Score=75.30  Aligned_cols=81  Identities=26%  Similarity=0.485  Sum_probs=61.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCC-CCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPE-TDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~-~~~~~~~~----~~~~~~   76 (82)
                      +|.++|.+|+++.....++++.||||.+++|..+..+.+.+|+.|......+.++|+.+.. .....++.    ..+..+
T Consensus       235 ~l~~~P~~R~~~~~~~~~~~~~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (324)
T cd05587         235 LLTKHPAKRLGCGPTGERDIREHAFFRRIDWEKLERREIQPPFKPKVKGRRSAENFDKFFTREPPVLTPPDKLVIANIDQ  314 (324)
T ss_pred             HhhcCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCccCcCCCcchhhhcCcccccCccccCCCCccccccccc
Confidence            5789999999875556789999999999999999999999999999888888999984333 32222222    223345


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|++|
T Consensus       315 ~~~~~~  320 (324)
T cd05587         315 SEFQGF  320 (324)
T ss_pred             cccCCC
Confidence            666665


No 25 
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=99.08  E-value=2.8e-10  Score=74.77  Aligned_cols=80  Identities=26%  Similarity=0.457  Sum_probs=59.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCC-CCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPET-DWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~-~~~~~~~----~~~~~~   76 (82)
                      +|+++|.+|+++...+..+|+.|+||+.++|+.+..+.+.||+.|.... .+..+++.|... .+..++.    .....+
T Consensus       235 ~l~~~p~~R~~~~~~~~~~i~~h~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (323)
T cd05616         235 LMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEVQPPYKPKACG-RDAENFDKFFTRHPPVLTPPDQEVIMNLDQ  313 (323)
T ss_pred             HcccCHHhcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcCCC-chhhhcCchhccCCccCCCCCccccccccc
Confidence            5789999999976667899999999999999999999999999998653 677788743333 2222222    122334


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|+||
T Consensus       314 ~~~~~~  319 (323)
T cd05616         314 SEFEGF  319 (323)
T ss_pred             cccCCC
Confidence            677776


No 26 
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=99.06  E-value=3.9e-10  Score=74.22  Aligned_cols=80  Identities=25%  Similarity=0.492  Sum_probs=59.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      +|.++|.+|+++...+..+|+.|+||.+++|..+..+.+.+|+.|..... ...+|+ .+.+..+...++    ....+.
T Consensus       235 ~l~~~p~~R~~~~~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (323)
T cd05615         235 LMTKHPSKRLGCGPEGERDIREHAFFRRIDWDKLENREIQPPFKPKVCGK-GAENFDKFFTRGQPVLTPPDQLVIANIDQ  313 (323)
T ss_pred             HcccCHhhCCCCCCCCHHHHhcCcccCCCCHHHHhcCCCCcCccCccCCC-chhhcCccccccCCCCCCCcccccccccc
Confidence            57899999998766678999999999999999999999999999976553 477787 443333333322    223445


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|.+|
T Consensus       314 ~~~~~~  319 (323)
T cd05615         314 ADFEGF  319 (323)
T ss_pred             cccCCC
Confidence            678776


No 27 
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=99.00  E-value=9.1e-10  Score=72.43  Aligned_cols=69  Identities=29%  Similarity=0.559  Sum_probs=58.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS   70 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~   70 (82)
                      +|+++|.+|++.....+.++..|+||.+++|..+..+.+.||+.|......++..|+ +++......+++
T Consensus       229 ~L~~dP~~R~~~~~~~~~~ll~h~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~  298 (323)
T cd05571         229 LLKKDPKQRLGGGPEDAKEIMEHRFFASINWQDVVQKKLEPPFKPQVTSETDTRYFDEEFTAQSITITPP  298 (323)
T ss_pred             HccCCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCcccccCCcccCCC
Confidence            578999999986555799999999999999999999999999999998888898887 666665544443


No 28 
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=98.97  E-value=1.2e-09  Score=71.71  Aligned_cols=77  Identities=26%  Similarity=0.558  Sum_probs=64.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCCC----Ccccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPSV----GETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~~----~~~~~   76 (82)
                      +|.++|.+|++.    ..+++.|+||..++|..+..+.+.||+.|......+.++|+ .++++....++..    ..+++
T Consensus       230 ~l~~~P~~R~~~----~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (316)
T cd05592         230 LFERDPTKRLGV----DGDIRQHPFFRGIDWERLEKREIPPPFKPKVKSPSDASNFDREFTNEKVRLSPVDKKLLASMDQ  305 (316)
T ss_pred             HccCCHHHcCCC----hHHHHcCcccCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCcccccccccCCCccccccccccc
Confidence            578999999963    46999999999999999999999999999999888999998 8888777666542    45667


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|.+|
T Consensus       306 ~~~~~~  311 (316)
T cd05592         306 EQFRGF  311 (316)
T ss_pred             cccCCC
Confidence            777775


No 29 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=98.97  E-value=9.4e-10  Score=71.30  Aligned_cols=59  Identities=58%  Similarity=1.005  Sum_probs=54.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEY   60 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~   60 (82)
                      +|+.||.+|+++.+..++++..|+||..++|..+..+++.||..|......++.+|+.+
T Consensus       232 ~l~~dp~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~  290 (291)
T cd05612         232 LLVVDRTRRLGNMKNGADDVKNHRWFKSVDWDDVPQRKLKPPIVPKVSHDGDTSNFDDY  290 (291)
T ss_pred             HcCCCHHHccCCccCCHHHHhcCccccCCCHHHHhcCCCCCCEeCCCCCccccccccCC
Confidence            58899999999877889999999999999999999999999999999999999998754


No 30 
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=98.95  E-value=2.4e-09  Score=70.71  Aligned_cols=67  Identities=21%  Similarity=0.396  Sum_probs=53.8

Q ss_pred             CCCCCccccCCCC-CCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKL-RNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAA   68 (82)
Q Consensus         2 lL~~~p~~RLG~~-~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~   68 (82)
                      +|+++|.+|+++. ..+..+|+.||||++++|+.+..+++.||+.|......+..+|+ .+.++.....
T Consensus       239 ~L~~dP~~R~~~~~~~~~~~i~~hp~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  307 (329)
T cd05618         239 FLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDLMEQKQVVPPFKPNISGEFGLDNFDAQFTNEPVQLT  307 (329)
T ss_pred             HhcCCHHHcCCCCCCCCHHHHhcCCCCCCCCHHHHHcCCCCcCccCCCCCcccchhcCcccccCCccCC
Confidence            5889999999863 24689999999999999999999999999999887777777776 4555544333


No 31 
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=98.91  E-value=2.5e-09  Score=70.26  Aligned_cols=77  Identities=25%  Similarity=0.460  Sum_probs=60.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      +|.++|.+|++.    .++++.|+||.+++|..+..+.+.+|+.|......+.++|+ ++..+....+..    ....++
T Consensus       230 ~l~~dP~~R~~~----~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (316)
T cd05620         230 LFERDPTRRLGV----VGNIRGHPFFKTINWTALEKRELDPPFKPKVKSPSDYSNFDREFLSEKPRLSYSDKNLIDSMDQ  305 (316)
T ss_pred             HccCCHHHcCCC----hHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCccccccCcccCCCcccccccccc
Confidence            578999999963    46899999999999999999999999999998888888888 666554443322    234556


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|.||
T Consensus       306 ~~~~~~  311 (316)
T cd05620         306 SAFAGF  311 (316)
T ss_pred             cCcCCC
Confidence            777765


No 32 
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=98.90  E-value=4e-09  Score=69.65  Aligned_cols=68  Identities=34%  Similarity=0.630  Sum_probs=58.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAP   69 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~   69 (82)
                      +|+++|.+|++.....+.+|..|+||.+++|..+..+.+.||+.|...+..+...|+ +++.+.....+
T Consensus       229 ~L~~dP~~R~~~~~~~~~~il~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  297 (328)
T cd05593         229 LLIKDPNKRLGGGPDDAKEIMRHSFFTGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITP  297 (328)
T ss_pred             HcCCCHHHcCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcCCCcchhhhcCcccccCCcccCC
Confidence            578999999987666899999999999999999999999999999998888888888 77776654443


No 33 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=98.85  E-value=7.3e-09  Score=67.77  Aligned_cols=79  Identities=27%  Similarity=0.476  Sum_probs=61.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC----CCcccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS----VGETEQ   76 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~----~~~~~~   76 (82)
                      +|..+|.+|++.  .++.++..||||..++|..+..+.+.+++.|...+..+.++|+ +++...+.....    .....|
T Consensus       227 ~L~~dp~~R~~~--~~~~e~l~hp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  304 (312)
T cd05585         227 LLSRDPTRRLGY--NGAQEIKNHPFFSQLSWKKLLMKGIQPPFKPAVSSAIDTSNFDEEFTREKPIDSVVDDSHLSETVQ  304 (312)
T ss_pred             HcCCCHHHcCCC--CCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCccchhhcCccccccccccCCCccccccchhc
Confidence            578999999974  4689999999999999999999999999999998888999987 666554332211    223446


Q ss_pred             cccCCC
Q psy8369          77 SLFDDF   82 (82)
Q Consensus        77 ~~F~~F   82 (82)
                      ..|.+|
T Consensus       305 ~~~~~~  310 (312)
T cd05585         305 QQFGGW  310 (312)
T ss_pred             cccCCC
Confidence            667665


No 34 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=98.85  E-value=6.1e-09  Score=68.54  Aligned_cols=62  Identities=26%  Similarity=0.521  Sum_probs=53.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETD   64 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~   64 (82)
                      +|+++|.+|+++ ...+.+++.||||.+++|+.+..+.+.+|+.|......+.++|+ +|.+..
T Consensus       232 ~L~~~P~~R~~~-~~~~~~ll~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  294 (330)
T cd05586         232 LLNRNPQHRLGA-HRDAVELKEHPFFADIDWDLLSKKQITPPFKPIVDSDEDVSNFDPEFTNSS  294 (330)
T ss_pred             HcCCCHHHCCCC-CCCHHHHhcCccccCCCHHHHHhCCCCCCccCCCCCCcchhhcCccccccc
Confidence            588999999976 45789999999999999999999999999999988888888876 555444


No 35 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=98.84  E-value=8.6e-09  Score=67.79  Aligned_cols=63  Identities=24%  Similarity=0.474  Sum_probs=54.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDW   65 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~   65 (82)
                      +|+++|.+|++. +....+++.||||.+++|..+..+++.+|+.|......+.++|+ .+.++..
T Consensus       230 ll~~~p~~R~~~-~~~~~~i~~h~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (325)
T cd05604         230 LLEKDRQRRLGA-KEDFLEIQEHPFFESLSWTDLEQKKIPPPFNPNVEGPDDISNFDAVFTEETV  293 (325)
T ss_pred             HhccCHHhcCCC-CCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcCCCcchhhhcCCccccCCc
Confidence            578999999986 45788999999999999999999999999999988888888888 5665543


No 36 
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=98.84  E-value=7.3e-09  Score=68.22  Aligned_cols=69  Identities=30%  Similarity=0.526  Sum_probs=59.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS   70 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~   70 (82)
                      +|+++|.+|++.....+.++.+|+||.+++|..+..+.+.||+.|...+..+...|+ +++.......++
T Consensus       229 ~L~~dP~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  298 (323)
T cd05595         229 LLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPP  298 (323)
T ss_pred             HccCCHHHhCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCChhhhhhcCcccccCCccCCCC
Confidence            578999999987666899999999999999999999999999999998888888888 777776655544


No 37 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=98.81  E-value=1.3e-08  Score=66.90  Aligned_cols=81  Identities=25%  Similarity=0.514  Sum_probs=61.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC-CCccccccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS-VGETEQSLF   79 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~-~~~~~~~~F   79 (82)
                      +|+++|.+|+++....++++.+||||.+++|..+..+++.+|+.|......+..+|. ++....+..++. .+......|
T Consensus       245 ~l~~dp~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  324 (332)
T cd05614         245 LLRKDPKKRLGAGPQGASEIKEHPFFKGLDWEALALRKVNPPFRPSIRNELDVGNFAEEFTNLEPVYSPAGTPPSGARVF  324 (332)
T ss_pred             HcCCCHHHcCCCCCCCHHHHHcCCCcCCCCHHHHHhCCCCCCcCCCCCCcchhhhcCcccccCCcccCCCCCCccccccc
Confidence            578999999987555899999999999999999999999999999988877887776 555444433333 233344555


Q ss_pred             CCC
Q psy8369          80 DDF   82 (82)
Q Consensus        80 ~~F   82 (82)
                      .+|
T Consensus       325 ~~~  327 (332)
T cd05614         325 QGY  327 (332)
T ss_pred             CCc
Confidence            554


No 38 
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=98.79  E-value=3.5e-09  Score=68.36  Aligned_cols=46  Identities=28%  Similarity=0.430  Sum_probs=42.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|+.+|.+|+++...++++|++||||.+++|+.+.++.++|||+|.
T Consensus       239 ~l~~~P~~R~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05631         239 LLTKNPKERLGCRGNGAAGVKQHPIFKNINFKRLEANMLEPPFCPD  284 (285)
T ss_pred             HhhcCHHHhcCCCCCCHHHHhcCHhhcCCCHHHHHhCcCCcCCCCC
Confidence            5789999999875667999999999999999999999999999996


No 39 
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=98.75  E-value=2.5e-08  Score=65.58  Aligned_cols=81  Identities=22%  Similarity=0.489  Sum_probs=61.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC---CCccccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS---VGETEQS   77 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~---~~~~~~~   77 (82)
                      +|+++|.+|+++....+.++..||||...+|+.+..+.+.+|+.+......+.+.|+ .++...+..++.   .......
T Consensus       234 ~l~~~p~~R~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (323)
T cd05584         234 LLKRNPSSRLGAGPGDAAEVQSHPFFRHVNWDDLLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQ  313 (323)
T ss_pred             HcccCHhHcCCCCCCCHHHHhcCCCcCCCCHHHHhcCCCCCCcCCCCCCcchhhhcCchhcccccccCcccccccccccc
Confidence            578999999987667899999999999999999999999999998888777877777 555544433322   2222346


Q ss_pred             ccCCC
Q psy8369          78 LFDDF   82 (82)
Q Consensus        78 ~F~~F   82 (82)
                      .|.||
T Consensus       314 ~~~~~  318 (323)
T cd05584         314 IFLGF  318 (323)
T ss_pred             CcCCC
Confidence            67765


No 40 
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=98.74  E-value=2.2e-08  Score=65.82  Aligned_cols=63  Identities=25%  Similarity=0.512  Sum_probs=53.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDW   65 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~   65 (82)
                      +|+++|.+|++. +....++..||||.+++|..+..+.+.+|+.|......+...|+ ++.++..
T Consensus       230 ~l~~~p~~R~~~-~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (323)
T cd05575         230 LLQKDRTKRLGA-KDDFLEIKNHVFFSSINWDDLVNKKITPPFNPNVSGPMDLKHFDPEFTEEPV  293 (323)
T ss_pred             HhhcCHHhCCCC-CCCHHHHHcCCCcCCCCHHHHhhccCCCCcCCCCCCcchhhhcCcccccccc
Confidence            578999999986 45778999999999999999999999999999988888888887 5555543


No 41 
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=98.74  E-value=1.9e-08  Score=67.51  Aligned_cols=57  Identities=32%  Similarity=0.603  Sum_probs=47.5

Q ss_pred             CCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCC
Q psy8369           4 TKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPET   63 (82)
Q Consensus         4 ~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~   63 (82)
                      .++|.+|++  +.++++|+.||||++++|.... ++..+|+.|.+..+.|+++|+.+...
T Consensus       287 ~~~p~~R~~--~~~~~ei~~hp~f~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  343 (382)
T cd05625         287 CRGPEDRLG--KNGADEIKAHPFFKTIDFSSDL-RQQSAPYIPKITHPTDTSNFDPVDPD  343 (382)
T ss_pred             ccCHhHcCC--CCCHHHHhcCCCcCCcChHHHH-hcCCCCccCcCCCcchhhhcCCCCcc
Confidence            468999997  4678999999999999999865 45778999999999999999854433


No 42 
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=98.70  E-value=4.1e-08  Score=64.33  Aligned_cols=81  Identities=31%  Similarity=0.572  Sum_probs=57.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCCCCCC--CCcccccc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWKAAPS--VGETEQSL   78 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~~~~~--~~~~~~~~   78 (82)
                      +|+++|.+|+.+......++..|+||..++|..+..+.+.||+.|......+...++ .+....+...+.  ........
T Consensus       232 ~l~~~P~~R~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~  311 (318)
T cd05582         232 LFKRNPANRLGAGPDGVEEIKRHPFFSTIDWNKLYRREIKPPFKPAVGRPDDTFYFDPEFTSRTPKDSPGIPPSANAHQL  311 (318)
T ss_pred             HhhcCHhHcCCCCCCCHHHHhCCCCcCCCCHHHHHhcCCCCCcCCCCCCcchhhhcCcccccCccccCCCCccccccccc
Confidence            588999999986555589999999999999999999999999998877666666665 444333222211  22234456


Q ss_pred             cCCC
Q psy8369          79 FDDF   82 (82)
Q Consensus        79 F~~F   82 (82)
                      |.+|
T Consensus       312 ~~~~  315 (318)
T cd05582         312 FRGF  315 (318)
T ss_pred             cCCC
Confidence            6665


No 43 
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=98.68  E-value=3.6e-08  Score=64.82  Aligned_cols=65  Identities=31%  Similarity=0.569  Sum_probs=54.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDWK   66 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~~   66 (82)
                      +|+++|.+|++.....+.++.+|+||.++.|..+..+.+.||+.|......+...|+ .+......
T Consensus       230 ~L~~dP~~R~~~~~~~~~~il~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  295 (325)
T cd05594         230 LLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKKLVPPFKPQVTSETDTRYFDEEFTAQMIT  295 (325)
T ss_pred             HhhcCHHHhCCCCCCCHHHHhcCCCcCCCCHHHHHhCCCCCCcCCcCCCcchhhhcCchhhcCccc
Confidence            578999999976556789999999999999999999999999999888888888887 55554433


No 44 
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=98.66  E-value=3.3e-08  Score=63.83  Aligned_cols=59  Identities=37%  Similarity=0.785  Sum_probs=52.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEY   60 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~   60 (82)
                      +|..+|.+|..+....+.++..||||..++|..+....+.+|+.|......+.+.|++|
T Consensus       232 ~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  290 (290)
T cd05580         232 LLQVDLTKRLGNLKNGVNDIKNHPWFAGIDWIALLQRKIEAPFIPKVKGPGDTSNFDDY  290 (290)
T ss_pred             HccCCHHHccCcccCCHHHHHcCcccccCCHHHHhhccCCCCccCCCCCccccccccCC
Confidence            47789999998766789999999999999999999999999999998888888888654


No 45 
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=98.63  E-value=8e-08  Score=63.19  Aligned_cols=63  Identities=27%  Similarity=0.538  Sum_probs=53.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDW   65 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~   65 (82)
                      +|+++|.+|++. .....++++|+||..++|+.+..+++.+|+.|......+..+|+ .++++..
T Consensus       230 ~l~~~p~~R~~~-~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (325)
T cd05602         230 LLQKDRTKRLGA-KDDFMEIKNHIFFSPINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPV  293 (325)
T ss_pred             HcccCHHHCCCC-CCCHHHHhcCcccCCCCHHHHHhCCCCcCcCCCCCCcchhhhcCCccccCCc
Confidence            588999999986 45688999999999999999999999999999888888888887 5555443


No 46 
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=98.60  E-value=1.3e-07  Score=63.02  Aligned_cols=56  Identities=41%  Similarity=0.767  Sum_probs=45.2

Q ss_pred             CCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCC
Q psy8369           5 KLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETD   64 (82)
Q Consensus         5 ~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~   64 (82)
                      .+|.+|++.  .++.+|+.||||.+++|..+..+...+|+  ...+..|.++|+++.+..
T Consensus       276 ~~p~~R~~~--~~~~ei~~hp~f~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~  331 (360)
T cd05627         276 TDSENRIGS--NGVEEIKSHPFFEGVDWGHIRERPAAIPI--EIKSIDDTSNFDEFPESD  331 (360)
T ss_pred             cChhhcCCC--CCHHHHhcCCCCCCCCHHHHhcCCCCCCc--cCCCcchhhhcCCCCccc
Confidence            589999984  57999999999999999999877766654  456778888988665554


No 47 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=98.59  E-value=1.3e-07  Score=61.99  Aligned_cols=63  Identities=27%  Similarity=0.530  Sum_probs=52.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPETDW   65 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~~~   65 (82)
                      +|+++|.+|++. ...+.+++.|+||..++|+.+..+.+.+|+.|......+...++ .++....
T Consensus       230 ~l~~~p~~R~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (321)
T cd05603         230 LLHKDQRRRLGA-KADFLEIKNHVFFSPINWDDLYHKRITPPYNPNVAGPADLRHFDPEFTQEAV  293 (321)
T ss_pred             HccCCHhhcCCC-CCCHHHHhCCCCcCCCCHHHHhcCCCCCCcCCCCCCcchhhhcCCccccccc
Confidence            588999999976 44688999999999999999999999999998887777777777 5554443


No 48 
>KOG0592|consensus
Probab=98.53  E-value=7.8e-08  Score=67.81  Aligned_cols=32  Identities=22%  Similarity=0.660  Sum_probs=28.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYR   38 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~   38 (82)
                      ||+++|..||+     .++||+||||.+|||+.|.+.
T Consensus       321 LLv~dp~~Rlt-----~~qIk~HpFF~~Vdw~nlw~~  352 (604)
T KOG0592|consen  321 LLVRDPSDRLT-----SQQIKAHPFFEGVDWENLWQQ  352 (604)
T ss_pred             HHccCcccccc-----HHHHhhCcccccCChhhhhhc
Confidence            78999999996     599999999999999997543


No 49 
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=98.48  E-value=9.9e-08  Score=61.68  Aligned_cols=46  Identities=24%  Similarity=0.368  Sum_probs=41.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|+.+|.+|+++...+++++.+||||..++|..+...+.+|||.|.
T Consensus       239 ~l~~~p~~R~s~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05630         239 LLCKDPKERLGCQGGGAREVKEHPLFKQINFKRLEAGMLEPPFKPD  284 (285)
T ss_pred             HhhcCHHHccCCCCCchHHHHcChhhhccCHHHHhcCCCCCCCCCC
Confidence            4788999999875557999999999999999999999999999986


No 50 
>KOG0606|consensus
Probab=98.42  E-value=8.8e-08  Score=71.66  Aligned_cols=54  Identities=26%  Similarity=0.478  Sum_probs=48.9

Q ss_pred             CCCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           1 MARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         1 ~lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      .||+.+|..|||-  +|+-+||+|.||..+||..|+.++..  |+|.+...+|+++|+
T Consensus       294 ~LL~qnp~~Rlgt--~ga~evk~h~ff~~LDw~~llRqkae--fvpql~~eddtsyfd  347 (1205)
T KOG0606|consen  294 QLLRQNPLCRLGT--GGALEVKQHGFFQLLDWKSLLRQKAE--FVPQLESEDDTSYFD  347 (1205)
T ss_pred             HHHHhChHhhccc--chhhhhhhccceeecccchhhhhhcc--ccccccccccchhhc
Confidence            3789999999994  68999999999999999999877665  999999999999998


No 51 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=98.41  E-value=4.2e-07  Score=59.98  Aligned_cols=57  Identities=32%  Similarity=0.661  Sum_probs=46.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETDW   65 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~~   65 (82)
                      +|. +|.+|..    .+.++..||||.+++|+.+.  ...+|++|...+..+.++|+.......
T Consensus       268 ll~-dp~~R~~----s~~~ll~hp~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~  324 (350)
T cd05573         268 LLC-DPEDRLG----SFEEIKSHPFFKGIDWENLR--ETKPPFVPELSSPLDTSNFDDFEDDKD  324 (350)
T ss_pred             Hcc-ChhhcCC----CHHHHhcCCCcCCCCHHHHh--hCCCCcCCCCCCchhhhhcCCCCcccc
Confidence            454 8999984    28999999999999999875  667889999998889999985555543


No 52 
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=98.40  E-value=1.9e-07  Score=60.17  Aligned_cols=46  Identities=20%  Similarity=0.432  Sum_probs=40.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|+.+|.+|++.....++++.+||||++++|..+..+.+.+|+.|.
T Consensus       235 ~l~~~P~~R~~~~~~~~~~~l~h~~~~~~~~~~~~~~~~~~~~~~~  280 (280)
T cd05608         235 LLAKDPEKRLGFRDGNCDGLRTHPLFRDLNWRQLEAGMLPPPFVPD  280 (280)
T ss_pred             HhcCCHHHhcCCCCCCHHHHhcChhhhcCCHhHHhhccCCCCCCCC
Confidence            4789999999875557899999999999999999999999999873


No 53 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=98.40  E-value=6.5e-07  Score=59.58  Aligned_cols=56  Identities=38%  Similarity=0.774  Sum_probs=45.9

Q ss_pred             CCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCC
Q psy8369           5 KLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETD   64 (82)
Q Consensus         5 ~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~   64 (82)
                      .+|.+|++.  .++.++..||||++++|+.+.  ...+|++|...+..|.++|+++.+..
T Consensus       279 ~~p~~R~~~--~~~~~ll~h~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~  334 (364)
T cd05599         279 CEAERRLGN--NGVNEIKSHPFFKGVDWEHIR--ERPAPIIPELKSITDTSNFDDFEEID  334 (364)
T ss_pred             cCHhhcCCC--CCHHHHhcCCCcCCCCHHHHh--hcCCCCCCCCCCchhhhhcccccccc
Confidence            389999973  578999999999999999874  45678899988888889998655554


No 54 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=98.39  E-value=1.1e-06  Score=58.73  Aligned_cols=56  Identities=34%  Similarity=0.684  Sum_probs=43.9

Q ss_pred             CCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCCC
Q psy8369           5 KLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPETD   64 (82)
Q Consensus         5 ~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~~   64 (82)
                      .+|.+|++  +.++++|++||||.+++|+.+..+...+|+  ...+..++++|+.+....
T Consensus       276 ~~~~~r~~--r~~~~ei~~hp~f~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~  331 (363)
T cd05628         276 CEWEHRIG--APGVEEIKTNPFFEGVDWEHIRERPAAIPI--EIKSIDDTSNFDEFPDSD  331 (363)
T ss_pred             CChhhcCC--CCCHHHHhCCCCCCCCCHHHHHhCCCCCCc--cCCCcchhhccCCCCccc
Confidence            36788887  468999999999999999999877666554  446777888998766554


No 55 
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=98.38  E-value=3.4e-07  Score=59.11  Aligned_cols=46  Identities=24%  Similarity=0.389  Sum_probs=41.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|..||.+|+++...++.++++|+||...+|..+..+.+.|||.|.
T Consensus       239 ~l~~~P~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05605         239 LLTKDPGFRLGCRGEGAEEVKAHPFFRTANFKRLEAGMLEPPFCPD  284 (285)
T ss_pred             HccCCHHHhcCCCCCCHHHHhcCcCccCCCHHHHhhCCCCCCCCCC
Confidence            4788999999875457899999999999999999999999999984


No 56 
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=98.36  E-value=2.7e-07  Score=59.37  Aligned_cols=45  Identities=24%  Similarity=0.491  Sum_probs=38.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|+++|.+|.++ ....++++.|+||.+++|..+..+.+.|||+|.
T Consensus       233 ~L~~~P~~R~~~-~~~~~~~~~h~~f~~~~~~~~~~~~~~~~~~~~  277 (277)
T cd05607         233 FLAKKPEDRLGS-REKNDDPRKHEFFKTINFPRLEAGLIPPPFVPD  277 (277)
T ss_pred             HhccCHhhCCCC-ccchhhhhcChhhcCCCHHHHhcCcCCCCCCCC
Confidence            588999999975 333578999999999999999999999999873


No 57 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=98.30  E-value=1.7e-06  Score=58.32  Aligned_cols=55  Identities=35%  Similarity=0.646  Sum_probs=43.9

Q ss_pred             CccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCC
Q psy8369           6 LRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPE   62 (82)
Q Consensus         6 ~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~   62 (82)
                      ++.+|++  +.++.++++||||++..|+....+...+|+.|......+.++|+.+..
T Consensus       288 ~~~~r~~--R~~~~e~l~hp~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~  342 (370)
T cd05621         288 DREVRLG--RNGVEEIKQHPFFKNDQWNWDNIRETAAPVVPELSSDIDSSNFDDIED  342 (370)
T ss_pred             CchhccC--CCCHHHHhcCcccCCCCcChHhcCCCCCCcCCCCCCcchhhhcCCccc
Confidence            4566665  457899999999999877766667888999999988888999974433


No 58 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=98.28  E-value=2.2e-06  Score=57.69  Aligned_cols=54  Identities=41%  Similarity=0.648  Sum_probs=42.2

Q ss_pred             ccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCC
Q psy8369           7 RDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPET   63 (82)
Q Consensus         7 p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~   63 (82)
                      +.+|++  +.++.+|+.||||.+++|.... +...+|+.|.+....++++|+...++
T Consensus       290 ~~~~~~--R~~~~~~l~hp~f~~~~~~~~~-~~~~~~~~p~~~~~~~~~~~~~~~~~  343 (381)
T cd05626         290 AEERLG--RNGADDIKAHPFFSEVDFSSDI-RTQPAPYVPKISHPMDTSNFDPVEEE  343 (381)
T ss_pred             cccccC--CCCHHHHhcCcccCCCChhHHh-hcCCCCccCcCCCcchhhhcCCCCcc
Confidence            344443  3478999999999999999865 46778999999999999999844433


No 59 
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=98.27  E-value=6.5e-07  Score=57.79  Aligned_cols=46  Identities=28%  Similarity=0.494  Sum_probs=42.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|..+|.+|+++...++.++..|+||+.++|..+..+++.|||+|.
T Consensus       239 ~l~~~P~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (285)
T cd05632         239 LLTKDPKQRLGCQEEGAGEVKRHPFFRNMNFKRLEAGMLDPPFVPD  284 (285)
T ss_pred             HccCCHhHcCCCcccChHHHHcChhhhcCCHHHHhcCcCCCCCCCC
Confidence            5788999999986667999999999999999999999999999985


No 60 
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=98.22  E-value=3.2e-06  Score=56.69  Aligned_cols=52  Identities=35%  Similarity=0.714  Sum_probs=44.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      ||+ +|.+|++  +.++.++..||||.+++|+.+  +.+.+|++|......+..+|.
T Consensus       286 lL~-~~~~r~~--r~~~~~~l~hp~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~  337 (377)
T cd05629         286 LIT-NAENRLG--RGGAHEIKSHPFFRGVDWDTI--RQIRAPFIPQLKSITDTSYFP  337 (377)
T ss_pred             Hhc-CHhhcCC--CCCHHHHhcCCCcCCCCHHHH--ccCCCCcccCCCCccccccCC
Confidence            354 7999987  368999999999999999988  678889999988887877775


No 61 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=98.21  E-value=4e-06  Score=56.49  Aligned_cols=56  Identities=38%  Similarity=0.622  Sum_probs=44.8

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYP   61 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~   61 (82)
                      |. +|..|++  +.++.+|++|+||++..|.....+...+|++|......+.++|++..
T Consensus       286 L~-~~~~r~~--r~~~~ei~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  341 (371)
T cd05622         286 LT-DREVRLG--RNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDIE  341 (371)
T ss_pred             cC-ChhhhcC--CCCHHHHhcCcccCCCChhHHhcCCCCCCCCCCCCCcchhhhcCCCc
Confidence            44 6788876  46899999999999977776666888899999988888888887433


No 62 
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=98.21  E-value=1.2e-06  Score=56.44  Aligned_cols=46  Identities=37%  Similarity=0.762  Sum_probs=39.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      .|+++|.+|+++....++++.+||||++++|......+..+|.+|.
T Consensus       233 ~l~~~p~~R~~~~~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~  278 (279)
T cd05633         233 LLQRDVSKRLGCLGRGAQEVKEHVFFKGIDWQQVYLQKYPPPLIPP  278 (279)
T ss_pred             HhcCCHHHhcCCCCCCHHHHHhCccccCCCHhHHhcCCCCCCCCCC
Confidence            4789999999876668999999999999999998888887776663


No 63 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=98.20  E-value=2.2e-06  Score=57.37  Aligned_cols=57  Identities=39%  Similarity=0.678  Sum_probs=46.9

Q ss_pred             CCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCCC
Q psy8369           4 TKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPET   63 (82)
Q Consensus         4 ~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~~   63 (82)
                      ..+|.+|++.  .++.++++||||.+++|..+. +...+|++|......+.++|+....+
T Consensus       283 ~~~p~~R~~~--~t~~ell~h~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~  339 (376)
T cd05598         283 CCGAEDRLGK--NGADEIKAHPFFKGIDFASLI-RRQKAPYIPKITHPTDTSNFDPVDPE  339 (376)
T ss_pred             hcCHhhcCCC--CCHHHHhCCCCcCCCCHHHHh-hcCCCCCCCcCCCcchhhhcCCCCcc
Confidence            3689999973  478999999999999999887 67788899998888888888744443


No 64 
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=98.17  E-value=1.4e-06  Score=55.79  Aligned_cols=46  Identities=24%  Similarity=0.480  Sum_probs=40.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPE   47 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~   47 (82)
                      +|..+|.+|++.....+.++..||||..++|..+.+-...|||.|.
T Consensus       232 ~l~~~p~~R~~~~~~~~~~ll~h~~~~~~~~~~~~~~~~~~~~~~~  277 (277)
T cd05577         232 LLQKDPEKRLGCRGGSADEVREHPLFKDLNWRRLEAGMLEPPFIPD  277 (277)
T ss_pred             HccCChhHccCCCcccHHHHHhChhhhcCChhhhhcCCCCCCCCCC
Confidence            4788999999875558999999999999999999888888888763


No 65 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=98.16  E-value=4.8e-06  Score=56.00  Aligned_cols=58  Identities=36%  Similarity=0.575  Sum_probs=45.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEYPE   62 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~~~   62 (82)
                      +|+.+| +|++  +.++++|+.||||.+.+|.....+...+|++|......+.++|++...
T Consensus       285 ~L~~~p-~r~~--R~s~~ell~h~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~  342 (370)
T cd05596         285 FLTDRE-VRLG--RNGVDEIKSHPFFKNDQWTFDNIRETVAPVVPELSSDIDTSNFDDIED  342 (370)
T ss_pred             HccChh-hccC--CCCHHHHhcCcccCCCChhhHHhcCCCcCccCcCCCcchhhhcCCccc
Confidence            455555 4443  347899999999999999987778888999999988888889874433


No 66 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=98.12  E-value=5.7e-06  Score=54.40  Aligned_cols=50  Identities=30%  Similarity=0.593  Sum_probs=41.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDE   59 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~   59 (82)
                      +|+ +|.+|+.     +.++..||||..++|..+.  ...||+.|......+.++|++
T Consensus       247 ll~-~p~~R~t-----~~~l~~h~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~  296 (330)
T cd05601         247 LLC-GQKERLG-----YEGLCCHPFFSKIDWNNIR--NSLPPFVPTLKSDDDTSNFDE  296 (330)
T ss_pred             Hcc-ChhhCCC-----HHHHhCCCCcCCCCHHHHh--hCCCCccCcCCCcchhhhcCC
Confidence            455 8999984     6899999999999999875  466888998888888888863


No 67 
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=97.99  E-value=4.8e-06  Score=53.55  Aligned_cols=43  Identities=35%  Similarity=0.699  Sum_probs=37.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeec
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVP   46 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P   46 (82)
                      +|..+|++|...  .++.++..|+||++++|+.+.++...|||.|
T Consensus       246 ~l~~~p~~R~t~--~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  288 (288)
T cd05583         246 LLEKDPKKRLGA--NGADEIKNHPFFQGIDWDDLAAKRIPAPFKP  288 (288)
T ss_pred             HhcCCHhhccCc--chHHHHhcCcccccCCHHHHhhhccCCCCCC
Confidence            477899999963  5789999999999999999999999998864


No 68 
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=97.94  E-value=2.6e-05  Score=51.57  Aligned_cols=48  Identities=40%  Similarity=0.922  Sum_probs=39.4

Q ss_pred             ccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           7 RDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         7 p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      +.+|++  +.++++++.|+||.+++|+.+  +.+.+|++|......+.++|+
T Consensus       251 ~~~~~~--~~~~~~~~~h~~f~~~~~~~~--~~~~~~~~p~~~~~~~~~~~~  298 (331)
T cd05624         251 RERRLG--QNGIEDFKKHAFFEGIDWENI--RNLEAPYIPDVSSPSDTSNFD  298 (331)
T ss_pred             chhhcC--CCCHHHHhcCCCcCCCCHHHH--hhCCCCccCCCCCcchhhhcC
Confidence            456665  467899999999999999987  567788999888777777776


No 69 
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=97.92  E-value=9.7e-06  Score=52.17  Aligned_cols=45  Identities=22%  Similarity=0.468  Sum_probs=39.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeec
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVP   46 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P   46 (82)
                      +|..+|.+|++++...+.++..|+||..++|+.+..+..++||.|
T Consensus       246 ~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  290 (290)
T cd05613         246 LLMKDPKKRLGCGPSDADEIKKHPFFQKINWDDLAAKKVPAPFKP  290 (290)
T ss_pred             HhcCCHHHhcCCCCCCHHHHHcCcccccCCHHHHhhccCCCCCCC
Confidence            377899999988777899999999999999999988888877754


No 70 
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=97.88  E-value=1.1e-05  Score=51.95  Aligned_cols=45  Identities=31%  Similarity=0.691  Sum_probs=38.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeec
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVP   46 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P   46 (82)
                      +|.++|.+|+.+....+.++..||||++++|+.+..++.+++.+|
T Consensus       233 ~l~~~p~~R~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~  277 (278)
T cd05606         233 LLQRDVNRRLGCLGRGAQEVKEHPFFRSLDWQMVFLQKYPPPLIP  277 (278)
T ss_pred             HhhcCHHhccCCCCCCHHHHHhCccccCCCchHhhhcccCCCCCC
Confidence            477899999987656899999999999999999988887776665


No 71 
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=97.86  E-value=5.9e-05  Score=49.84  Aligned_cols=48  Identities=40%  Similarity=0.850  Sum_probs=38.9

Q ss_pred             ccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           7 RDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         7 p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      +..|++  +.++.+++.||||.+++|+.+.  ...+|++|...++.+.++++
T Consensus       251 ~~~r~~--r~~~~~~~~h~~f~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~  298 (332)
T cd05623         251 REHRLG--QNGIEDFKQHPFFTGIDWDNIR--NCEAPYIPEVSSPTDTSNFD  298 (332)
T ss_pred             hhhhcC--CCCHHHHhCCCCcCCCCHHHHh--hCCCCccCCCCCCcccccCC
Confidence            556765  4678999999999999999884  56778899888887777764


No 72 
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=97.74  E-value=3.8e-05  Score=50.63  Aligned_cols=51  Identities=35%  Similarity=0.660  Sum_probs=39.8

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFDEY   60 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~~~   60 (82)
                      |..+|.+|.     .+.+|..|+||.+++|..+.  ...||++|......+...|+++
T Consensus       241 l~~~~~rr~-----s~~~ll~h~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~  291 (333)
T cd05600         241 INDPSRRFG-----SLEDIKNHPFFKEVDWNELR--ELKPPFVPELESEIDTGYFDDF  291 (333)
T ss_pred             hhChhhhcC-----CHHHHHhCcccCCCCHHHHh--hCCCCCCCCCCCcchhhhccCC
Confidence            455566654     58999999999999999875  7888999988777777766543


No 73 
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=97.66  E-value=0.00017  Score=47.74  Aligned_cols=49  Identities=41%  Similarity=0.790  Sum_probs=39.5

Q ss_pred             CccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           6 LRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         6 ~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      .+.+|++  +.++.+++.||||.+++|..+.  ...+|++|...+..+.++|+
T Consensus       250 ~~~~r~~--r~~~~~~l~hp~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~  298 (331)
T cd05597         250 SPETRLG--RNGLQDFKDHPFFEGIDWDNIR--NSTAPYVPEVSSPTDTSNFD  298 (331)
T ss_pred             CcccccC--CCCHHHHhcCCCCCCCCHHHHh--hCCCCccCcCCCcchhhhcC
Confidence            3667765  3578999999999999999875  45677899888888888886


No 74 
>KOG0606|consensus
Probab=97.63  E-value=4.2e-05  Score=57.88  Aligned_cols=58  Identities=28%  Similarity=0.544  Sum_probs=48.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC-CCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD-EYPET   63 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~-~~~~~   63 (82)
                      ||..++.+|+|.  .++.+++.|+||.+++|+.|...+.  +|+|...+..|+++|. .|..+
T Consensus      1072 ll~~~~~qr~~a--~~~~e~k~~~~~~~~~~~~l~~q~~--~~~p~~~s~~dtS~~~~r~~~~ 1130 (1205)
T KOG0606|consen 1072 LLTEEPTQRLGA--KGAAEVKGHPFFQDVDWENLALQKA--EFVPQPESTQDTSYFESRFSEE 1130 (1205)
T ss_pred             hhccCchhccCc--ccccccccCCccCCCCccccccccC--ccCCCCCCCCccchhhcccccc
Confidence            577899999995  6778999999999999999865544  4899998899999998 66633


No 75 
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=97.41  E-value=0.00011  Score=47.92  Aligned_cols=45  Identities=29%  Similarity=0.640  Sum_probs=35.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVH   49 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~   49 (82)
                      +|.++|.+|..+ ..+++++..|+||.+++|..+..  ..||-+|...
T Consensus       268 ~l~~~p~~R~s~-~~~~~~ll~~~~~~~~~~~~~~~--~~~~~~~~~~  312 (316)
T cd05574         268 LLVKDPSKRLGS-KRGAAEIKQHPFFRGVNWALIRH--TTPPIIPRPD  312 (316)
T ss_pred             HccCCHhHCCCc-hhhHHHHHcCchhhcCChhhccc--CCCCCCCCcc
Confidence            478899999864 44689999999999999998744  5566666553


No 76 
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=97.38  E-value=0.00024  Score=46.20  Aligned_cols=53  Identities=28%  Similarity=0.572  Sum_probs=41.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      +|..+|.+|..+  .++.++..||||.+.+|..+...+  ..++|.+....+.++|+
T Consensus       253 ~l~~~P~~R~~~--~~~~~ll~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~  305 (305)
T cd05609         253 LLRQNPLERLGT--GGAFEVKQHRFFLGLDWNGLLRQK--AEFIPQLESEDDTSYFD  305 (305)
T ss_pred             HhccChhhccCc--cCHHHHHhCccccCCCHHHHhhcC--CCCCCCCCCccccccCC
Confidence            477899999975  468999999999999999876443  46788887666666543


No 77 
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=97.38  E-value=0.00015  Score=52.65  Aligned_cols=50  Identities=30%  Similarity=0.571  Sum_probs=40.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeecccCCCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVPEVHYDGDTRNFD   58 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P~~~~~~d~~~f~   58 (82)
                      +|..+|.+|.     .+.++..|+||..++|+.+..  ...||+|...+..|..+|+
T Consensus       617 lL~~dP~~R~-----ta~e~l~h~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~  666 (669)
T cd05610         617 LLTMDPTKRA-----GLKELKQHPLFHGVDWENLQN--QTMPFIPQPDDETDTSYFE  666 (669)
T ss_pred             HcccChhHCc-----CHHHHHhCHhhcCCCHHHhcc--cCCCCCCCCCCcccccccc
Confidence            5788999998     479999999999999988754  4477998777676777665


No 78 
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=97.22  E-value=0.00015  Score=45.91  Aligned_cols=32  Identities=31%  Similarity=0.873  Sum_probs=28.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|.++|.+|+++....+.++.+||||++++|+
T Consensus       230 ~l~~~p~~R~~~~~~~~~~l~~~~~~~~~~~~  261 (262)
T cd05572         230 LLRRNPEERLGNLKGGIKDIKKHKWFNGFDWE  261 (262)
T ss_pred             HccCChhhCcCCcccCHHHHhcChhhhCCCCC
Confidence            46789999998656679999999999999996


No 79 
>PF00433 Pkinase_C:  Protein kinase C terminal domain;  InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain is found in a large variety of protein kinases with different functions and dependencies. Protein kinase C, for example, is a calcium-activated, phospholipid-dependent serine- and threonine-specific enzyme. It is activated by diacylglycerol which, in turn, phosphorylates a range of cellular proteins. This domain is most often found associated with IPR000719 from INTERPRO.; GO: 0004674 protein serine/threonine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3E8D_A 1MRV_A 3E88_A 1GZO_A 1GZK_A 2JDO_A 2JDR_A 1MRY_A 1GZN_A 1O6L_A ....
Probab=96.94  E-value=0.00026  Score=34.85  Aligned_cols=35  Identities=34%  Similarity=0.536  Sum_probs=22.8

Q ss_pred             cCCCCCCCCCC-CCCCCCCCCCCC-----CCcccccccCCC
Q psy8369          48 VHYDGDTRNFD-EYPETDWKAAPS-----VGETEQSLFDDF   82 (82)
Q Consensus        48 ~~~~~d~~~f~-~~~~~~~~~~~~-----~~~~~~~~F~~F   82 (82)
                      +++..|++||| +|+++.+..++.     .....+..|.||
T Consensus         2 v~~~~DtsnFD~eFt~~~~~~t~~~~~~~~~~~~~~~F~GF   42 (48)
T PF00433_consen    2 VKSETDTSNFDPEFTEEPPVDTPPSDPSPLSSSMQENFQGF   42 (48)
T ss_dssp             -SSTT-GTTSCHHHHTSSSSS--S--HHHHCTSSGGGGTT-
T ss_pred             CCchhhhhhcCcccccCCCCCCCcccCCcccccccCcCCCC
Confidence            56788999999 899999888764     233445559987


No 80 
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=96.94  E-value=0.00028  Score=44.55  Aligned_cols=30  Identities=23%  Similarity=0.519  Sum_probs=26.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|..+|.+|+++  .++.++..||||.+++|+
T Consensus       231 ~l~~~p~~R~~~--~~~~~~l~~~~~~~~~~~  260 (260)
T cd05611         231 LLCMDPAKRLGA--NGYQEIKSHPFFKSINWD  260 (260)
T ss_pred             HccCCHHHccCC--CcHHHHHcChHhhcCCCC
Confidence            477899999974  578999999999999996


No 81 
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=96.54  E-value=0.0014  Score=41.08  Aligned_cols=29  Identities=24%  Similarity=0.612  Sum_probs=24.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|+.+|.+|..+  ..+.++..||||++++|
T Consensus       237 ~l~~~p~~Rpt~--~~~~~~l~~~~~~~~~~  265 (265)
T cd05579         237 LLVPDPEKRLGA--KSIEEIKNHPFFKGIDW  265 (265)
T ss_pred             HhcCCHhhcCCC--ccHHHHhcCccccCCCC
Confidence            467899999863  56799999999999999


No 82 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=96.02  E-value=0.0038  Score=40.54  Aligned_cols=27  Identities=15%  Similarity=0.208  Sum_probs=23.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|+.+|.+|+.     +.++.+||||.++.+.
T Consensus       271 mL~~dp~~R~s-----~~~~l~h~~f~~~~~~  297 (303)
T cd07869         271 LLQCFPKNRLS-----AQAALSHEYFSDLPPR  297 (303)
T ss_pred             HhccCchhccC-----HHHHhcCcccccCChh
Confidence            47889999984     7999999999998863


No 83 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=94.81  E-value=0.019  Score=41.26  Aligned_cols=27  Identities=11%  Similarity=0.075  Sum_probs=24.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|++||.+|+     .+.++.+||||.+.++.
T Consensus       433 mL~~dP~kR~-----ta~e~L~Hpff~~~~~~  459 (566)
T PLN03225        433 MMRFKGRQRI-----SAKAALAHPYFDREGLL  459 (566)
T ss_pred             HccCCcccCC-----CHHHHhCCcCcCCCCcc
Confidence            6889999998     47999999999998885


No 84 
>PTZ00284 protein kinase; Provisional
Probab=94.24  E-value=0.027  Score=39.13  Aligned_cols=23  Identities=13%  Similarity=0.163  Sum_probs=20.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|+.||.+|+     .+.++..||||..
T Consensus       421 mL~~dP~~R~-----ta~e~L~Hp~~~~  443 (467)
T PTZ00284        421 LLHYDRQKRL-----NARQMTTHPYVLK  443 (467)
T ss_pred             hCCcChhhCC-----CHHHHhcCccccc
Confidence            5889999999     4799999999974


No 85 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=94.15  E-value=0.028  Score=39.62  Aligned_cols=31  Identities=13%  Similarity=0.105  Sum_probs=25.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhc
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYY   37 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~   37 (82)
                      +|+.||.+|.     ++.++..||||.+.+.+.+..
T Consensus       437 mL~~DP~~Rp-----sa~elL~hp~f~~~~~~~~~~  467 (501)
T PHA03210        437 MLTFDWHLRP-----GAAELLALPLFSAEEEEEILF  467 (501)
T ss_pred             HhccCcccCc-----CHHHHhhChhhhcCCchHHHH
Confidence            4788999998     479999999999988776543


No 86 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=94.12  E-value=0.027  Score=38.19  Aligned_cols=30  Identities=13%  Similarity=-0.047  Sum_probs=26.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVY   36 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~   36 (82)
                      +|+.+|.+|.     .+.++..||||....|+.+.
T Consensus       358 ml~~dp~~Rp-----sa~e~l~~p~f~~~~~~~~~  387 (392)
T PHA03207        358 MLTFDQEFRP-----SAQDILSLPLFTKEPINLLN  387 (392)
T ss_pred             HhccChhhCC-----CHHHHhhCchhhccchhhhc
Confidence            4778999997     47999999999999998774


No 87 
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=93.86  E-value=0.037  Score=35.80  Aligned_cols=25  Identities=12%  Similarity=0.252  Sum_probs=21.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|+     .+.+|.+|+||..+.
T Consensus       269 ml~~dp~~R~-----t~~eil~h~~f~~~~  293 (301)
T cd07873         269 LLQFEGRKRI-----SAEEAMKHPYFHCLG  293 (301)
T ss_pred             HhcCCcccCc-----CHHHHhcCccccccc
Confidence            5788999998     479999999997654


No 88 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=93.82  E-value=0.029  Score=37.45  Aligned_cols=22  Identities=9%  Similarity=0.193  Sum_probs=19.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|+.||.+|+     .+.++.+||||.
T Consensus       301 mL~~dP~~R~-----t~~e~L~hp~~~  322 (364)
T cd07875         301 MLVIDASKRI-----SVDEALQHPYIN  322 (364)
T ss_pred             hcCcCcccCC-----CHHHHhcCcccc
Confidence            4788999998     479999999997


No 89 
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=93.72  E-value=0.037  Score=36.24  Aligned_cols=26  Identities=15%  Similarity=0.155  Sum_probs=22.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|+.+|.+|.     .+.++.+||||+++..
T Consensus       273 ~l~~~P~~Rp-----t~~e~l~hp~f~~~~~  298 (338)
T cd07859         273 LLAFDPKDRP-----TAEEALADPYFKGLAK  298 (338)
T ss_pred             HcCcCcccCC-----CHHHHhcCchhhhcCc
Confidence            4788999997     4799999999987665


No 90 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=93.59  E-value=0.036  Score=36.08  Aligned_cols=24  Identities=13%  Similarity=0.351  Sum_probs=20.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|+     .+.++..|+||.++
T Consensus       269 ~L~~dp~~R~-----t~~e~l~h~~~~~~  292 (309)
T cd07872         269 FLQYESKKRI-----SAEEAMKHAYFRSL  292 (309)
T ss_pred             hccCChhhCC-----CHHHHhcChhhhhc
Confidence            5788999998     47999999999754


No 91 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=93.47  E-value=0.024  Score=39.24  Aligned_cols=26  Identities=4%  Similarity=-0.116  Sum_probs=22.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|+++|.+|+.     +.++..||||..+..
T Consensus       334 ~L~~dP~~R~t-----a~e~l~hp~f~~~~~  359 (440)
T PTZ00036        334 FLKYEPLKRLN-----PIEALADPFFDDLRD  359 (440)
T ss_pred             HCCCChhHCcC-----HHHHhCChhHHhhhc
Confidence            58899999994     799999999986654


No 92 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=93.18  E-value=0.1  Score=34.99  Aligned_cols=27  Identities=15%  Similarity=0.090  Sum_probs=22.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|+.||.+|+.     +.++..||||.+..+.
T Consensus       271 mL~~dP~~R~t-----~~e~l~hp~~~~~~~~  297 (372)
T cd07853         271 MLVFDPDKRIS-----AADALAHPYLDEGRLR  297 (372)
T ss_pred             hCCCChhhCcC-----HHHHhcCHhhCCCcch
Confidence            57889999984     7999999999987543


No 93 
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=92.90  E-value=0.061  Score=34.59  Aligned_cols=30  Identities=17%  Similarity=0.147  Sum_probs=25.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVY   36 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~   36 (82)
                      +|..+|.+|.     .+.+|..||||..++|....
T Consensus       252 ~l~~~p~~Rp-----~~~~il~~~~~~~~~~~~~~  281 (292)
T cd06644         252 ALDKHPETRP-----SAAQLLEHPFVSSVTSNRPL  281 (292)
T ss_pred             HhcCCcccCc-----CHHHHhcCccccccccchhH
Confidence            3678999997     47899999999999998743


No 94 
>KOG0615|consensus
Probab=92.73  E-value=0.053  Score=38.13  Aligned_cols=26  Identities=27%  Similarity=0.401  Sum_probs=22.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      ||..||.+|.     .++|..+||||+.+.-
T Consensus       420 mL~VdP~~R~-----s~~eaL~hpW~~~~~~  445 (475)
T KOG0615|consen  420 MLVVDPENRP-----SADEALNHPWFKDAPC  445 (475)
T ss_pred             hhEeCcccCc-----CHHHHhcChhhhcccc
Confidence            6889999997     4799999999998774


No 95 
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=92.32  E-value=0.06  Score=34.43  Aligned_cols=29  Identities=14%  Similarity=0.160  Sum_probs=23.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDV   35 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l   35 (82)
                      .|.++|.+|.     ++++|..|+||....|...
T Consensus       250 ~l~~~p~~Rp-----t~~~i~~~~~~~~~~~~~~  278 (288)
T cd06616         250 CLIKDESKRP-----KYKELLEHPFIKDYEERNV  278 (288)
T ss_pred             HccCChhhCc-----CHHHHhcChhhhchhhcch
Confidence            3678999998     4799999999998777654


No 96 
>KOG0585|consensus
Probab=92.08  E-value=0.047  Score=39.08  Aligned_cols=22  Identities=23%  Similarity=0.392  Sum_probs=19.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      ||+|||.+|+.     ..+||.|||-.
T Consensus       355 lL~KdP~~Ri~-----l~~ik~Hpwvt  376 (576)
T KOG0585|consen  355 LLEKDPEQRIT-----LPDIKLHPWVT  376 (576)
T ss_pred             HhhcChhheee-----hhhheecceec
Confidence            79999999995     68999999953


No 97 
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=91.92  E-value=0.089  Score=34.88  Aligned_cols=28  Identities=18%  Similarity=0.196  Sum_probs=23.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQD   34 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~   34 (82)
                      +|+.+|.+|+.     +.++..|+||.++....
T Consensus       280 ~l~~dP~~R~~-----~~e~l~h~~f~~~~~~~  307 (342)
T cd07879         280 MLELDVDKRLT-----ATEALEHPYFDSFRDAD  307 (342)
T ss_pred             HcCCChhhCcC-----HHHHhcCcchhhccccc
Confidence            47889999984     79999999999876543


No 98 
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=91.71  E-value=0.12  Score=33.18  Aligned_cols=30  Identities=13%  Similarity=-0.051  Sum_probs=20.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhc--CCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKR--HRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~--h~ff~~~dw   32 (82)
                      .|+.+|.+|... ..=.+.++.  ||+|+++||
T Consensus       257 ~l~~~p~~Rps~-~~ll~~l~~~~~~~~~~~~~  288 (288)
T cd05061         257 CWQFNPKMRPTF-LEIVNLLKDDLHPSFPEVSF  288 (288)
T ss_pred             HcCCChhHCcCH-HHHHHHHHhhcCCCCCCCCC
Confidence            367899999853 111223333  999999999


No 99 
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=91.56  E-value=0.095  Score=34.01  Aligned_cols=23  Identities=13%  Similarity=0.114  Sum_probs=19.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|..||.+|+     ++.++..|+||.+
T Consensus       273 ml~~dp~~R~-----t~~~il~h~~f~~  295 (309)
T cd07845         273 LLMYDPKKRA-----TAEEALESSYFKE  295 (309)
T ss_pred             HhcCChhhCc-----CHHHHhcChhhcc
Confidence            4678999998     4789999999973


No 100
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=91.19  E-value=0.14  Score=33.96  Aligned_cols=25  Identities=12%  Similarity=0.086  Sum_probs=20.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|.     .+.++..|+||..+.
T Consensus       283 ~L~~dP~~R~-----t~~ell~h~~~~~~~  307 (342)
T cd07854         283 ILTFNPMDRL-----TAEEALMHPYMSCYS  307 (342)
T ss_pred             HhCCCchhcc-----CHHHHhCCCcccccc
Confidence            4778999998     478999999998543


No 101
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=90.96  E-value=0.13  Score=34.35  Aligned_cols=23  Identities=17%  Similarity=0.229  Sum_probs=19.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|..+|.+|+     ++.++..||||..
T Consensus       298 mL~~dP~~R~-----t~~e~l~hp~~~~  320 (359)
T cd07876         298 MLVIDPDKRI-----SVDEALRHPYITV  320 (359)
T ss_pred             HhccCcccCC-----CHHHHhcCchhhh
Confidence            4788999998     4799999999973


No 102
>PHA03212 serine/threonine kinase US3; Provisional
Probab=90.90  E-value=0.11  Score=35.44  Aligned_cols=24  Identities=8%  Similarity=0.018  Sum_probs=20.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.||.+|+     .+.++..||||..+
T Consensus       359 mL~~dP~~Rp-----ta~elL~hp~f~~~  382 (391)
T PHA03212        359 MLAFDAHHRP-----SAEALLDFAAFQDI  382 (391)
T ss_pred             HhcCChhhCC-----CHHHHhcChhhccC
Confidence            4788999997     47999999999753


No 103
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=90.86  E-value=0.14  Score=33.79  Aligned_cols=25  Identities=16%  Similarity=0.226  Sum_probs=20.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|+     ++.++..||||....
T Consensus       281 mL~~dp~~R~-----s~~ell~hp~~~~~~  305 (343)
T cd07878         281 MLVLDSDKRI-----SASEALAHPYFSQYH  305 (343)
T ss_pred             HcCCChhhCC-----CHHHHhcCcchhccC
Confidence            4778999998     479999999997643


No 104
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=90.85  E-value=0.12  Score=34.41  Aligned_cols=24  Identities=13%  Similarity=0.198  Sum_probs=20.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|+.     +.++..|+||..+
T Consensus       281 ~l~~dP~~R~t-----~~~~l~~~~~~~~  304 (343)
T cd07880         281 MLVLDAESRIT-----AAEALAHPYFEEF  304 (343)
T ss_pred             HcCCChhhCCC-----HHHHhcCccHhhh
Confidence            47789999984     6899999999855


No 105
>KOG0603|consensus
Probab=90.03  E-value=0.095  Score=38.26  Aligned_cols=22  Identities=23%  Similarity=0.339  Sum_probs=19.1

Q ss_pred             CCCCCCccccCCCCCCCHHHHhcCCCC
Q psy8369           1 MARTKLRDNQFLKLRNGADDVKRHRWF   27 (82)
Q Consensus         1 ~lL~~~p~~RLG~~~~~~~~ik~h~ff   27 (82)
                      +||+.+|.+||+     +.+|..|+||
T Consensus       545 ~LL~~dP~~Rl~-----~~~i~~h~w~  566 (612)
T KOG0603|consen  545 QLLQVDPALRLG-----ADEIGAHPWF  566 (612)
T ss_pred             HhccCChhhCcC-----hhhhccCcch
Confidence            489999999996     5788889988


No 106
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=89.98  E-value=0.11  Score=33.47  Aligned_cols=25  Identities=16%  Similarity=0.209  Sum_probs=20.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|.     .+.++..|+||.+++
T Consensus       267 ~l~~~P~~Rp-----s~~~~l~~~~~~~~~  291 (294)
T PLN00009        267 MLRLDPSKRI-----TARAALEHEYFKDLG  291 (294)
T ss_pred             HccCChhhCc-----CHHHHhcCchHhHHh
Confidence            4778999997     478999999998654


No 107
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=89.66  E-value=0.15  Score=33.11  Aligned_cols=25  Identities=16%  Similarity=0.278  Sum_probs=20.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|.     .+.++..||||+.+.
T Consensus       278 ~l~~~P~~Rp-----t~~~ll~~p~~~~~~  302 (314)
T cd08216         278 CLQRDPESRP-----SASQLLNHSFFKQCK  302 (314)
T ss_pred             HhhcCCCcCc-----CHHHHhcCchHhhhc
Confidence            4778999998     479999999998553


No 108
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=89.61  E-value=0.15  Score=33.55  Aligned_cols=24  Identities=21%  Similarity=0.338  Sum_probs=20.4

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      |+.||.+|.     .++++.+||||+.+.
T Consensus       291 l~~dP~~Rp-----t~~ell~~p~f~~~~  314 (327)
T cd08227         291 LQRNPDARP-----SASTLLNHSFFKQIK  314 (327)
T ss_pred             HhhCchhcC-----CHHHHhcChhhhhcc
Confidence            678999998     479999999998754


No 109
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=89.42  E-value=0.15  Score=33.73  Aligned_cols=24  Identities=4%  Similarity=0.106  Sum_probs=20.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|+     ++.++.+|+||..+
T Consensus       274 ~l~~~P~~Rp-----s~~ell~h~~~~~~  297 (337)
T cd07858         274 MLVFDPSKRI-----TVEEALAHPYLASL  297 (337)
T ss_pred             HhcCChhhcc-----CHHHHHcCcchhhh
Confidence            3678999998     47999999999854


No 110
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=89.30  E-value=0.31  Score=32.47  Aligned_cols=24  Identities=8%  Similarity=0.162  Sum_probs=20.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     .+.+|..|+||.+-
T Consensus       311 ~l~~~P~~Rp-----t~~ell~hp~~~~~  334 (353)
T PLN00034        311 CLQREPAKRW-----SAMQLLQHPFILRA  334 (353)
T ss_pred             HccCChhhCc-----CHHHHhcCcccccC
Confidence            4778999998     47999999999864


No 111
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=89.10  E-value=0.14  Score=33.76  Aligned_cols=26  Identities=12%  Similarity=0.074  Sum_probs=21.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      .|..||.+|.     .+.+|..|+||.....
T Consensus       284 ~L~~~P~~Rp-----t~~ell~h~~~~~~~~  309 (331)
T cd06649         284 CLIKNPAERA-----DLKMLMNHTFIKRSEV  309 (331)
T ss_pred             HccCCcccCC-----CHHHHhcChHHhhccc
Confidence            4788999997     5799999999976543


No 112
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=89.08  E-value=0.26  Score=32.42  Aligned_cols=24  Identities=17%  Similarity=0.210  Sum_probs=20.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|+     .++++..|+||.+.
T Consensus       296 ~l~~~P~~R~-----s~~~~l~~~~~~~~  319 (335)
T PTZ00024        296 LLKLNPLERI-----SAKEALKHEYFKSD  319 (335)
T ss_pred             HcCCCchhcc-----CHHHHhcCcccCCC
Confidence            4778999998     47999999999844


No 113
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=88.79  E-value=0.32  Score=32.28  Aligned_cols=23  Identities=13%  Similarity=0.135  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      .|+.+|.+|.     ++.+|..||||..
T Consensus       281 ~l~~~P~~Rp-----t~~ell~h~~~~~  303 (343)
T cd07851         281 MLVLDPDKRI-----TAAEALAHPYLAE  303 (343)
T ss_pred             hCCCChhhCC-----CHHHHhcCCCccc
Confidence            3778999997     4789999999984


No 114
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=88.47  E-value=0.26  Score=32.76  Aligned_cols=22  Identities=9%  Similarity=0.176  Sum_probs=19.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|+.||.+|+     .+.++..||||.
T Consensus       294 mL~~dP~~Rp-----s~~ell~hp~~~  315 (355)
T cd07874         294 MLVIDPAKRI-----SVDEALQHPYIN  315 (355)
T ss_pred             HhcCCchhcC-----CHHHHhcCcchh
Confidence            4778999998     479999999997


No 115
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=88.30  E-value=0.2  Score=31.81  Aligned_cols=27  Identities=11%  Similarity=0.027  Sum_probs=22.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|..+|.+|+     ...+|..|+||.....+
T Consensus       244 ~l~~~p~~Rp-----~~~~il~~~~~~~~~~~  270 (283)
T cd06617         244 CLKKNYKERP-----NYPELLQHPFFELHLSK  270 (283)
T ss_pred             HccCChhhCc-----CHHHHhcCchhhhcccc
Confidence            4778999998     46999999999976654


No 116
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=88.21  E-value=0.3  Score=32.18  Aligned_cols=24  Identities=8%  Similarity=0.116  Sum_probs=20.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|+     ++.++..||||..+
T Consensus       275 ~l~~dP~~Rp-----t~~e~l~hp~~~~~  298 (336)
T cd07849         275 MLTFNPHKRI-----TVEEALAHPYLEQY  298 (336)
T ss_pred             HcCCChhhCc-----CHHHHhcCcccccc
Confidence            4788999998     47899999999843


No 117
>KOG0671|consensus
Probab=87.53  E-value=0.23  Score=34.66  Aligned_cols=24  Identities=8%  Similarity=0.076  Sum_probs=20.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|.-||++|+     .+.|+..||||...
T Consensus       389 mL~fDP~~Ri-----Tl~EAL~HpFF~~~  412 (415)
T KOG0671|consen  389 MLEFDPARRI-----TLREALSHPFFARL  412 (415)
T ss_pred             HHccCccccc-----cHHHHhcCHHhhcC
Confidence            4778999999     46899999999853


No 118
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=87.02  E-value=0.36  Score=31.00  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=20.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|..+|.+|.     .+.+|..|+||.+.
T Consensus       265 ~l~~~P~~R~-----s~~e~l~~~~~~~~  288 (298)
T cd07841         265 LLTLNPNKRI-----TARQALEHPYFSND  288 (298)
T ss_pred             HhcCCcccCc-----CHHHHhhCccccCC
Confidence            3678999997     47999999999854


No 119
>KOG0583|consensus
Probab=86.69  E-value=0.34  Score=33.26  Aligned_cols=24  Identities=13%  Similarity=0.248  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|+     ...+|..|+||+.-
T Consensus       258 mL~~~P~~R~-----t~~~i~~h~w~~~~  281 (370)
T KOG0583|consen  258 MLVPDPSTRI-----TLLEILEHPWFQKE  281 (370)
T ss_pred             HcCCCcccCC-----CHHHHhhChhhccC
Confidence            5788999998     47999999999953


No 120
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=86.59  E-value=0.43  Score=30.47  Aligned_cols=25  Identities=8%  Similarity=0.166  Sum_probs=20.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|.++|.+|+     .++++..|+||...+
T Consensus       236 ~l~~~P~~Rp-----~~~eil~~~~~~~~~  260 (279)
T cd06619         236 CMRKQPKERP-----APENLMDHPFIVQYN  260 (279)
T ss_pred             HhhCChhhCC-----CHHHHhcCccccccc
Confidence            4678999998     479999999998654


No 121
>KOG0599|consensus
Probab=86.51  E-value=0.21  Score=33.94  Aligned_cols=24  Identities=13%  Similarity=0.151  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      ||+.||++|+.     +++..+||||..+
T Consensus       266 lLqVdp~~Rit-----ake~LaHpff~q~  289 (411)
T KOG0599|consen  266 LLQVDPTKRIT-----AKEALAHPFFIQI  289 (411)
T ss_pred             HHeeCchhccc-----HHHHhcChHHHHH
Confidence            68899999994     6999999999633


No 122
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=85.99  E-value=0.47  Score=30.17  Aligned_cols=27  Identities=15%  Similarity=0.136  Sum_probs=22.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|..+|.+|.     ++.+|.+|+||.+....
T Consensus       245 ~l~~~p~~Rp-----s~~~il~~~~~~~~~~~  271 (280)
T cd06611         245 CLVKDPDDRP-----TAAELLKHPFVSDQSDN  271 (280)
T ss_pred             HhccChhhCc-----CHHHHhcChhhcccchh
Confidence            3678999997     47899999999987544


No 123
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=85.92  E-value=0.41  Score=31.79  Aligned_cols=23  Identities=17%  Similarity=0.190  Sum_probs=19.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|+.+|.+|+.     +.++..|+||..
T Consensus       283 ~L~~dp~~R~t-----~~e~l~h~~f~~  305 (345)
T cd07877         283 MLVLDSDKRIT-----AAQALAHAYFAQ  305 (345)
T ss_pred             HcCCChhhcCC-----HHHHhcChhhhh
Confidence            46789999984     689999999984


No 124
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=85.69  E-value=0.41  Score=31.51  Aligned_cols=24  Identities=4%  Similarity=0.073  Sum_probs=20.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|..     +.++..||||.+.
T Consensus       277 ~l~~~P~~Rpt-----~~~~l~~~~~~~~  300 (334)
T cd07855         277 MLQFDPEERIT-----VEQALQHPFLAQY  300 (334)
T ss_pred             HccCChhhCcC-----HHHHHhChhhhhc
Confidence            47889999984     7899999999743


No 125
>KOG0604|consensus
Probab=85.58  E-value=0.34  Score=33.19  Aligned_cols=23  Identities=13%  Similarity=0.332  Sum_probs=20.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      ||+.+|++||     ...+++.|||...
T Consensus       305 LLkt~PteRl-----TI~~~m~hpwi~~  327 (400)
T KOG0604|consen  305 LLKTEPTERL-----TIEEVMDHPWINQ  327 (400)
T ss_pred             HhcCCchhhe-----eHHHhhcCchhcc
Confidence            7889999999     4799999999763


No 126
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=85.55  E-value=0.33  Score=31.74  Aligned_cols=24  Identities=13%  Similarity=0.147  Sum_probs=20.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|.++|.+|.     .+.++..|+||.++
T Consensus       272 ~l~~~P~~Rp-----t~~~ll~~~~~~~~  295 (330)
T cd07834         272 MLVFDPKKRI-----TADEALAHPYLAQL  295 (330)
T ss_pred             HccCChhhCC-----CHHHHHhCccHHhh
Confidence            4778999998     47899999999853


No 127
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=85.37  E-value=0.33  Score=32.15  Aligned_cols=24  Identities=13%  Similarity=0.095  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|++||.+|.     .+.++..|+||+..
T Consensus       282 ~L~~~P~~Rp-----t~~ell~h~~~~~~  305 (333)
T cd06650         282 CLIKNPAERA-----DLKQLMVHAFIKRS  305 (333)
T ss_pred             hccCCcccCc-----CHHHHhhCHHHhcC
Confidence            4789999997     47999999999754


No 128
>KOG0593|consensus
Probab=85.10  E-value=0.23  Score=34.06  Aligned_cols=24  Identities=17%  Similarity=0.347  Sum_probs=20.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|..||.+|+.|     +++..|++|.++
T Consensus       267 cL~~dP~~R~sc-----~qll~H~yFd~~  290 (396)
T KOG0593|consen  267 CLKMDPDDRLSC-----EQLLHHPYFDGF  290 (396)
T ss_pred             HhcCCccccccH-----HHHhcChHHHHH
Confidence            378999999964     899999999643


No 129
>KOG0575|consensus
Probab=85.09  E-value=0.43  Score=34.87  Aligned_cols=22  Identities=23%  Similarity=0.267  Sum_probs=19.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      ||.++|.+|.     .+++|..|+||+
T Consensus       252 lL~~~P~~Rp-----sl~~vL~h~Ff~  273 (592)
T KOG0575|consen  252 LLRPNPSERP-----SLDEVLDHPFFK  273 (592)
T ss_pred             HhcCCcccCC-----CHHHHhcCHhhh
Confidence            6899999998     479999999993


No 130
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=84.97  E-value=0.48  Score=30.84  Aligned_cols=23  Identities=13%  Similarity=0.247  Sum_probs=19.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      .|..+|.+|.     .+.+|.+|+||.+
T Consensus       270 ~l~~~P~~Rp-----t~~~ll~~~~~~~  292 (308)
T cd06615         270 CLKKNPKERA-----DLKELTKHPFIKR  292 (308)
T ss_pred             HccCChhhCc-----CHHHHhcChhhhh
Confidence            4678999997     4799999999975


No 131
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=84.75  E-value=0.44  Score=31.69  Aligned_cols=22  Identities=14%  Similarity=0.252  Sum_probs=19.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|+.||.+|+     .+.++..||||.
T Consensus       294 ~L~~dP~~R~-----t~~eiL~~~~~~  315 (353)
T cd07850         294 MLVIDPEKRI-----SVDDALQHPYIN  315 (353)
T ss_pred             HcCCChhhCc-----CHHHHhcChhHh
Confidence            4778999998     479999999998


No 132
>KOG0581|consensus
Probab=84.75  E-value=0.41  Score=33.01  Aligned_cols=23  Identities=17%  Similarity=0.180  Sum_probs=19.9

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      |+|||.+|.     ++.++.+|||++..
T Consensus       319 L~Kdp~~R~-----s~~qLl~Hpfi~~~  341 (364)
T KOG0581|consen  319 LRKDPSERP-----SAKQLLQHPFIKKF  341 (364)
T ss_pred             hcCCcccCC-----CHHHHhcCHHHhhc
Confidence            789999997     57999999998754


No 133
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=84.52  E-value=0.19  Score=33.08  Aligned_cols=23  Identities=17%  Similarity=0.257  Sum_probs=19.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      .|+.+|.+|.     .+.++.+|+||..
T Consensus       291 ~l~~dP~~Rp-----ta~e~l~~~~~~~  313 (328)
T cd08226         291 CLQQDPEKRP-----SASSLLSHAFFKQ  313 (328)
T ss_pred             HccCCcccCC-----CHHHHhhCHHHHH
Confidence            4778999997     4799999999863


No 134
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=84.45  E-value=0.69  Score=29.65  Aligned_cols=24  Identities=21%  Similarity=0.219  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|..+|.+|.     ++.+|..|+||...
T Consensus       249 ~l~~~p~~Rp-----t~~eil~~~~~~~~  272 (287)
T cd06621         249 CLEKDPTRRP-----TPWDMLEHPWIKAQ  272 (287)
T ss_pred             HcCCCcccCC-----CHHHHHhCcccccc
Confidence            3678999997     47899999999654


No 135
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=84.32  E-value=0.6  Score=30.85  Aligned_cols=22  Identities=9%  Similarity=0.101  Sum_probs=18.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      .|+.+|.+|.     .+.++..|+||.
T Consensus       271 ~l~~~P~~R~-----t~~ell~~~~~~  292 (328)
T cd07856         271 MLVFDPQKRI-----SAAEALAHPYLA  292 (328)
T ss_pred             HcCCChhhCC-----CHHHHhcCCccc
Confidence            3678899998     478999999995


No 136
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=83.76  E-value=0.61  Score=29.54  Aligned_cols=25  Identities=16%  Similarity=0.276  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|..+|.+|+     ++.+|..|+||.+..
T Consensus       234 ~l~~~p~~Rp-----t~~~il~~~~~~~~~  258 (274)
T cd06609         234 CLNKDPKERP-----SAKELLKHKFIKKAK  258 (274)
T ss_pred             HhhCChhhCc-----CHHHHhhChhhcCCC
Confidence            3678999997     479999999998654


No 137
>KOG0665|consensus
Probab=83.11  E-value=0.63  Score=31.98  Aligned_cols=36  Identities=19%  Similarity=0.272  Sum_probs=26.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChHHHhcCcCCCCeec
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQDVYYRRQKPPIVP   46 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~l~~~~~~pp~~P   46 (82)
                      +|..+|++|+     .++++.+||+++  -|  .-...+.+|..+
T Consensus       293 MLvi~pe~Ri-----sv~daL~HPY~~--vw--~~~~ev~ap~pe  328 (369)
T KOG0665|consen  293 MLVIDPEKRI-----SVDDALRHPYIK--VW--YDPDEVEAPPPE  328 (369)
T ss_pred             hhccChhhcc-----cHHHHhcCCeee--ee--cccccccCCCCc
Confidence            4778999998     489999999998  56  333555554444


No 138
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=82.82  E-value=0.76  Score=30.23  Aligned_cols=22  Identities=5%  Similarity=0.114  Sum_probs=18.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|+.+|.+|+     ++.++..|||+.
T Consensus       275 ~l~~~P~~R~-----t~~~ll~~~~~~  296 (332)
T cd07857         275 LLAFDPTKRI-----SVEEALEHPYLA  296 (332)
T ss_pred             HccCCcccCC-----CHHHHhcChhhh
Confidence            4778999998     478999999985


No 139
>KOG0597|consensus
Probab=82.71  E-value=0.39  Score=35.53  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      ||.|||.+||     ...++..|||.++
T Consensus       234 LL~kdP~~Rl-----tW~~Ll~HpF~k~  256 (808)
T KOG0597|consen  234 LLIKDPAQRL-----TWTDLLGHPFWKG  256 (808)
T ss_pred             HhhcChhhcc-----cHHHHhcChHHhh
Confidence            7999999999     4789999999875


No 140
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=81.93  E-value=0.69  Score=29.93  Aligned_cols=24  Identities=13%  Similarity=0.171  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     .+.+|..|+||...
T Consensus       255 ~l~~~P~~Rp-----t~~~il~~~~~~~~  278 (292)
T cd06658         255 MLVREPSQRA-----TAQELLQHPFLKLA  278 (292)
T ss_pred             HccCChhHCc-----CHHHHhhChhhhcc
Confidence            4678999997     47999999999743


No 141
>KOG0582|consensus
Probab=81.36  E-value=0.61  Score=33.35  Aligned_cols=26  Identities=19%  Similarity=0.216  Sum_probs=21.6

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      |++||++|-     .+.++..|+||+..--.
T Consensus       277 L~kDP~kRp-----tAskLlkh~FFk~~k~~  302 (516)
T KOG0582|consen  277 LVKDPSKRP-----TASKLLKHAFFKKAKSK  302 (516)
T ss_pred             hhcCcccCC-----CHHHHhccHHHhhccch
Confidence            789999996     57999999999976433


No 142
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=81.20  E-value=0.81  Score=28.97  Aligned_cols=25  Identities=12%  Similarity=0.417  Sum_probs=20.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      .|+.+|.+|+     .+.+|..|+||+...
T Consensus       238 ~l~~~p~~R~-----~~~~il~~~~~~~~~  262 (277)
T cd06917         238 CLDEEPKERL-----SAEELLKSKWIKAHS  262 (277)
T ss_pred             HcCCCcccCc-----CHHHHhhChHhhccc
Confidence            3678999998     478999999997543


No 143
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=80.83  E-value=0.88  Score=29.01  Aligned_cols=24  Identities=13%  Similarity=0.264  Sum_probs=19.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     ++.++..|+||...
T Consensus       245 ~l~~~p~~Rp-----~~~~l~~~~~~~~~  268 (286)
T cd06622         245 CLNKIPNRRP-----TYAQLLEHPWLVKY  268 (286)
T ss_pred             HcccCcccCC-----CHHHHhcChhhhhc
Confidence            3678999997     47899999998643


No 144
>KOG0588|consensus
Probab=80.62  E-value=0.97  Score=33.87  Aligned_cols=26  Identities=8%  Similarity=0.190  Sum_probs=21.7

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      |..||++|+     ..++|..|||..+..-.
T Consensus       247 l~VDp~~Ri-----T~~eI~kHP~l~g~~~~  272 (786)
T KOG0588|consen  247 LDVDPSTRI-----TTEEILKHPFLSGYTSL  272 (786)
T ss_pred             hccCccccc-----cHHHHhhCchhhcCCCC
Confidence            678999999     47999999998876543


No 145
>KOG0032|consensus
Probab=80.56  E-value=1.3  Score=30.72  Aligned_cols=24  Identities=17%  Similarity=0.286  Sum_probs=20.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|+.     +.++..|||..+.
T Consensus       276 ll~~dp~~R~t-----a~~~L~HpWi~~~  299 (382)
T KOG0032|consen  276 LLEFDPRKRLT-----AAQALQHPWIKSI  299 (382)
T ss_pred             hcccCcccCCC-----HHHHhcCccccCC
Confidence            68899999984     7899999997754


No 146
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=80.34  E-value=0.96  Score=28.82  Aligned_cols=23  Identities=13%  Similarity=0.192  Sum_probs=19.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|..+|.+|.     .+.+|.+|+||..
T Consensus       245 ~l~~~p~~Rp-----~~~~il~~~~~~~  267 (282)
T cd06643         245 CLEKNVDARW-----TTTQLLQHPFVTV  267 (282)
T ss_pred             HccCChhhCc-----CHHHHhcCCCEec
Confidence            4778999997     4789999999874


No 147
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=79.82  E-value=1.1  Score=28.92  Aligned_cols=23  Identities=17%  Similarity=0.130  Sum_probs=19.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|..+|.+|.     .+.+|..||||..
T Consensus       252 ~l~~~p~~Rp-----s~~~il~~~~~~~  274 (297)
T cd06656         252 CLEMDVDRRG-----SAKELLQHPFLKL  274 (297)
T ss_pred             HccCChhhCc-----CHHHHhcCchhcc
Confidence            4678999996     4799999999974


No 148
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=77.94  E-value=1.1  Score=29.49  Aligned_cols=24  Identities=8%  Similarity=0.127  Sum_probs=20.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|+.+|.+|+     .+.++..|+|+..+
T Consensus       278 ~l~~~P~~Rp-----s~~~il~~~~~~~~  301 (337)
T cd07852         278 LLVFNPNKRL-----TAEEALEHPYVAQF  301 (337)
T ss_pred             hccCCccccc-----CHHHHhhChhhhhh
Confidence            3678999998     47899999999875


No 149
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=76.92  E-value=1  Score=29.06  Aligned_cols=25  Identities=12%  Similarity=0.106  Sum_probs=20.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|..+|.+|.     .+.+|..|+||....
T Consensus       252 ~l~~~p~~Rp-----~~~~il~h~~~~~~~  276 (293)
T cd06647         252 CLEMDVEKRG-----SAKELLQHPFLKIAK  276 (293)
T ss_pred             HccCChhhCc-----CHHHHhcCHHHhcCc
Confidence            3678899997     479999999997544


No 150
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=76.67  E-value=1.1  Score=29.05  Aligned_cols=23  Identities=9%  Similarity=0.137  Sum_probs=18.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      .|..+|.+|.     .+.++..|+||..
T Consensus       253 ~l~~~P~~R~-----~~~~ll~~~~~~~  275 (292)
T cd06657         253 LLVRDPAQRA-----TAAELLKHPFLAK  275 (292)
T ss_pred             HHhCCcccCc-----CHHHHhcChHHhc
Confidence            3678899997     4789999999973


No 151
>KOG1027|consensus
Probab=76.47  E-value=2.3  Score=32.58  Aligned_cols=25  Identities=24%  Similarity=0.106  Sum_probs=20.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|+.+|..|.     .+.+|..||||.  +|+
T Consensus       750 ml~~dP~~RP-----sa~~VL~HPlFW--~~e  774 (903)
T KOG1027|consen  750 MLNPDPQLRP-----SATDVLNHPLFW--DSE  774 (903)
T ss_pred             hcCCCcccCC-----CHHHHhCCCccC--ChH
Confidence            5788999997     479999999996  555


No 152
>KOG1167|consensus
Probab=75.94  E-value=1.5  Score=30.86  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=20.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|..||.+|++     +++-..||||...+
T Consensus       364 ~le~np~kRit-----AEeALkHpFF~~~~  388 (418)
T KOG1167|consen  364 CLELNPQKRIT-----AEDALKHPFFDEAD  388 (418)
T ss_pred             HccCChhhccc-----HHHHhcCcCCcchh
Confidence            58889999985     68999999999554


No 153
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=75.63  E-value=2  Score=28.04  Aligned_cols=26  Identities=12%  Similarity=0.184  Sum_probs=21.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|+.+|.+|.     .+.++..|+||...+=
T Consensus       256 ~l~~~P~~Rp-----~~~~~l~~~~~~~~~~  281 (313)
T cd06633         256 CLQKIPQERP-----ASAELLRHDFVRRDRP  281 (313)
T ss_pred             HccCChhhCc-----CHHHHhcCcccCCCch
Confidence            4778999998     4789999999986553


No 154
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=75.55  E-value=1.9  Score=27.68  Aligned_cols=24  Identities=8%  Similarity=0.106  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     .+.+|..|+||...
T Consensus       252 ~l~~~p~~Rp-----t~~~il~~~~~~~~  275 (285)
T cd06648         252 MLVRDPAQRA-----TAAELLNHPFLAKA  275 (285)
T ss_pred             HcccChhhCc-----CHHHHccCcccccC
Confidence            3678999997     46899999999753


No 155
>KOG0662|consensus
Probab=74.16  E-value=2.4  Score=27.35  Aligned_cols=24  Identities=13%  Similarity=0.163  Sum_probs=19.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      ||.-+|.+|+.     ++.-.+||+|.+.
T Consensus       266 ll~cnp~qris-----aeaalqhpyf~d~  289 (292)
T KOG0662|consen  266 LLKCNPAQRIS-----AEAALQHPYFSDF  289 (292)
T ss_pred             HhccCcccccC-----HHHHhcCcccccc
Confidence            57778999984     6888999999864


No 156
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=73.91  E-value=1.7  Score=28.00  Aligned_cols=22  Identities=14%  Similarity=0.176  Sum_probs=19.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|..+|.+|.     +.++|..|+||.
T Consensus       256 ~l~~~p~~Rp-----~~~~il~~~~~~  277 (296)
T cd06618         256 CLTKDHRKRP-----KYRELLQHPFIR  277 (296)
T ss_pred             HccCChhhCC-----CHHHHhcChhhh
Confidence            4778999998     479999999987


No 157
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=73.66  E-value=1.5  Score=28.01  Aligned_cols=27  Identities=15%  Similarity=0.167  Sum_probs=22.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      +|..+|.+|.     .+.+|..|+||....|.
T Consensus       253 ~l~~~p~~Rp-----t~~~il~~~~~~~~~~~  279 (286)
T cd06614         253 CLVKDPEKRP-----SAEELLQHPFLKKACPK  279 (286)
T ss_pred             HhccChhhCc-----CHHHHhhChHhhccCch
Confidence            3677899996     57999999999986664


No 158
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=72.90  E-value=1.7  Score=27.69  Aligned_cols=26  Identities=12%  Similarity=0.049  Sum_probs=21.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|.++|.+|.     .+.+|..|+||.....
T Consensus       236 ~l~~~p~~Rp-----~~~~il~~~~~~~~~~  261 (277)
T cd06640         236 CLNKDPSFRP-----TAKELLKHKFIVKNAK  261 (277)
T ss_pred             HcccCcccCc-----CHHHHHhChHhhhcch
Confidence            4778999997     4799999999976554


No 159
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=72.80  E-value=1.4  Score=28.60  Aligned_cols=24  Identities=13%  Similarity=0.105  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     .+.+|..|+||...
T Consensus       252 ~l~~dp~~Rp-----t~~~il~~~~~~~~  275 (296)
T cd06655         252 CLEMDVEKRG-----SAKELLQHPFLKLA  275 (296)
T ss_pred             HhhcChhhCC-----CHHHHhhChHhhhc
Confidence            3678999997     47899999999743


No 160
>KOG0669|consensus
Probab=72.68  E-value=1.6  Score=29.55  Aligned_cols=23  Identities=17%  Similarity=0.104  Sum_probs=19.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      ||..||.+|+-     +++..+|.||..
T Consensus       298 ll~~DP~kR~~-----ad~alnh~~F~k  320 (376)
T KOG0669|consen  298 LLKLDPTKRID-----ADQALNHDFFWK  320 (376)
T ss_pred             HhccCcccCcc-----hHhhhchhhhhc
Confidence            67889999994     689999999975


No 161
>KOG0663|consensus
Probab=71.94  E-value=2.4  Score=29.59  Aligned_cols=24  Identities=21%  Similarity=0.289  Sum_probs=20.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      ||..||.+|+.     +.+-..|.||...
T Consensus       344 llt~dP~kR~t-----A~~~L~h~~F~e~  367 (419)
T KOG0663|consen  344 LLTYDPGKRIT-----AEDGLKHEYFRET  367 (419)
T ss_pred             HhccCcccccc-----HHHhhcccccccC
Confidence            68889999994     6888999999864


No 162
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=69.90  E-value=1.8  Score=27.57  Aligned_cols=24  Identities=13%  Similarity=0.155  Sum_probs=19.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     ++.++..|+||...
T Consensus       236 ~l~~~p~~Rp-----~~~~~l~~~~~~~~  259 (277)
T cd06641         236 CLNKEPSFRP-----TAKELLKHKFIVRF  259 (277)
T ss_pred             HccCChhhCc-----CHHHHHhCHHHhhh
Confidence            3678899997     47899999999753


No 163
>KOG4717|consensus
Probab=69.13  E-value=2.8  Score=31.08  Aligned_cols=27  Identities=7%  Similarity=0.220  Sum_probs=23.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      .|+++|.+|.     ..++|..|+|.+.+|=.
T Consensus       253 MLvRdPkkRA-----slEeI~s~~Wlq~~D~~  279 (864)
T KOG4717|consen  253 MLVRDPKKRA-----SLEEIVSTSWLQAGDRG  279 (864)
T ss_pred             HHhcCchhhc-----cHHHHhccccccCCCCC
Confidence            3789999997     47999999999998854


No 164
>KOG0660|consensus
Probab=68.69  E-value=2.4  Score=29.33  Aligned_cols=24  Identities=8%  Similarity=0.070  Sum_probs=20.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+-||.+|+     .+++-.+|||+...
T Consensus       293 mL~fdP~kRi-----ta~eAL~hPYl~~~  316 (359)
T KOG0660|consen  293 MLVFDPKKRI-----TAEEALAHPYLAPY  316 (359)
T ss_pred             HhccCccccC-----CHHHHhcChhhhhh
Confidence            5788999999     47999999999744


No 165
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=68.57  E-value=2.8  Score=27.13  Aligned_cols=24  Identities=13%  Similarity=0.162  Sum_probs=19.6

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|.     .+.+|..|+||...
T Consensus       254 ~l~~~P~~Rp-----s~~~ll~~~~~~~~  277 (297)
T cd06659         254 MLTREPQERA-----TAQELLDHPFLLQT  277 (297)
T ss_pred             HhcCCcccCc-----CHHHHhhChhhccC
Confidence            4678999997     47999999999744


No 166
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=67.42  E-value=4  Score=29.42  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=10.6

Q ss_pred             CHHHHhcCCCCC
Q psy8369          17 GADDVKRHRWFK   28 (82)
Q Consensus        17 ~~~~ik~h~ff~   28 (82)
                      ++.++..||||.
T Consensus       493 Sa~eaL~Hp~f~  504 (507)
T PLN03224        493 SVGQALSHRFFL  504 (507)
T ss_pred             CHHHHhCCCCcC
Confidence            579999999995


No 167
>KOG0607|consensus
Probab=67.41  E-value=1.7  Score=30.30  Aligned_cols=27  Identities=15%  Similarity=0.227  Sum_probs=22.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      ||.+++..||.     +..+.+|||+..+.-+
T Consensus       344 Llvrda~~rls-----a~~vlnhPw~~~~~~e  370 (463)
T KOG0607|consen  344 LLVRDAKQRLS-----AAQVLNHPWVQRCAPE  370 (463)
T ss_pred             HHhccHHhhhh-----hhhccCCccccccchh
Confidence            68899999994     6899999999987654


No 168
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=67.02  E-value=3.5  Score=26.61  Aligned_cols=23  Identities=13%  Similarity=0.143  Sum_probs=19.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|.++|.+|.     .+.+|..|+||..
T Consensus       253 ~l~~~p~~Rp-----t~~eil~~~~~~~  275 (296)
T cd06654         253 CLDMDVEKRG-----SAKELLQHQFLKI  275 (296)
T ss_pred             HCcCCcccCc-----CHHHHhhChhhhc
Confidence            3678999996     4799999999874


No 169
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=66.25  E-value=3.3  Score=26.40  Aligned_cols=22  Identities=9%  Similarity=-0.133  Sum_probs=18.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      +|..+|.+|.     .+.+|.+|+||.
T Consensus       249 ~l~~dp~~Rp-----t~~e~~~~~~~~  270 (284)
T cd06620         249 CLLKDPTERP-----TPQQLCAMPPFI  270 (284)
T ss_pred             HhcCCcccCc-----CHHHHhcCcccc
Confidence            3678999997     479999999885


No 170
>KOG0666|consensus
Probab=65.26  E-value=3.7  Score=28.54  Aligned_cols=25  Identities=16%  Similarity=0.090  Sum_probs=21.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      ||+.||.+|+.     +++-.+|+||...+
T Consensus       320 lL~yDP~kRIt-----a~qAleh~yF~~d~  344 (438)
T KOG0666|consen  320 LLTYDPIKRIT-----AEQALEHPYFTEDP  344 (438)
T ss_pred             HhccCchhhcc-----HHHHhcccccccCC
Confidence            68899999995     58889999998654


No 171
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=64.84  E-value=1.2  Score=28.31  Aligned_cols=27  Identities=11%  Similarity=0.096  Sum_probs=20.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCChH
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDWQ   33 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~   33 (82)
                      .|..+|.+|.     ++.+|..|+||....+.
T Consensus       236 ~l~~~p~~Rp-----~~~~il~~~~~~~~~~~  262 (277)
T cd06642         236 CLNKDPRFRP-----TAKELLKHKFITRYTKK  262 (277)
T ss_pred             HccCCcccCc-----CHHHHHHhHHHHHHhhh
Confidence            3677899997     47899999998755443


No 172
>KOG0033|consensus
Probab=64.01  E-value=3.7  Score=27.67  Aligned_cols=22  Identities=23%  Similarity=0.389  Sum_probs=18.9

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      |..||.+|+.     +.|-.+|||...
T Consensus       251 L~~dP~kRIt-----a~EAL~HpWi~~  272 (355)
T KOG0033|consen  251 LTVNPKKRIT-----ADEALKHPWICN  272 (355)
T ss_pred             hccChhhhcc-----HHHHhCCchhcc
Confidence            6789999994     789999999874


No 173
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=63.91  E-value=5  Score=26.07  Aligned_cols=24  Identities=13%  Similarity=0.221  Sum_probs=19.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|..+|.+|.     .+.+|..|+|+...
T Consensus       250 cl~~~P~~Rp-----~~~~ll~~~~~~~~  273 (308)
T cd06634         250 CLQKIPQDRP-----TSEVLLKHRFVLRE  273 (308)
T ss_pred             HhhCCcccCC-----CHHHHhhCcccccc
Confidence            3678899997     47999999999864


No 174
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=63.56  E-value=3.6  Score=26.64  Aligned_cols=22  Identities=14%  Similarity=0.370  Sum_probs=18.5

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      |..+|.+|.     ++.+|..|+||..
T Consensus       251 l~~~p~~Rp-----~~~~il~~~~~~~  272 (307)
T cd06607         251 LQKIPQDRP-----SSEELLKHRFVLR  272 (307)
T ss_pred             hcCChhhCc-----CHHHHhcChhhcc
Confidence            677899997     4799999999874


No 175
>KOG0667|consensus
Probab=62.16  E-value=4.2  Score=29.95  Aligned_cols=26  Identities=8%  Similarity=0.108  Sum_probs=21.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      +|.-||.+|+     ...+..+|||+.+...
T Consensus       485 ~L~~dP~~R~-----tp~qal~Hpfl~~~~~  510 (586)
T KOG0667|consen  485 CLEWDPAERI-----TPAQALNHPFLTGTSL  510 (586)
T ss_pred             HhccCchhcC-----CHHHHhcCcccccccc
Confidence            4778999998     4689999999996543


No 176
>KOG0579|consensus
Probab=61.30  E-value=5.8  Score=30.33  Aligned_cols=27  Identities=15%  Similarity=0.118  Sum_probs=22.5

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCChHH
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDWQD   34 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw~~   34 (82)
                      |.+||..|..     +.++..||||.+++-..
T Consensus       273 L~Knp~~Rp~-----aaqll~Hpfv~~~~SnK  299 (1187)
T KOG0579|consen  273 LVKNPRNRPP-----AAQLLKHPFVQNAPSNK  299 (1187)
T ss_pred             HhcCCccCCC-----HHHHhhCcccccCCcch
Confidence            7789999974     68999999999887653


No 177
>PLN00181 protein SPA1-RELATED; Provisional
Probab=60.22  E-value=4.7  Score=30.21  Aligned_cols=24  Identities=0%  Similarity=-0.060  Sum_probs=20.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|.     .+.+|.+||||...
T Consensus       248 ~L~~~P~~Rp-----s~~eil~h~~~~~~  271 (793)
T PLN00181        248 LLHPEPSCRP-----SMSELLQSEFINEP  271 (793)
T ss_pred             hCCCChhhCc-----ChHHHhhchhhhhh
Confidence            4788999997     46899999999753


No 178
>KOG0658|consensus
Probab=59.49  E-value=3.2  Score=28.82  Aligned_cols=24  Identities=13%  Similarity=0.140  Sum_probs=19.8

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|+.     +.++..|+||..+
T Consensus       289 ~L~Y~P~~R~~-----~~~~l~h~fFdel  312 (364)
T KOG0658|consen  289 LLQYSPSKRLS-----ALEALAHPFFDEL  312 (364)
T ss_pred             HhccChhhcCC-----HHHHhcchhhHHh
Confidence            47789999984     6899999999743


No 179
>KOG0594|consensus
Probab=57.59  E-value=6.2  Score=27.00  Aligned_cols=25  Identities=12%  Similarity=0.108  Sum_probs=20.7

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|+.     +.....|+||..+.
T Consensus       285 ~L~y~p~~R~S-----a~~al~h~yf~~~~  309 (323)
T KOG0594|consen  285 LLQYDPAKRIS-----AKGALTHPYFSELP  309 (323)
T ss_pred             HhccCcccCcC-----HHHHhcChhhcccc
Confidence            46788999984     68999999999874


No 180
>PHA03209 serine/threonine kinase US3; Provisional
Probab=56.42  E-value=7.1  Score=26.11  Aligned_cols=16  Identities=19%  Similarity=0.347  Sum_probs=13.4

Q ss_pred             CCCHHHHhcCCCCCCC
Q psy8369          15 RNGADDVKRHRWFKGV   30 (82)
Q Consensus        15 ~~~~~~ik~h~ff~~~   30 (82)
                      +..+.++.+||||+.+
T Consensus       342 Rpta~e~l~hp~f~~~  357 (357)
T PHA03209        342 RPSAEEILNYPMFAQL  357 (357)
T ss_pred             CcCHHHHhcCchhccC
Confidence            4578999999999864


No 181
>KOG0659|consensus
Probab=55.76  E-value=4.9  Score=27.20  Aligned_cols=23  Identities=22%  Similarity=0.297  Sum_probs=19.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      +|..||.+|+.     +.+...|+||++
T Consensus       264 m~~ynP~~Rit-----a~qaL~~~yf~~  286 (318)
T KOG0659|consen  264 MLTYNPKKRIT-----ASQALKHPYFKS  286 (318)
T ss_pred             hhccCchhccc-----HHHHhcchhhhc
Confidence            57789999995     589999999974


No 182
>KOG0578|consensus
Probab=49.50  E-value=7.6  Score=28.45  Aligned_cols=21  Identities=14%  Similarity=0.203  Sum_probs=18.1

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      |+.|+.+|.     .+.++.+||||+
T Consensus       507 L~~dv~~Ra-----sA~eLL~HpFl~  527 (550)
T KOG0578|consen  507 LVVDVEQRA-----SAKELLEHPFLK  527 (550)
T ss_pred             hhcchhcCC-----CHHHHhcChhhh
Confidence            778899986     579999999994


No 183
>KOG0661|consensus
Probab=48.59  E-value=10  Score=27.62  Aligned_cols=23  Identities=17%  Similarity=0.120  Sum_probs=19.2

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      ||.=||.+|.     .+.+..+||||..
T Consensus       274 ll~WDP~kRp-----TA~~al~~pffq~  296 (538)
T KOG0661|consen  274 LLAWDPDKRP-----TASQALQHPFFQV  296 (538)
T ss_pred             HhcCCCccCc-----cHHHHhcCccccc
Confidence            4667999997     5799999999984


No 184
>KOG0668|consensus
Probab=46.49  E-value=5.5  Score=26.66  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=18.9

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      ||.-|-.+||     .++|-+.||||..+
T Consensus       305 lLrYDHqeRl-----TakEam~HpyF~~~  328 (338)
T KOG0668|consen  305 LLRYDHQERL-----TAKEAMAHPYFAPV  328 (338)
T ss_pred             HHhhcccccc-----chHHHhcCchHHHH
Confidence            5667778888     46899999999754


No 185
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=45.02  E-value=11  Score=24.59  Aligned_cols=22  Identities=9%  Similarity=0.273  Sum_probs=18.1

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFK   28 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~   28 (82)
                      .|..+|.+|.     .+.+|..|+|+.
T Consensus       260 ~l~~~p~~Rp-----t~~~il~~~~~~  281 (317)
T cd06635         260 CLQKIPQDRP-----TSEELLKHMFVL  281 (317)
T ss_pred             HccCCcccCc-----CHHHHHhChhhh
Confidence            3678899997     479999999985


No 186
>KOG0590|consensus
Probab=44.23  E-value=10  Score=28.01  Aligned_cols=25  Identities=4%  Similarity=0.286  Sum_probs=21.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      +|+.+|.+|+     ..++|.+-+||+.++
T Consensus       568 ~l~~~P~~R~-----ti~~i~~d~W~~~i~  592 (601)
T KOG0590|consen  568 MLQLDPTKRI-----TIEQILNDEWIRSIE  592 (601)
T ss_pred             HccCChhhee-----cHHHHhhChHhhhcc
Confidence            4788999998     579999999998765


No 187
>KOG1290|consensus
Probab=42.65  E-value=16  Score=26.83  Aligned_cols=24  Identities=17%  Similarity=0.235  Sum_probs=19.4

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVD   31 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~d   31 (82)
                      |+-+|++|.     .+.+..+|||+..+-
T Consensus       534 Lef~PeKR~-----tA~~cl~hPwLn~~~  557 (590)
T KOG1290|consen  534 LEFDPEKRP-----TAAQCLKHPWLNPVA  557 (590)
T ss_pred             HhcCccccc-----cHHHHhcCccccCCC
Confidence            667899997     468899999998554


No 188
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=40.68  E-value=10  Score=26.93  Aligned_cols=24  Identities=4%  Similarity=-0.158  Sum_probs=19.5

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|+.+|.+|.     .+.++..|||++.+
T Consensus       280 ~L~~dP~~RP-----s~~ell~~p~~~~~  303 (496)
T PTZ00283        280 LLSSDPKRRP-----SSSKLLNMPICKLF  303 (496)
T ss_pred             HcccChhhCc-----CHHHHHhCHHHHHh
Confidence            4788999998     46899999987753


No 189
>KOG0600|consensus
Probab=39.75  E-value=18  Score=26.53  Aligned_cols=23  Identities=13%  Similarity=0.075  Sum_probs=19.4

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      ||..||.+|.     .+.+...|.||..
T Consensus       383 lL~ldP~kR~-----tA~~aL~seyF~t  405 (560)
T KOG0600|consen  383 LLSLDPDKRG-----TASSALQSEYFTT  405 (560)
T ss_pred             HhccCccccc-----cHHHHhcCccccc
Confidence            6889999997     4789999999943


No 190
>KOG0596|consensus
Probab=37.02  E-value=22  Score=26.61  Aligned_cols=25  Identities=4%  Similarity=0.090  Sum_probs=20.4

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCCCh
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGVDW   32 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~dw   32 (82)
                      |.+||.+|..     ..++.+|||...+-.
T Consensus       611 L~rdPkkR~s-----i~eLLqhpFl~~~~i  635 (677)
T KOG0596|consen  611 LARDPKKRWS-----IPELLQHPFLQIQPI  635 (677)
T ss_pred             HhcCcccCCC-----cHHHhcCcccccccc
Confidence            6789999984     689999999876443


No 191
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=35.32  E-value=24  Score=22.12  Aligned_cols=14  Identities=29%  Similarity=0.579  Sum_probs=11.7

Q ss_pred             CCCHHHHhcCCCCC
Q psy8369          15 RNGADDVKRHRWFK   28 (82)
Q Consensus        15 ~~~~~~ik~h~ff~   28 (82)
                      +.++++|..||||.
T Consensus       252 Rp~~~eil~hp~~~  265 (266)
T cd06651         252 RPSAEELLRHPFAQ  265 (266)
T ss_pred             CcCHHHHhcCcccc
Confidence            45789999999985


No 192
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=34.48  E-value=24  Score=22.36  Aligned_cols=12  Identities=17%  Similarity=0.440  Sum_probs=10.3

Q ss_pred             HHHHhcCCCCCC
Q psy8369          18 ADDVKRHRWFKG   29 (82)
Q Consensus        18 ~~~ik~h~ff~~   29 (82)
                      ++++.+|+||.+
T Consensus       256 ~~~~l~h~~~~~  267 (267)
T PHA03390        256 YNEIIKHPFLKI  267 (267)
T ss_pred             HHHHhcCCcccC
Confidence            589999999973


No 193
>KOG0201|consensus
Probab=32.79  E-value=11  Score=26.97  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=20.3

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      .|+++|..|.     .+.++..|.|.+..
T Consensus       246 CL~k~P~~Rp-----sA~~LLKh~FIk~a  269 (467)
T KOG0201|consen  246 CLDKNPEFRP-----SAKELLKHKFIKRA  269 (467)
T ss_pred             HhhcCcccCc-----CHHHHhhhHHHHhc
Confidence            5899999998     47899999998763


No 194
>PF03790 KNOX1:  KNOX1 domain ;  InterPro: IPR005540 The MEINOX region is comprised of two domains, KNOX1 and KNOX2. KNOX1 plays a role in suppressing target gene expression. KNOX2, essential for function, is thought to be necessary for homo-dimerization [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=25.64  E-value=22  Score=17.27  Aligned_cols=25  Identities=8%  Similarity=0.150  Sum_probs=15.8

Q ss_pred             HHHhcCCCCCCCChHHHhcCcCCCC
Q psy8369          19 DDVKRHRWFKGVDWQDVYYRRQKPP   43 (82)
Q Consensus        19 ~~ik~h~ff~~~dw~~l~~~~~~pp   43 (82)
                      ..|..||.|..+=-.-+..+++.+|
T Consensus         5 A~I~~HP~Y~~Ll~Ayi~C~KVGAP   29 (45)
T PF03790_consen    5 AKIASHPLYPRLLAAYIDCQKVGAP   29 (45)
T ss_pred             HHHHcCCCcHHHHHHHHHHHhcCCC
Confidence            4788999887554444555555544


No 195
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=25.14  E-value=51  Score=20.90  Aligned_cols=14  Identities=29%  Similarity=0.463  Sum_probs=11.2

Q ss_pred             CCCHHHHhcCCCCC
Q psy8369          15 RNGADDVKRHRWFK   28 (82)
Q Consensus        15 ~~~~~~ik~h~ff~   28 (82)
                      +..+.++..||||.
T Consensus       282 R~~~~eil~~~~~~  295 (295)
T cd07837         282 RISAKAALTHPYFD  295 (295)
T ss_pred             cCCHHHHhcCCCcC
Confidence            44678999999984


No 196
>KOG0198|consensus
Probab=24.98  E-value=43  Score=22.79  Aligned_cols=22  Identities=14%  Similarity=0.238  Sum_probs=18.3

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      |.++|.+|-     .+.++..|||-..
T Consensus       260 ~~~~p~~Rp-----ta~eLL~hpf~~~  281 (313)
T KOG0198|consen  260 FKRDPEKRP-----TAEELLEHPFLKQ  281 (313)
T ss_pred             hhcCcccCc-----CHHHHhhChhhhc
Confidence            678899986     5899999998764


No 197
>smart00750 KIND kinase non-catalytic C-lobe domain. It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Probab=24.90  E-value=19  Score=21.06  Aligned_cols=20  Identities=15%  Similarity=0.121  Sum_probs=15.6

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWF   27 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff   27 (82)
                      |..+|.+|.     .+.++..|+|.
T Consensus       149 l~~~p~~Rp-----~~~~ll~~~~~  168 (176)
T smart00750      149 ASRLPQRRE-----AANHYLAHCRA  168 (176)
T ss_pred             Hhccccccc-----CHHHHHHHHHH
Confidence            567889987     46889888865


No 198
>PF04663 Phenol_monoox:  Phenol hydroxylase conserved region;  InterPro: IPR006756 Under aerobic conditions, phenol is usually hydroxylated to catechol and degraded via the meta or ortho pathways. Two types of phenol hydroxylase are known: one is a multi-component enzyme the other is a single-component monooxygenase. This signature is found in both types of enzymes [, ].; PDB: 3U52_F 2INN_F 2INP_E.
Probab=23.72  E-value=22  Score=18.74  Aligned_cols=16  Identities=31%  Similarity=0.636  Sum_probs=11.0

Q ss_pred             HHhcCCCCCCCChHHH
Q psy8369          20 DVKRHRWFKGVDWQDV   35 (82)
Q Consensus        20 ~ik~h~ff~~~dw~~l   35 (82)
                      -+..||=|..|||+.+
T Consensus        49 ~~~~hPD~a~idw~~v   64 (67)
T PF04663_consen   49 AYGQHPDFAKIDWSKV   64 (67)
T ss_dssp             HHTTSTTGCC--STSS
T ss_pred             hhccCCchhhCcchhc
Confidence            4578999999999754


No 199
>KOG0983|consensus
Probab=23.71  E-value=48  Score=22.92  Aligned_cols=23  Identities=17%  Similarity=0.127  Sum_probs=18.4

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      |++|+.+|-     ...++.+|+|....
T Consensus       333 L~kd~r~RP-----~Y~~Ll~h~Fi~~y  355 (391)
T KOG0983|consen  333 LTKDHRKRP-----KYNKLLEHPFIKRY  355 (391)
T ss_pred             hhcCcccCc-----chHHHhcCcceeec
Confidence            678888886     46899999998743


No 200
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=23.52  E-value=21  Score=25.08  Aligned_cols=24  Identities=13%  Similarity=0.023  Sum_probs=19.0

Q ss_pred             CCCCCccccCCCCCCCHHHHhcCCCCCCC
Q psy8369           2 ARTKLRDNQFLKLRNGADDVKRHRWFKGV   30 (82)
Q Consensus         2 lL~~~p~~RLG~~~~~~~~ik~h~ff~~~   30 (82)
                      +|.++|.+|..     +.++..|+|++.+
T Consensus       306 ~L~~dP~~Rps-----~~~~l~~~~~~~~  329 (478)
T PTZ00267        306 LLSKNPALRPT-----TQQLLHTEFLKYV  329 (478)
T ss_pred             HhccChhhCcC-----HHHHHhCHHHHHH
Confidence            47889999984     6888899887643


No 201
>PHA03211 serine/threonine kinase US3; Provisional
Probab=23.01  E-value=56  Score=23.17  Aligned_cols=15  Identities=27%  Similarity=0.419  Sum_probs=12.4

Q ss_pred             CCCHHHHhcCCCCCC
Q psy8369          15 RNGADDVKRHRWFKG   29 (82)
Q Consensus        15 ~~~~~~ik~h~ff~~   29 (82)
                      +-.+.++.+|+||.+
T Consensus       446 RPsa~elL~hp~f~~  460 (461)
T PHA03211        446 RPSAAELLRLPLFQS  460 (461)
T ss_pred             CcCHHHHhhCcccCC
Confidence            447899999999974


No 202
>PF14623 Vint:  Hint-domain
Probab=22.79  E-value=30  Score=21.40  Aligned_cols=11  Identities=36%  Similarity=0.845  Sum_probs=10.2

Q ss_pred             HHHhcCCCCCC
Q psy8369          19 DDVKRHRWFKG   29 (82)
Q Consensus        19 ~~ik~h~ff~~   29 (82)
                      +++..|+||.+
T Consensus       118 ~dvraH~fFG~  128 (162)
T PF14623_consen  118 EDVRAHAFFGD  128 (162)
T ss_pred             CcEEeecccCc
Confidence            79999999996


No 203
>PF03720 UDPG_MGDP_dh_C:  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain;  InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]. The enzymes have a wide range of functions. In plants UDP-glucose dehydrogenase, 1.1.1.22 from EC, is an important enzyme in the synthesis of hemicellulose and pectin [], which are the components of newly formed cell walls; while in zebrafish UDP-glucose dehydrogenase is required for cardiac valve formation []. In Xanthomonas campestris, a plant pathogen, UDP-glucose dehydrogenase is required for virulence [].  GDP-mannose dehydrogenase, 1.1.1.132 from EC, catalyses the formation of GDP-mannuronic acid, which is the monomeric unit from which the exopolysaccharide alginate is formed. Alginate is secreted by a number of bacteria, which include Pseudomonas aeruginosa and Azotobacter vinelandii. In P. aeruginosa, alginate is believed to play an important role in the bacteria's resistance to antibiotics and the host immune response [], while in A. vinelandii it is essential for the encystment process []. This entry represents the C-terminal substrate-binding domain of these enzymes. Structural studies indicate that this domain forms an incomplete dinucleotide binding fold [, ].; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 3GG2_D 1DLI_A 1DLJ_A 2Y0E_D 2Y0D_B 2Y0C_D 1MV8_B 1MUU_A 1MFZ_C 3TDK_B ....
Probab=22.61  E-value=37  Score=18.87  Aligned_cols=29  Identities=24%  Similarity=0.618  Sum_probs=18.6

Q ss_pred             HhcCCCCCCCChHHHhcCcCCCCeecccC
Q psy8369          21 VKRHRWFKGVDWQDVYYRRQKPPIVPEVH   49 (82)
Q Consensus        21 ik~h~ff~~~dw~~l~~~~~~pp~~P~~~   49 (82)
                      ...|+-|+.++|+.+......++++-..+
T Consensus        73 ~t~h~~f~~l~~~~~~~~~~~~~~iiD~~  101 (106)
T PF03720_consen   73 ATDHDEFRELDWEEIAKLMRKPPVIIDGR  101 (106)
T ss_dssp             SS--GGGGCCGHHHHHHHSCSSEEEEESS
T ss_pred             EecCHHHhccCHHHHHHhcCCCCEEEECc
Confidence            36788999999998875544555554443


No 204
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=21.99  E-value=51  Score=20.40  Aligned_cols=15  Identities=20%  Similarity=0.381  Sum_probs=12.1

Q ss_pred             CCCHHHHhcCCCCCC
Q psy8369          15 RNGADDVKRHRWFKG   29 (82)
Q Consensus        15 ~~~~~~ik~h~ff~~   29 (82)
                      +.++.++..||||..
T Consensus       248 Rpt~~~ll~~~~~~~  262 (265)
T cd06605         248 RPSYKELLEHPFIKK  262 (265)
T ss_pred             CcCHHHHhhCchhhc
Confidence            457889999999964


No 205
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=21.96  E-value=62  Score=20.52  Aligned_cols=14  Identities=21%  Similarity=0.423  Sum_probs=11.1

Q ss_pred             CCCHHHHhcCCCCC
Q psy8369          15 RNGADDVKRHRWFK   28 (82)
Q Consensus        15 ~~~~~~ik~h~ff~   28 (82)
                      +.++.+|.+||||.
T Consensus       278 Rps~~~il~~~~~~  291 (291)
T cd06639         278 RPSVTHLLEHPFIK  291 (291)
T ss_pred             CcCHHHHhcCcccC
Confidence            44788999999984


No 206
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=21.73  E-value=61  Score=20.31  Aligned_cols=14  Identities=36%  Similarity=0.617  Sum_probs=11.0

Q ss_pred             CCCHHHHhcCCCCC
Q psy8369          15 RNGADDVKRHRWFK   28 (82)
Q Consensus        15 ~~~~~~ik~h~ff~   28 (82)
                      +-.+.++..||||.
T Consensus       273 R~~~~~~l~h~~~~  286 (286)
T cd07832         273 RLSAAEALRHPYFT  286 (286)
T ss_pred             CCCHHHHhhCcCcC
Confidence            44678999999983


No 207
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=20.55  E-value=40  Score=20.82  Aligned_cols=17  Identities=29%  Similarity=0.526  Sum_probs=13.4

Q ss_pred             CCCHHHHhcCCCCCCCC
Q psy8369          15 RNGADDVKRHRWFKGVD   31 (82)
Q Consensus        15 ~~~~~~ik~h~ff~~~d   31 (82)
                      +.++.+|..|||++.++
T Consensus       247 R~~~~~ll~~~~~~~~~  263 (264)
T cd06623         247 RPSAAELLQHPFIKKAD  263 (264)
T ss_pred             CCCHHHHHhCHHHHhcc
Confidence            45788999999997654


No 208
>KOG0574|consensus
Probab=20.21  E-value=32  Score=24.09  Aligned_cols=22  Identities=18%  Similarity=0.148  Sum_probs=18.2

Q ss_pred             CCCCccccCCCCCCCHHHHhcCCCCCC
Q psy8369           3 RTKLRDNQFLKLRNGADDVKRHRWFKG   29 (82)
Q Consensus         3 L~~~p~~RLG~~~~~~~~ik~h~ff~~   29 (82)
                      |.++|++|.     .+..+.+|+|.++
T Consensus       267 LiK~PE~R~-----TA~~L~~H~Fikn  288 (502)
T KOG0574|consen  267 LIKKPEERK-----TALRLCEHTFIKN  288 (502)
T ss_pred             hcCCHHHHH-----HHHHHhhhhhhcC
Confidence            678899996     4689999999875


Done!