Diaphorina citri psyllid: psy8386


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MFVLVLMLRHCITFLRTRGFNHKAKKTVFYWTHLLYVPFWILLILHCPNFWKWVILPGIIYCCERIFRFTIMR
ccHHHHHHHHHHHHHHccccccccccEEEEEHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHEEEEEEcc
MFVLVLMLRHCITFLRTRGFNHKAKKTVFYWTHLLYVPFWILLILHCPNFWKWVILPGIIYCCERIFRFTIM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVLVLMLRHCITFLRTRGFNHKAKKTVFYWTHLLYVPFWILLILHCPNFWKWVILPGIIYCCERIFRFTIMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADPH oxidase 5 Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.confidentQ96PH1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042554 [BP]superoxide anion generationprobableGO:0072593, GO:0009987, GO:0044237, GO:0008150, GO:0006801, GO:0008152
GO:0015992 [BP]proton transportprobableGO:0006818, GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0015252 [MF]hydrogen ion channel activityprobableGO:0022891, GO:0022892, GO:0005261, GO:0005215, GO:0005216, GO:0008324, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022803, GO:0022838
GO:2000379 [BP]positive regulation of reactive oxygen species metabolic processprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:2000377, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0016175 [MF]superoxide-generating NADPH oxidase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0050664
GO:0001935 [BP]endothelial cell proliferationprobableGO:0008283, GO:0008150, GO:0044699, GO:0050673

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted