Query         psy8389
Match_columns 156
No_of_seqs    173 out of 408
Neff          5.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:22:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8389.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8389hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0039|consensus               99.9 1.2E-23 2.7E-28  194.7   7.1  117   40-156   507-646 (646)
  2 PF08030 NAD_binding_6:  Ferric  99.7 2.2E-18 4.7E-23  130.3   5.2  106   40-145    34-156 (156)
  3 PLN02844 oxidoreductase/ferric  99.1   1E-10 2.2E-15  110.5   5.2   54  103-156   651-720 (722)
  4 PLN02631 ferric-chelate reduct  98.8 3.8E-09 8.2E-14   99.6   5.2   52  103-156   642-697 (699)
  5 PLN02292 ferric-chelate reduct  98.8 3.7E-09 8.1E-14   99.7   5.1   52  102-156   645-700 (702)
  6 cd06186 NOX_Duox_like_FAD_NADP  98.7 1.3E-08 2.9E-13   80.2   4.9   67   40-156   138-210 (210)
  7 cd06184 flavohem_like_fad_nad_  97.2  0.0011 2.3E-08   53.7   6.7   49  105-156   192-243 (247)
  8 cd06215 FNR_iron_sulfur_bindin  97.0   0.002 4.3E-08   51.3   6.3   97   41-156   132-231 (231)
  9 cd06216 FNR_iron_sulfur_bindin  97.0  0.0024 5.1E-08   51.6   6.5   91   41-156   151-243 (243)
 10 PRK08051 fre FMN reductase; Va  96.9  0.0019 4.1E-08   52.2   5.6   95   41-156   131-229 (232)
 11 cd06190 T4MO_e_transfer_like T  96.6  0.0053 1.2E-07   49.0   6.0  101   40-156   127-231 (232)
 12 cd06185 PDR_like Phthalate dio  96.6  0.0075 1.6E-07   47.4   6.6   46  107-156   162-210 (211)
 13 PF00175 NAD_binding_1:  Oxidor  96.6  0.0068 1.5E-07   42.6   5.7   84   39-142    23-109 (109)
 14 cd06211 phenol_2-monooxygenase  96.6  0.0075 1.6E-07   48.6   6.6   32  125-156   204-238 (238)
 15 cd06191 FNR_iron_sulfur_bindin  96.5  0.0069 1.5E-07   48.4   5.8   31  126-156   198-231 (231)
 16 PRK10684 HCP oxidoreductase, N  96.3   0.011 2.4E-07   50.4   6.3   31  126-156   204-237 (332)
 17 cd06189 flavin_oxioreductase N  96.3    0.01 2.2E-07   47.4   5.6   33  124-156   189-224 (224)
 18 cd06212 monooxygenase_like The  96.2   0.018 3.9E-07   46.1   6.8   32  125-156   197-231 (232)
 19 cd06214 PA_degradation_oxidore  96.2   0.014 3.1E-07   46.7   6.2   25  124-148   205-229 (241)
 20 cd06197 FNR_like_2 FAD/NAD(P)   96.2  0.0043 9.2E-08   50.1   3.0   28  127-156   192-219 (220)
 21 cd06210 MMO_FAD_NAD_binding Me  96.0   0.021 4.6E-07   45.6   6.1   31  126-156   202-235 (236)
 22 cd06194 FNR_N-term_Iron_sulfur  95.8   0.018 3.9E-07   45.6   5.2   25  124-148   186-210 (222)
 23 COG4097 Predicted ferric reduc  95.6  0.0043 9.3E-08   55.8   1.0   31  126-156   402-435 (438)
 24 TIGR02160 PA_CoA_Oxy5 phenylac  95.4    0.04 8.8E-07   47.1   6.2   91   41-148   138-230 (352)
 25 cd06183 cyt_b5_reduct_like Cyt  95.3   0.035 7.6E-07   44.0   5.0   89   40-148   133-225 (234)
 26 PRK13289 bifunctional nitric o  95.2    0.06 1.3E-06   46.7   6.5   24  125-148   358-381 (399)
 27 cd06195 FNR1 Ferredoxin-NADP+   95.0    0.02 4.3E-07   46.2   2.8   33  124-156   200-241 (241)
 28 cd06198 FNR_like_3 NAD(P) bind  94.7    0.02 4.4E-07   45.3   2.0   33  124-156   180-215 (216)
 29 cd06217 FNR_iron_sulfur_bindin  94.6   0.024 5.3E-07   45.1   2.3   32  125-156   201-235 (235)
 30 cd06188 NADH_quinone_reductase  94.3   0.054 1.2E-06   45.1   4.0   33  124-156   248-283 (283)
 31 PRK08345 cytochrome-c3 hydroge  94.0    0.12 2.6E-06   43.5   5.4   24  124-147   211-234 (289)
 32 cd06209 BenDO_FAD_NAD Benzoate  94.0   0.037   8E-07   44.2   2.2   33  124-156   192-227 (228)
 33 cd06221 sulfite_reductase_like  93.7    0.13 2.8E-06   42.3   5.0   25  124-148   189-213 (253)
 34 cd06213 oxygenase_e_transfer_s  93.7   0.054 1.2E-06   43.2   2.6   32  125-156   193-227 (227)
 35 cd06187 O2ase_reductase_like T  92.9   0.079 1.7E-06   41.8   2.4   24  125-148   190-213 (224)
 36 PRK11872 antC anthranilate dio  92.8   0.065 1.4E-06   46.1   2.0   23  126-148   302-324 (340)
 37 cd06220 DHOD_e_trans_like2 FAD  92.5    0.12 2.6E-06   41.7   3.0   30  127-156   169-200 (233)
 38 cd06218 DHOD_e_trans FAD/NAD b  92.0    0.15 3.3E-06   41.7   3.1   32  124-155   179-212 (246)
 39 PRK05713 hypothetical protein;  91.5    0.12 2.5E-06   43.9   1.9   23  126-148   275-297 (312)
 40 PRK05464 Na(+)-translocating N  90.7    0.16 3.5E-06   44.8   2.2   33  124-156   372-407 (409)
 41 KOG0534|consensus               90.7    0.87 1.9E-05   39.4   6.6   82   40-139   185-267 (286)
 42 cd00322 FNR_like Ferredoxin re  90.5    0.17 3.7E-06   39.4   2.0   24  124-147   190-213 (223)
 43 PRK10926 ferredoxin-NADP reduc  90.4    0.18 3.8E-06   41.4   2.0   23  125-147   206-228 (248)
 44 TIGR01941 nqrF NADH:ubiquinone  90.2     0.2 4.3E-06   44.2   2.2   33  124-156   368-403 (405)
 45 PRK06222 ferredoxin-NADP(+) re  90.1     0.2 4.3E-06   42.0   2.1   22  127-148   183-204 (281)
 46 PRK07609 CDP-6-deoxy-delta-3,4  90.0    0.18 3.9E-06   42.9   1.9   24  125-148   298-321 (339)
 47 cd06196 FNR_like_1 Ferredoxin   89.8    0.22 4.7E-06   39.3   2.0   22  126-147   187-208 (218)
 48 cd06208 CYPOR_like_FNR These f  89.3    0.21 4.5E-06   41.8   1.6   23  124-146   238-260 (286)
 49 cd06193 siderophore_interactin  89.1    0.24 5.3E-06   40.1   1.9   23  124-146   197-219 (235)
 50 PLN03116 ferredoxin--NADP+ red  89.1    0.24 5.3E-06   42.0   1.9   23  125-147   259-281 (307)
 51 cd06201 SiR_like2 Cytochrome p  88.4     0.3 6.4E-06   41.2   1.9   22  125-146   245-266 (289)
 52 cd06192 DHOD_e_trans_like FAD/  88.3    0.33 7.2E-06   39.2   2.1   22  126-147   179-200 (243)
 53 cd06200 SiR_like1 Cytochrome p  88.1    0.27 5.9E-06   40.2   1.6   21  126-146   203-224 (245)
 54 cd06182 CYPOR_like NADPH cytoc  87.4     0.3 6.6E-06   40.7   1.4   21  127-147   216-237 (267)
 55 cd06219 DHOD_e_trans_like1 FAD  85.6    0.55 1.2E-05   38.4   2.0   21  127-147   182-202 (248)
 56 cd06206 bifunctional_CYPOR The  85.5    0.45 9.7E-06   41.7   1.6   22  125-146   328-349 (384)
 57 PRK00054 dihydroorotate dehydr  85.1    0.58 1.3E-05   38.2   2.0   22  127-148   183-204 (250)
 58 COG1018 Hmp Flavodoxin reducta  85.1    0.69 1.5E-05   39.1   2.5   31  126-156   197-230 (266)
 59 COG0543 UbiB 2-polyprenylpheno  84.3    0.69 1.5E-05   38.4   2.1   24  124-147   191-214 (252)
 60 PRK08221 anaerobic sulfite red  83.0     1.5 3.1E-05   36.4   3.5   24  124-147   191-214 (263)
 61 PLN03115 ferredoxin--NADP(+) r  82.7    0.91   2E-05   40.2   2.3   22  125-146   319-340 (367)
 62 PLN02292 ferric-chelate reduct  82.2     1.9   4E-05   41.6   4.3   41   41-81    465-510 (702)
 63 PTZ00274 cytochrome b5 reducta  82.1    0.84 1.8E-05   39.6   1.8   18  126-143   264-281 (325)
 64 TIGR02911 sulfite_red_B sulfit  82.0    0.95 2.1E-05   37.5   2.0   24  124-147   189-212 (261)
 65 TIGR03224 benzo_boxA benzoyl-C  81.8    0.86 1.9E-05   40.7   1.8   19  126-144   364-382 (411)
 66 PRK05802 hypothetical protein;  80.9     1.1 2.5E-05   38.6   2.2   19  128-146   257-275 (320)
 67 cd06207 CyPoR_like NADPH cytoc  80.3    0.78 1.7E-05   40.2   1.0   22  126-147   330-352 (382)
 68 PTZ00319 NADH-cytochrome B5 re  79.0     1.5 3.3E-05   37.2   2.4   22  125-146   267-289 (300)
 69 cd06199 SiR Cytochrome p450- l  78.6    0.96 2.1E-05   39.4   1.1   21  126-146   308-329 (360)
 70 cd06202 Nitric_oxide_synthase   78.6     1.3 2.9E-05   39.2   1.9   22  125-146   350-371 (406)
 71 cd06204 CYPOR NADPH cytochrome  76.8     1.3 2.8E-05   39.5   1.3   21  126-146   364-385 (416)
 72 PRK12779 putative bifunctional  75.3     1.9   4E-05   42.7   2.1   22  127-148   849-870 (944)
 73 PRK12778 putative bifunctional  75.2     1.9 4.1E-05   41.0   2.1   22  127-148   183-204 (752)
 74 TIGR01715 phage_lam_T phage ta  72.3     1.9 4.2E-05   32.0   1.1   15  106-120     1-15  (100)
 75 PF06223 Phage_tail_T:  Minor t  71.8     1.9   4E-05   32.3   0.9   16  105-120     5-20  (103)
 76 PTZ00306 NADH-dependent fumara  70.8     2.6 5.6E-05   42.4   2.0   24  124-147  1128-1151(1167)
 77 cd06203 methionine_synthase_re  69.5     2.8   6E-05   37.1   1.7   22  125-146   345-367 (398)
 78 TIGR01931 cysJ sulfite reducta  68.3     2.4 5.2E-05   39.7   1.0   20  127-146   546-566 (597)
 79 PRK12775 putative trifunctiona  60.6     5.6 0.00012   39.6   2.1   22  127-148   183-204 (1006)
 80 PLN02252 nitrate reductase [NA  60.4      10 0.00022   37.6   3.7   24  124-147   854-878 (888)
 81 PRK06214 sulfite reductase; Pr  54.1     9.3  0.0002   35.6   2.2   21  126-146   478-499 (530)
 82 PRK14536 cysS cysteinyl-tRNA s  51.6     9.1  0.0002   35.4   1.7   12  122-133    20-31  (490)
 83 PLN02946 cysteine-tRNA ligase   46.9      12 0.00026   35.3   1.8   11  123-133    78-88  (557)
 84 PRK10953 cysJ sulfite reductas  43.7      14 0.00031   34.8   1.8   20  127-146   549-569 (600)
 85 COG0215 CysS Cysteinyl-tRNA sy  43.3      15 0.00032   34.0   1.8   12  122-133    19-30  (464)
 86 PRK14534 cysS cysteinyl-tRNA s  40.7      15 0.00032   34.0   1.3   10  124-133    20-29  (481)
 87 PRK14535 cysS cysteinyl-tRNA s  37.2      20 0.00043   34.8   1.7   11  123-133   246-256 (699)
 88 COG2871 NqrF Na+-transporting   36.9      36 0.00079   30.4   3.1   25  123-147   372-396 (410)
 89 PRK11104 hemG protoporphyrinog  35.8      45 0.00097   26.1   3.2   39   94-133    47-88  (177)
 90 PRK06703 flavodoxin; Provision  35.6      69  0.0015   23.8   4.1   36  100-135    54-94  (151)
 91 PHA03302 envelope glycoprotein  33.7      31 0.00068   29.5   2.1   43   94-148   107-149 (253)
 92 PLN02844 oxidoreductase/ferric  33.6      22 0.00049   34.5   1.4   41   41-81    457-500 (722)
 93 PF03031 NIF:  NLI interacting   32.9      80  0.0017   23.5   4.1   38  107-146    37-74  (159)
 94 PF14980 TIP39:  TIP39 peptide   32.5      46   0.001   21.8   2.3   17    2-18     20-36  (51)
 95 PF11892 DUF3412:  Domain of un  32.3      17 0.00037   28.0   0.3   21    8-28     50-70  (123)
 96 PF01251 Ribosomal_S7e:  Riboso  32.0      27 0.00059   28.7   1.4   15    8-22     72-86  (189)
 97 COG0369 CysJ Sulfite reductase  31.6      28  0.0006   33.0   1.6   20  127-146   536-556 (587)
 98 PF02675 AdoMet_dc:  S-adenosyl  31.5      42  0.0009   24.2   2.3   17  124-140    70-86  (106)
 99 PF12724 Flavodoxin_5:  Flavodo  30.6      58  0.0013   24.2   3.0   40   93-133    43-85  (143)
100 PRK09267 flavodoxin FldA; Vali  30.1      71  0.0015   24.2   3.5   34   99-132    51-89  (169)
101 TIGR03447 mycothiol_MshC cyste  28.9      32 0.00069   31.3   1.5   12  123-134    34-45  (411)
102 TIGR03330 SAM_DCase_Bsu S-aden  28.8      36 0.00078   25.2   1.5   11  124-134    75-85  (112)
103 TIGR01752 flav_long flavodoxin  28.5      75  0.0016   24.4   3.4   34   99-132    49-87  (167)
104 PRK12359 flavodoxin FldB; Prov  26.3      82  0.0018   25.0   3.3   33  102-134    53-90  (172)
105 PTZ00399 cysteinyl-tRNA-synthe  26.1      41 0.00089   32.2   1.8   11  123-133    58-68  (651)
106 PF00650 CRAL_TRIO:  CRAL/TRIO   25.5 1.3E+02  0.0028   21.7   4.1   40  108-147    82-122 (159)
107 PRK00458 S-adenosylmethionine   25.3      45 0.00098   25.4   1.5   19  124-142    88-107 (127)
108 TIGR00435 cysS cysteinyl-tRNA   24.3      44 0.00096   30.4   1.6   12  122-133    18-29  (465)
109 PF01337 Barstar:  Barstar (bar  24.2 1.4E+02   0.003   20.5   3.8   35  103-138    25-62  (90)
110 PRK05568 flavodoxin; Provision  24.1 1.5E+02  0.0033   21.5   4.2   52   94-146    49-108 (142)
111 PRK00260 cysS cysteinyl-tRNA s  24.0      46 0.00099   30.2   1.6   12  122-133    20-31  (463)
112 KOG3829|consensus               24.0      28  0.0006   32.2   0.2   49   99-147   380-436 (486)
113 COG3871 Uncharacterized stress  23.7 1.1E+02  0.0024   24.1   3.5   66    4-79      6-72  (145)
114 PF09652 Cas_VVA1548:  Putative  23.4      28 0.00061   25.6   0.1   14   47-60      1-15  (93)
115 PRK04025 S-adenosylmethionine   23.1      57  0.0012   25.3   1.8   21  124-144    76-97  (139)
116 PHA02629 A-type inclusion body  22.7      74  0.0016   21.2   2.0   20   11-34      4-23  (61)
117 TIGR02251 HIF-SF_euk Dullard-l  22.6 1.6E+02  0.0036   22.5   4.3   38  106-145    42-79  (162)
118 PF05496 RuvB_N:  Holliday junc  22.6      74  0.0016   26.9   2.5   26  114-139    38-64  (233)
119 cd01855 YqeH YqeH.  YqeH is an  22.2      70  0.0015   24.5   2.1   29  111-139   113-141 (190)
120 PF02190 LON:  ATP-dependent pr  21.7      66  0.0014   24.4   1.9   36   96-131    12-47  (205)
121 PRK01236 S-adenosylmethionine   21.6      59  0.0013   24.9   1.6   11  124-134    77-87  (131)
122 PRK02770 S-adenosylmethionine   21.1      67  0.0015   24.9   1.8   19  124-142    89-108 (139)
123 PRK01706 S-adenosylmethionine   21.0      68  0.0015   24.3   1.8   11  124-134    78-88  (123)
124 KOG0733|consensus               20.9      47   0.001   32.5   1.1   20  125-144   545-564 (802)
125 KOG1158|consensus               20.4      61  0.0013   31.3   1.7   21  126-146   593-614 (645)

No 1  
>KOG0039|consensus
Probab=99.89  E-value=1.2e-23  Score=194.71  Aligned_cols=117  Identities=32%  Similarity=0.533  Sum_probs=102.9

Q ss_pred             CcceeEEEEE---ecCCcccchhHhhcCccccccC--CcceeEEecccC-----------CCCCCcccCccccccCCccc
Q psy8389          40 NIRGKMVVFK---NHHGASGYTNESFCSLPEDFKM--GNIGVYCFSLTN-----------SPYPLSSQEKRDLITGLKTR  103 (156)
Q Consensus        40 ~~k~kkVyFi---R~~~~feWf~dll~eVe~~d~~--~~IhiylT~~~~-----------~~e~~~~~~~~d~iTgLrs~  103 (156)
                      ..+++++||+   |++++|+||.+++.+|++.+..  .++|+|+|+.-.           .+...+...+.|+.+|+++.
T Consensus       507 ~~~~~~~~F~Wv~~~~~sf~wf~~~l~~v~~~~~~~~~e~~~~~t~~~~~~d~~~~~~~~~~~~~~~~~~~di~~g~~~~  586 (646)
T KOG0039|consen  507 SLKLKKVYFYWVTREQRSFEWFKGLLTEVEEYDSSGVIELHNYVTSSYEEGDARSALIQMVQKLLHAKNGVDIVTGLKVE  586 (646)
T ss_pred             cceecceeEEEEeccccchHHHHHHHHHHHHHHhcCCchhheehhHhHhhhhhhhHHHHHHHhhcccccCccccccceee
Confidence            5799999999   9999999999999999998864  589999996422           12333556778999999999


Q ss_pred             cccCCCChHHHHHHHHhcCC-CeeEEEEeCChhhHHHHHhhcccc------ceeEeccCC
Q psy8389         104 TNAGRPNWDRVFKHLLDQKK-GKVTVFYCGPPQLARILRLKCDQF------GFSFRKEVF  156 (156)
Q Consensus       104 ThfGRPnw~~if~~v~~~~~-~~VGVF~CGP~~L~~~l~~~c~~~------~F~fhkEnF  156 (156)
                      +|+|||||+++|++++..|+ .+||||+||||+|.+++++.|.++      .|.||+|+|
T Consensus       587 ~~~gRPn~~~~~~~~~~~~~~~~vgVf~CGp~~l~~~~~~~~~~~~~~~~~~~~f~~E~F  646 (646)
T KOG0039|consen  587 THFGRPNWKEVFKEIAKSHPNVRVGVFSCGPPGLVKELRKLCNDFSSSTATRFEFHKENF  646 (646)
T ss_pred             eeCCCCCHHHHHHHHHhhCCCceEEEEEeCCHHHHHHHHHHHHhcccccCceeeeeeccC
Confidence            99999999999999999987 579999999999999999999997      399999998


No 2  
>PF08030 NAD_binding_6:  Ferric reductase NAD binding domain;  InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=99.74  E-value=2.2e-18  Score=130.29  Aligned_cols=106  Identities=21%  Similarity=0.367  Sum_probs=65.1

Q ss_pred             CcceeEEEEEecCCcccchhHhhcCccccccC--CcceeEEecccCCCCCCc-------------ccCccccccCCc-cc
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCSLPEDFKM--GNIGVYCFSLTNSPYPLS-------------SQEKRDLITGLK-TR  103 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~eVe~~d~~--~~IhiylT~~~~~~e~~~-------------~~~~~d~iTgLr-s~  103 (156)
                      .-+++.||.+|+..+++||.++|+++++.+..  .++++|+|+.....+...             .....|..+..+ ..
T Consensus        34 ~~~i~lvW~vR~~~~l~w~~~~l~~l~~~~~~~~~~~~iyvT~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~s~~~~~~  113 (156)
T PF08030_consen   34 TRRIKLVWVVRDADELEWFSPELNELLELDRLGNVEVHIYVTRESSAPSNSDSSDSSSDGENSSSESSNVDSVSPTSNIS  113 (156)
T ss_dssp             --EEEEEEEES-TTTTHHHHHHHHHHHHHHHHTSEEEEEEETT-------------------------------------
T ss_pred             ccceEEEEeeCchhhhhhhhHHHHHHHHHhccccceEEEEEcCCcccccchhhhhcccccccccccccCCcccCCCcccc
Confidence            46688899999999999999999988888754  467899996543321110             012234555554 56


Q ss_pred             cccCCCChHHHHHHHHhcC-CCeeEEEEeCChhhHHHHHhhcc
Q psy8389         104 TNAGRPNWDRVFKHLLDQK-KGKVTVFYCGPPQLARILRLKCD  145 (156)
Q Consensus       104 ThfGRPnw~~if~~v~~~~-~~~VGVF~CGP~~L~~~l~~~c~  145 (156)
                      .++|||||+.++.+..... ..+|+||+|||++|..+++++|.
T Consensus       114 ~~~gRP~~~~~~~~~~~~~~~~~~~V~~CGP~~m~~~vr~~v~  156 (156)
T PF08030_consen  114 VHYGRPDLDEILSEVASQQSSGRVAVFVCGPPSMVDDVRNAVN  156 (156)
T ss_dssp             EEES---HHHHHHHHHHHSTT-EEEEEEES-HHHHHHHHHHH-
T ss_pred             eecCCCCHHHHHHHHHHhCCCCcEEEEEcCcHHHHHHHHHHhC
Confidence            7899999999999995444 58999999999999999999884


No 3  
>PLN02844 oxidoreductase/ferric-chelate reductase
Probab=99.08  E-value=1e-10  Score=110.46  Aligned_cols=54  Identities=26%  Similarity=0.604  Sum_probs=49.3

Q ss_pred             ccccC-CCChHHHHHHHHhcCC-CeeEEEEeCChhhHHHHHhhccccc--------------eeEeccCC
Q psy8389         103 RTNAG-RPNWDRVFKHLLDQKK-GKVTVFYCGPPQLARILRLKCDQFG--------------FSFRKEVF  156 (156)
Q Consensus       103 ~ThfG-RPnw~~if~~v~~~~~-~~VGVF~CGP~~L~~~l~~~c~~~~--------------F~fhkEnF  156 (156)
                      .+||| |||+++||+++.++.. ++|||.+|||++|.++|++.|+.+|              |+||.-||
T Consensus       651 ~~~~g~rp~~~~i~~~~~~~~~~~~vgvlv~gp~~~~~~va~~~~~~~~~~~~~~~~~~~~~~~~hs~~f  720 (722)
T PLN02844        651 EIHFGGRPNFQDIFSKFPKETRGSDIGVLVCGPETMKESVASMCRLKSQCFNVGDDGKRKMYFSFHSLNF  720 (722)
T ss_pred             eeecCCCCCHHHHHHHhhhhccCCceeEEEeCchHHHHHHHHHHHhcccccccccccccCCceeeeeccc
Confidence            57887 9999999999999875 8999999999999999999998874              88998887


No 4  
>PLN02631 ferric-chelate reductase
Probab=98.82  E-value=3.8e-09  Score=99.60  Aligned_cols=52  Identities=21%  Similarity=0.421  Sum_probs=44.4

Q ss_pred             ccccC-CCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccccc---eeEeccCC
Q psy8389         103 RTNAG-RPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFG---FSFRKEVF  156 (156)
Q Consensus       103 ~ThfG-RPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~~---F~fhkEnF  156 (156)
                      .+||| |||+++||.+...  .++|||++|||+.|..+|++.|+..+   |+||.-+|
T Consensus       642 ~~~~g~rp~~~~i~~~~~~--~~~vgvlv~gp~~~~~~va~~c~s~~~~~~~f~s~sf  697 (699)
T PLN02631        642 SVHFGSKPNLKKILLEAEG--SEDVGVMVCGPRKMRHEVAKICSSGLAKNLHFEAISF  697 (699)
T ss_pred             eeeecCCCCHHHHHHhccC--CCceeEEEECcHHHHHHHHHHHhcCCCcceeEEeecc
Confidence            47898 9999999983222  36999999999999999999999874   89988776


No 5  
>PLN02292 ferric-chelate reductase
Probab=98.82  E-value=3.7e-09  Score=99.68  Aligned_cols=52  Identities=27%  Similarity=0.495  Sum_probs=44.6

Q ss_pred             cccccC-CCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccccc---eeEeccCC
Q psy8389         102 TRTNAG-RPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFG---FSFRKEVF  156 (156)
Q Consensus       102 s~ThfG-RPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~~---F~fhkEnF  156 (156)
                      +.+||| |||+++||.+..   .++|||++|||+.|..+|++.|+..+   |+||.-+|
T Consensus       645 ~~~~~g~rp~~~~i~~~~~---~~~vgvlv~gp~~~~~~va~~c~s~~~~~~~~~s~sf  700 (702)
T PLN02292        645 TNIHYGERPNLNKLLVGLK---GSSVGVLVCGPKKMRQKVAKICSSGLAENLHFESISF  700 (702)
T ss_pred             eeeeccCCCCHHHHHHhcC---CCceeEEEECcHHHHHHHHHHHhcCCCcceeEEeecc
Confidence            367887 999999994433   47999999999999999999999884   88988776


No 6  
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide. ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single  transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation.
Probab=98.73  E-value=1.3e-08  Score=80.16  Aligned_cols=67  Identities=28%  Similarity=0.455  Sum_probs=55.6

Q ss_pred             CcceeEEEEEecCCcccchhHhhcC---ccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHH
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCS---LPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFK  116 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~e---Ve~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~  116 (156)
                      .-+++.||..|+..++.||.+.|.+   ++..   .++++|+|+                                    
T Consensus       138 ~~~v~l~w~~r~~~~~~~~~~~l~~~~~~~~~---~~~~i~~T~------------------------------------  178 (210)
T cd06186         138 TRRVKLVWVVRDREDLEWFLDELRAAQELEVD---GEIEIYVTR------------------------------------  178 (210)
T ss_pred             ccEEEEEEEECCHHHhHHHHHHHHhhhhccCC---ceEEEEEee------------------------------------
Confidence            3467777878999999999998864   5544   278999995                                    


Q ss_pred             HHHhcCCCeeEEEEeCChhhHHHHHhhcccc---ceeEeccCC
Q psy8389         117 HLLDQKKGKVTVFYCGPPQLARILRLKCDQF---GFSFRKEVF  156 (156)
Q Consensus       117 ~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~---~F~fhkEnF  156 (156)
                                 ||+|||++|.+.++..|.+.   .+.||.|+|
T Consensus       179 -----------v~~CGp~~~~~~~~~~~~~~~~~~~~~~~e~f  210 (210)
T cd06186         179 -----------VVVCGPPGLVDDVRNAVAKKGGTGVEFHEESF  210 (210)
T ss_pred             -----------EEEECchhhccHHHHHHhhcCCCceEEEeecC
Confidence                       99999999999999999643   499999998


No 7  
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The hemoglobin domain adopts a globin fold with an embedded heme molecule. Flavohemoglobins also have a C-terminal reductase domain with bindiing sites for FAD and NAD(P)H. This domain catalyzes the conversion of NO + O2 + NAD(P)H to NO3- + NAD(P)+.  Instead of the oxygen transport function of hemoglobins, flavohemoglobins seem to act in NO dioxygenation and NO signalling.
Probab=97.22  E-value=0.0011  Score=53.69  Aligned_cols=49  Identities=24%  Similarity=0.451  Sum_probs=33.1

Q ss_pred             ccCCCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         105 NAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       105 hfGRPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      +.||++...+-+ .  .......||.|||++|.+.+++......+   ..|.|.|
T Consensus       192 ~~g~~~~~~l~~-~--~~~~~~~v~icGp~~m~~~v~~~l~~~G~~~~~i~~e~f  243 (247)
T cd06184         192 HAGRIDLALLRE-L--LLPADADFYLCGPVPFMQAVREGLKALGVPAERIHYEVF  243 (247)
T ss_pred             ccCccCHHHHhh-c--cCCCCCEEEEECCHHHHHHHHHHHHHcCCCHHHeeeecc
Confidence            347777544333 1  12346789999999999999999887753   3555554


No 8  
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur pr
Probab=97.01  E-value=0.002  Score=51.26  Aligned_cols=97  Identities=16%  Similarity=0.195  Sum_probs=53.2

Q ss_pred             cceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHHh
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLD  120 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~~  120 (156)
                      .++..+|..|+..++. +.+.+.++.++...-.+++++|....         .       ......||.+-. ++..+..
T Consensus       132 ~~v~l~~~~r~~~~~~-~~~~l~~l~~~~~~~~~~~~~~~~~~---------~-------~~~~~~g~~~~~-~l~~~~~  193 (231)
T cd06215         132 ADIVFIHSARSPADII-FADELEELARRHPNFRLHLILEQPAP---------G-------AWGGYRGRLNAE-LLALLVP  193 (231)
T ss_pred             CcEEEEEecCChhhhh-HHHHHHHHHHHCCCeEEEEEEccCCC---------C-------cccccCCcCCHH-HHHHhcC
Confidence            4566666668877765 34555566544111234444542110         0       001123676543 2333221


Q ss_pred             cCCCeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         121 QKKGKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       121 ~~~~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                       ....-.||.|||++|.+.+++.+..+.+   ..|.|.|
T Consensus       194 -~~~~~~v~icGp~~m~~~~~~~l~~~gv~~~~i~~e~f  231 (231)
T cd06215         194 -DLKERTVFVCGPAGFMKAVKSLLAELGFPMSRFHQESF  231 (231)
T ss_pred             -CccCCeEEEECCHHHHHHHHHHHHHcCCCHHHeeeecC
Confidence             1133479999999999999999987653   3555665


No 9  
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain.  Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains.  Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to for
Probab=96.97  E-value=0.0024  Score=51.62  Aligned_cols=91  Identities=12%  Similarity=0.188  Sum_probs=51.9

Q ss_pred             cceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHHh
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLD  120 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~~  120 (156)
                      -++..+|..|+..+. |+.+.+.++.++...-.++.++|..                      ..-||.+-. .++++..
T Consensus       151 ~~i~l~~~~r~~~~~-~~~~el~~l~~~~~~~~~~~~~s~~----------------------~~~g~~~~~-~l~~~~~  206 (243)
T cd06216         151 ADVVLLYYARTREDV-IFADELRALAAQHPNLRLHLLYTRE----------------------ELDGRLSAA-HLDAVVP  206 (243)
T ss_pred             CCEEEEEEcCChhhh-HHHHHHHHHHHhCCCeEEEEEEcCC----------------------ccCCCCCHH-HHHHhcc
Confidence            456666666777765 5666666665431111233344310                      012555432 2333221


Q ss_pred             cCCCeeEEEEeCChhhHHHHHhhccccce--eEeccCC
Q psy8389         121 QKKGKVTVFYCGPPQLARILRLKCDQFGF--SFRKEVF  156 (156)
Q Consensus       121 ~~~~~VGVF~CGP~~L~~~l~~~c~~~~F--~fhkEnF  156 (156)
                      . ...-.||.|||++|.+.+++......+  ..|.|.|
T Consensus       207 ~-~~~~~vyvcGp~~m~~~~~~~l~~~Gv~~~i~~e~F  243 (243)
T cd06216         207 D-LADRQVYACGPPGFLDAAEELLEAAGLADRLHTERF  243 (243)
T ss_pred             C-cccCeEEEECCHHHHHHHHHHHHHCCCccceeeccC
Confidence            1 123589999999999999999887655  4555655


No 10 
>PRK08051 fre FMN reductase; Validated
Probab=96.93  E-value=0.0019  Score=52.23  Aligned_cols=95  Identities=13%  Similarity=0.111  Sum_probs=50.3

Q ss_pred             cceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHHh
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLD  120 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~~  120 (156)
                      ..+..+|..|+..+. |+.+.+.+++..  ..+++++.+- ....         +..++     .-|+-. +.+++.+..
T Consensus       131 ~~v~l~~g~r~~~~~-~~~~el~~l~~~--~~~~~~~~~~-~~~~---------~~~~~-----~~g~v~-~~l~~~~~~  191 (232)
T PRK08051        131 RPITLYWGGREEDHL-YDLDELEALALK--HPNLHFVPVV-EQPE---------EGWQG-----KTGTVL-TAVMQDFGS  191 (232)
T ss_pred             CcEEEEEEeccHHHh-hhhHHHHHHHHH--CCCcEEEEEe-CCCC---------CCccc-----ceeeeh-HHHHhhccC
Confidence            345555666888876 777777777654  2355554430 1000         00011     012221 222222211


Q ss_pred             cCCCeeEEEEeCChhhHHHHHhhc-cccce---eEeccCC
Q psy8389         121 QKKGKVTVFYCGPPQLARILRLKC-DQFGF---SFRKEVF  156 (156)
Q Consensus       121 ~~~~~VGVF~CGP~~L~~~l~~~c-~~~~F---~fhkEnF  156 (156)
                        ...-.||+|||++|.+.+.+.+ .+..+   .+|.|.|
T Consensus       192 --~~~~~vyicGp~~m~~~v~~~l~~~~G~~~~~i~~e~f  229 (232)
T PRK08051        192 --LAEYDIYIAGRFEMAKIARELFCRERGAREEHLFGDAF  229 (232)
T ss_pred             --cccCEEEEECCHHHHHHHHHHHHHHcCCCHHHeecccc
Confidence              1223599999999999999999 77643   2455544


No 11 
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.
Probab=96.63  E-value=0.0053  Score=49.03  Aligned_cols=101  Identities=11%  Similarity=0.089  Sum_probs=51.1

Q ss_pred             CcceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHH
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLL  119 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~  119 (156)
                      +.++..+|..|+..++.+ .+.+.++++.  .++++++++-.....      ...+.-++     +-||..  ..+.+..
T Consensus       127 ~~~v~l~~~~r~~~~~~~-~~el~~l~~~--~~~~~~~~~~s~~~~------~~~~~~~~-----~~g~v~--~~l~~~~  190 (232)
T cd06190         127 DRPVDLFYGGRTPSDLCA-LDELSALVAL--GARLRVTPAVSDAGS------GSAAGWDG-----PTGFVH--EVVEATL  190 (232)
T ss_pred             CCeEEEEEeecCHHHHhh-HHHHHHHHHh--CCCEEEEEEeCCCCC------CcCCCccC-----CcCcHH--HHHHhhc
Confidence            456677777788887754 5555666554  345554433101000      00000000     113322  2232222


Q ss_pred             hcCCCeeEEEEeCChhhHHHHHhhccccc-e---eEeccCC
Q psy8389         120 DQKKGKVTVFYCGPPQLARILRLKCDQFG-F---SFRKEVF  156 (156)
Q Consensus       120 ~~~~~~VGVF~CGP~~L~~~l~~~c~~~~-F---~fhkEnF  156 (156)
                      ......-.||.|||++|.+.+.+...... .   ..|.|.|
T Consensus       191 ~~~~~~~~vyiCGp~~m~~~v~~~l~~~g~~~~~~i~~e~f  231 (232)
T cd06190         191 GDRLAEFEFYFAGPPPMVDAVQRMLMIEGVVPFDQIHFDRF  231 (232)
T ss_pred             cCCccccEEEEECCHHHHHHHHHHHHHhCCCChHheeeccc
Confidence            21133457999999999999988775542 1   2455554


No 12 
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster. PDR has an an N-terminal  ferrredoxin reductase (FNR)-like NAD(H) binding domain and a C-terminal iron-sulfur [2Fe-2S] cluster domain. Although structurally homologous to FNR, PDR binds FMN rather than FAD in it's FNR-like domain. Electron transfer between pyrimidines and iron-sulfur clusters (Rieske center [2Fe-2S]) or heme groups is mediated by flavins in respiration, photosynthesis, and oxygenase systems. Type I dioxygenase systems, including the hydroxylate phthalate system, have 2 components, a monomeric reductase consisting of a flavin and a 2Fe-2S center and a multimeric oxygenase. In contrast to other Rieske dioxygenases the ferredoxin like domain is C-, not N-terminal.
Probab=96.59  E-value=0.0075  Score=47.37  Aligned_cols=46  Identities=22%  Similarity=0.478  Sum_probs=33.2

Q ss_pred             CCCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         107 GRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       107 GRPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      +|++..+++.++    ...-.||.|||+.|.+.+++.+....+   ..|.|.|
T Consensus       162 ~~~~~~~~~~~~----~~~~~vyicGp~~m~~~~~~~l~~~gv~~~~i~~e~F  210 (211)
T cd06185         162 GRLDLAALLAAP----PAGTHVYVCGPEGMMDAVRAAAAALGWPEARLHFERF  210 (211)
T ss_pred             CccCHHHHhccC----CCCCEEEEECCHHHHHHHHHHHHHcCCChhheEeeec
Confidence            677776666543    224579999999999999999987753   3555555


No 13 
>PF00175 NAD_binding_1:  Oxidoreductase NAD-binding domain ;  InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes. Chloroplast ferredoxin-NADP+ reductase (1.18.1.2 from EC) may play a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power. It is involved in the final step in the linear photosynthetic electron transport chain and has also been implicated in cyclic electron flow around photosystem I where its role would be to return electrons from ferredoxin to the cytochrome B-F complex. This domain is present in a variety of proteins that include, bacterial flavohemoprotein, mammalian NADH-cytochrome b5 reductase, eukaryotic NADPH-cytochrome P450 reductase, nitrate reductase from plants, nitric-oxide synthase, bacterial vanillate demethylase, as well as others.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1UMK_A 1CNE_A 2CND_A 1CNF_A 4FK8_A 4F7D_A 2XNJ_B 1FDR_A 1JB9_A 3LVB_A ....
Probab=96.59  E-value=0.0068  Score=42.56  Aligned_cols=84  Identities=15%  Similarity=0.277  Sum_probs=46.1

Q ss_pred             CCcceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHH-HH
Q psy8389          39 ANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVF-KH  117 (156)
Q Consensus        39 ~~~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if-~~  117 (156)
                      ..-++..+|..|+..++- +.+.+.++.+.... .++++.+  ..      ...+.        ..+-||  ....+ ++
T Consensus        23 ~~~~v~l~~~~r~~~~~~-~~~~l~~~~~~~~~-~~~~~~~--~~------~~~~~--------~~~~g~--v~~~~~~~   82 (109)
T PF00175_consen   23 DNRKVTLFYGARTPEDLL-FRDELEALAQEYPN-RFHVVYV--SS------PDDGW--------DGFKGR--VTDLLLED   82 (109)
T ss_dssp             CTSEEEEEEEESSGGGST-THHHHHHHHHHSTT-CEEEEEE--TT------TTSST--------TSEESS--HHHHHHHH
T ss_pred             CCCCEEEEEEEccccccc-chhHHHHHHhhccc-ccccccc--cc------ccccc--------CCceee--hhHHHHHh
Confidence            455677777779999885 45556666544211 3444333  10      00000        001222  33333 33


Q ss_pred             HHh--cCCCeeEEEEeCChhhHHHHHh
Q psy8389         118 LLD--QKKGKVTVFYCGPPQLARILRL  142 (156)
Q Consensus       118 v~~--~~~~~VGVF~CGP~~L~~~l~~  142 (156)
                      +..  ......-||+|||++|.+.+++
T Consensus        83 ~~~~~~~~~~~~v~iCGp~~m~~~v~~  109 (109)
T PF00175_consen   83 LLPEKIDPDDTHVYICGPPPMMKAVRK  109 (109)
T ss_dssp             HHHHHHCTTTEEEEEEEEHHHHHHHHH
T ss_pred             hcccccCCCCCEEEEECCHHHHHHhcC
Confidence            332  2246778999999999999874


No 14 
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol. This protein is encoded by a single gene and uses a tightly bound FAD cofactor in the NAD(P)H dependent conversion of phenol and O2 to catechol and H2O. This group is related to the NAD binding ferredoxin reductases.
Probab=96.57  E-value=0.0075  Score=48.65  Aligned_cols=32  Identities=22%  Similarity=0.322  Sum_probs=25.0

Q ss_pred             eeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      .-.||+|||++|.+.+.++..+..+   ..|.|.|
T Consensus       204 ~~~vyvCGp~~m~~~~~~~L~~~Gv~~~~i~~e~F  238 (238)
T cd06211         204 GHKAYLCGPPPMIDACIKTLMQGRLFERDIYYEKF  238 (238)
T ss_pred             cCEEEEECCHHHHHHHHHHHHHcCCCHHHccccCC
Confidence            3469999999999999999887754   3566655


No 15 
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in
Probab=96.49  E-value=0.0069  Score=48.44  Aligned_cols=31  Identities=23%  Similarity=0.558  Sum_probs=25.0

Q ss_pred             eEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      -.||.|||++|.+.+++.+....+   ..|.|.|
T Consensus       198 ~~vyicGp~~mv~~~~~~l~~~G~~~~~i~~E~f  231 (231)
T cd06191         198 REAFICGPAGMMDAVETALKELGMPPERIHTERF  231 (231)
T ss_pred             CeEEEECCHHHHHHHHHHHHHcCCCHHHeeeccC
Confidence            469999999999999999987653   3566665


No 16 
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional
Probab=96.29  E-value=0.011  Score=50.40  Aligned_cols=31  Identities=32%  Similarity=0.572  Sum_probs=24.5

Q ss_pred             eEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      -.||.|||++|.+.+.+......+   .+|.|.|
T Consensus       204 ~~vyiCGP~~m~~~v~~~l~~~Gv~~~~i~~E~F  237 (332)
T PRK10684        204 RTVMTCGPAPYMDWVEQEVKALGVTADRFFKEKF  237 (332)
T ss_pred             CEEEEECCHHHHHHHHHHHHHcCCCHHHeEeecc
Confidence            359999999999999999877643   3566665


No 17 
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.
Probab=96.26  E-value=0.01  Score=47.36  Aligned_cols=33  Identities=24%  Similarity=0.539  Sum_probs=25.5

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      ..-.||+|||++|.+.+.+...+..+   ..|.|.|
T Consensus       189 ~~~~v~vCGp~~m~~~~~~~l~~~G~~~~~i~~e~f  224 (224)
T cd06189         189 SDFDVYACGSPEMVYAARDDFVEKGLPEENFFSDAF  224 (224)
T ss_pred             cccEEEEECCHHHHHHHHHHHHHcCCCHHHcccCCC
Confidence            34569999999999999999987642   3555665


No 18 
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. These flavoprotein monooxygenases use molecular oxygen as a substrate and require reduced FAD. One atom of oxygen is incorportated into the aromatic compond, while the other is used to form a molecule of water. In contrast dioxygenases add both atoms of oxygen to the substrate.
Probab=96.22  E-value=0.018  Score=46.08  Aligned_cols=32  Identities=22%  Similarity=0.438  Sum_probs=25.6

Q ss_pred             eeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      ...||.|||++|.+.+.+.+.+..+   ..|.|.|
T Consensus       197 ~~~v~~CGp~~~~~~v~~~l~~~G~~~~~i~~e~f  231 (232)
T cd06212         197 GCDVYLCGPPPMIDAALPVLEMSGVPPDQIFYDKF  231 (232)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHeeeccc
Confidence            4469999999999999999988754   4666655


No 19 
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase. PA oxidoreductases of E. coli hydroxylate PA-CoA in the second step of PA degradation. Members of this group typically fuse a ferredoxin reductase-like domain with an iron-sulfur binding cluster domain. Ferredoxins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal portion may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and
Probab=96.19  E-value=0.014  Score=46.69  Aligned_cols=25  Identities=20%  Similarity=0.420  Sum_probs=21.3

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ...-||.|||+.|.+.+.+......
T Consensus       205 ~~~~v~icGp~~mv~~v~~~l~~~G  229 (241)
T cd06214         205 EFDEAFLCGPEPMMDAVEAALLELG  229 (241)
T ss_pred             cCcEEEEECCHHHHHHHHHHHHHcC
Confidence            4567999999999999999987764


No 20 
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of  ferredoxin reductase-like proteins. Ferredoxin reductase (FNR) was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and have a variety of physiological  functions in a variety of organisms including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which varies in orientation with respect  to the NAD(P) binding domain. The N-terminal moeity 
Probab=96.17  E-value=0.0043  Score=50.12  Aligned_cols=28  Identities=29%  Similarity=0.604  Sum_probs=25.0

Q ss_pred             EEEEeCChhhHHHHHhhccccceeEeccCC
Q psy8389         127 TVFYCGPPQLARILRLKCDQFGFSFRKEVF  156 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~F~fhkEnF  156 (156)
                      .||.|||++|.+.+.+.+...  .+|.|.|
T Consensus       192 ~v~~CGP~~m~~~~~~~~~~~--~~~~e~f  219 (220)
T cd06197         192 EVYLCGPPALEKAVLEWLEGK--KVHRESF  219 (220)
T ss_pred             cEEEECcHHHHHHHHHHhhhc--eeEeccc
Confidence            589999999999999999886  7788877


No 21 
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol. This multicomponent enzyme mediates electron transfer via a hydroxylase (MMOH), a coupling protein, and a reductase which is comprised of an N-terminal [2Fe-2S] ferredoxin domain, an FAD binding subdomain, and an NADH binding subdomain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. Dioxygenases add both atom of oxygen to the substrate, while mono-oxygenases add one atom to the substrate and one atom to water.
Probab=95.96  E-value=0.021  Score=45.65  Aligned_cols=31  Identities=23%  Similarity=0.496  Sum_probs=24.1

Q ss_pred             eEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      -.||.|||++|.+.+++...+..+   ..|.|.|
T Consensus       202 ~~vyicGp~~m~~~~~~~l~~~G~~~~~i~~E~f  235 (236)
T cd06210         202 PDIYLCGPPGMVDAAFAAAREAGVPDEQVYLEKF  235 (236)
T ss_pred             cEEEEeCCHHHHHHHHHHHHHcCCCHHHeeeccc
Confidence            358999999999999999987653   2555554


No 22 
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second e
Probab=95.83  E-value=0.018  Score=45.64  Aligned_cols=25  Identities=24%  Similarity=0.526  Sum_probs=21.0

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ..-.||.|||++|.+.+++...+..
T Consensus       186 ~~~~vyicGp~~m~~~~~~~L~~~G  210 (222)
T cd06194         186 RDDVVYLCGAPSMVNAVRRRAFLAG  210 (222)
T ss_pred             CCCEEEEeCCHHHHHHHHHHHHHcC
Confidence            3456999999999999999987764


No 23 
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism]
Probab=95.64  E-value=0.0043  Score=55.78  Aligned_cols=31  Identities=32%  Similarity=0.645  Sum_probs=26.9

Q ss_pred             eEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      =.||+|||++|.++|++.-++.++   .||.|.|
T Consensus       402 ~sv~fCGP~~m~dsL~r~l~~~~~~i~~~h~E~F  435 (438)
T COG4097         402 RSVFFCGPIKMMDSLRRDLKKQNVPITNFHYEHF  435 (438)
T ss_pred             ceEEEEcCHHHHHHHHHHHHHcCCCHHHHHHHhc
Confidence            379999999999999999999873   6788876


No 24 
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=95.44  E-value=0.04  Score=47.14  Aligned_cols=91  Identities=13%  Similarity=0.115  Sum_probs=48.3

Q ss_pred             cceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHHh
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLD  120 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~~  120 (156)
                      .++..+|..|++.++ ++.+-+.++.+. ...+++++.+-...       ....        ....||.+-..+-+-+..
T Consensus       138 ~~v~l~~~~r~~~d~-~~~~el~~l~~~-~~~~~~~~~~~s~~-------~~~~--------~~~~gr~~~~~l~~~l~~  200 (352)
T TIGR02160       138 STFTLVYGNRRTASV-MFAEELADLKDK-HPQRFHLAHVLSRE-------PREA--------PLLSGRLDGERLAALLDS  200 (352)
T ss_pred             ceEEEEEEeCCHHHH-HHHHHHHHHHHh-CcCcEEEEEEecCC-------CcCc--------ccccCccCHHHHHHHHHh
Confidence            456666666888876 445555555432 11234443320010       0000        012477764333232322


Q ss_pred             cC--CCeeEEEEeCChhhHHHHHhhccccc
Q psy8389         121 QK--KGKVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       121 ~~--~~~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ..  ...-.||.|||++|.+.+++......
T Consensus       201 ~~~~~~~~~vyiCGp~~m~~~v~~~L~~~G  230 (352)
T TIGR02160       201 LIDVDRADEWFLCGPQAMVDDAEQALTGLG  230 (352)
T ss_pred             ccCcccCCEEEEECCHHHHHHHHHHHHHcC
Confidence            21  22346999999999999999987764


No 25 
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH.
Probab=95.31  E-value=0.035  Score=43.98  Aligned_cols=89  Identities=15%  Similarity=0.192  Sum_probs=48.1

Q ss_pred             CcceeEEEEEecCCcccchhHhhcCccccccCCccee--EEecccCCCCCCcccCccccccCCccccccCCCChHHHHHH
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGV--YCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKH  117 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~Ihi--ylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~  117 (156)
                      +.++..+|..|+..+. |+.+.+.++...- .+++++  ++|.-.         . .+       ..+-||.+-. +...
T Consensus       133 ~~~i~l~~~~r~~~~~-~~~~~l~~~~~~~-~~~~~~~~~~~~~~---------~-~~-------~~~~g~~~~~-~l~~  192 (234)
T cd06183         133 KTKISLLYANRTEEDI-LLREELDELAKKH-PDRFKVHYVLSRPP---------E-GW-------KGGVGFITKE-MIKE  192 (234)
T ss_pred             CcEEEEEEecCCHHHh-hhHHHHHHHHHhC-cccEEEEEEEcCCC---------c-CC-------ccccceECHH-HHHH
Confidence            3455666666877765 6677666665430 133433  333100         0 00       1123555432 2222


Q ss_pred             HHhc-CCCeeEEEEeCChhhHH-HHHhhccccc
Q psy8389         118 LLDQ-KKGKVTVFYCGPPQLAR-ILRLKCDQFG  148 (156)
Q Consensus       118 v~~~-~~~~VGVF~CGP~~L~~-~l~~~c~~~~  148 (156)
                      .... ....-.||.|||++|.+ .+++++.+..
T Consensus       193 ~~~~~~~~~~~~~icGp~~~~~~~~~~~l~~~G  225 (234)
T cd06183         193 HLPPPPSEDTLVLVCGPPPMIEGAVKGLLKELG  225 (234)
T ss_pred             hCCCCCCCCeEEEEECCHHHHHHHHHHHHHHcC
Confidence            2211 22456799999999999 9999887653


No 26 
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional
Probab=95.17  E-value=0.06  Score=46.72  Aligned_cols=24  Identities=17%  Similarity=0.609  Sum_probs=20.9

Q ss_pred             eeEEEEeCChhhHHHHHhhccccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ...||.|||++|.+.+.+......
T Consensus       358 ~~~vyiCGp~~m~~~v~~~L~~~G  381 (399)
T PRK13289        358 DADFYFCGPVPFMQFVAKQLLELG  381 (399)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcC
Confidence            567999999999999999887764


No 27 
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.
Probab=94.97  E-value=0.02  Score=46.18  Aligned_cols=33  Identities=21%  Similarity=0.299  Sum_probs=27.0

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc---------eeEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG---------FSFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~---------F~fhkEnF  156 (156)
                      +.-.||.|||++|.+.+++.+.+..         -.+|.|.|
T Consensus       200 ~~~~vyiCGp~~m~~~~~~~l~~~G~~~~~~~~~~~~~~E~~  241 (241)
T cd06195         200 ETSHVMLCGNPQMIDDTQELLKEKGFSKNHRRKPGNITVEKY  241 (241)
T ss_pred             ccCEEEEeCCHHHHHHHHHHHHHcCCCccccCCCceEEEecC
Confidence            4457999999999999999997763         56777776


No 28 
>cd06198 FNR_like_3 NAD(P) binding domain of  ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=94.66  E-value=0.02  Score=45.29  Aligned_cols=33  Identities=33%  Similarity=0.721  Sum_probs=25.6

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      ....||.|||++|.+.+++.+....+   ..|.|.|
T Consensus       180 ~~~~vyicGp~~m~~~v~~~l~~~Gv~~~~I~~E~f  215 (216)
T cd06198         180 ADADVWFCGPPGMADALEKGLRALGVPARRFHYERF  215 (216)
T ss_pred             CCCeEEEECcHHHHHHHHHHHHHcCCChHhcchhhc
Confidence            45679999999999999999987643   3455554


No 29 
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form 
Probab=94.56  E-value=0.024  Score=45.09  Aligned_cols=32  Identities=28%  Similarity=0.567  Sum_probs=25.0

Q ss_pred             eeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      .-.||.|||++|.+.+.+.+.+..+   ..|.|.|
T Consensus       201 ~~~v~icGp~~m~~~v~~~l~~~Gv~~~~i~~E~f  235 (235)
T cd06217         201 GRRVYVCGPPAFVEAATRLLLELGVPRDRIRTEAF  235 (235)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHEeeccC
Confidence            3469999999999999999988753   2455655


No 30 
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.
Probab=94.33  E-value=0.054  Score=45.07  Aligned_cols=33  Identities=21%  Similarity=0.526  Sum_probs=25.9

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc---eeEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG---FSFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~---F~fhkEnF  156 (156)
                      .+..||.|||++|.+.+.+.+....   =..|.|.|
T Consensus       248 ~~~~vyiCGP~~m~~~~~~~l~~~Gv~~~~i~~e~F  283 (283)
T cd06188         248 EDIEFYLCGPPPMNSAVIKMLDDLGVPRENIAFDDF  283 (283)
T ss_pred             CCeEEEEECCHHHHHHHHHHHHHcCCCHHHeeccCC
Confidence            4577999999999999999987764   23566655


No 31 
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional
Probab=93.99  E-value=0.12  Score=43.49  Aligned_cols=24  Identities=17%  Similarity=0.292  Sum_probs=20.1

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      ..-.||.|||++|.+.+++.....
T Consensus       211 ~~~~vyiCGP~~m~~~v~~~L~~~  234 (289)
T PRK08345        211 KNTYAAICGPPVMYKFVFKELINR  234 (289)
T ss_pred             cccEEEEECCHHHHHHHHHHHHHc
Confidence            345699999999999999988665


No 32 
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain.  In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.
Probab=93.97  E-value=0.037  Score=44.15  Aligned_cols=33  Identities=39%  Similarity=0.784  Sum_probs=26.4

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      .+..||.|||++|.+.+++++.+..+   ..|.|.|
T Consensus       192 ~~~~v~icGp~~m~~~~~~~l~~~G~~~~~i~~E~F  227 (228)
T cd06209         192 GDVDVYLCGPPPMVDAVRSWLDEQGIEPANFYYEKF  227 (228)
T ss_pred             CCcEEEEeCCHHHHHHHHHHHHHcCCCHHHEeeecc
Confidence            45679999999999999999987753   4666665


No 33 
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.
Probab=93.72  E-value=0.13  Score=42.27  Aligned_cols=25  Identities=24%  Similarity=0.600  Sum_probs=20.8

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ..-.||+|||++|.+.+.++.....
T Consensus       189 ~~~~vyicGp~~mv~~~~~~L~~~G  213 (253)
T cd06221         189 DNTVAIVCGPPIMMRFVAKELLKLG  213 (253)
T ss_pred             CCcEEEEECCHHHHHHHHHHHHHcC
Confidence            3457999999999999999887653


No 34 
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate while mono-oxygenases add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with  Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=93.67  E-value=0.054  Score=43.23  Aligned_cols=32  Identities=19%  Similarity=0.506  Sum_probs=25.3

Q ss_pred             eeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      .-.||.|||++|.+.+++.+....+   ..|.|.|
T Consensus       193 ~~~v~~CGp~~~~~~~~~~l~~~G~~~~~i~~e~f  227 (227)
T cd06213         193 ATEAYLCGPPAMIDAAIAVLRALGIAREHIHADRF  227 (227)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCCHHHEeccCC
Confidence            4469999999999999999987754   3566665


No 35 
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type  [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=92.85  E-value=0.079  Score=41.84  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=20.7

Q ss_pred             eeEEEEeCChhhHHHHHhhccccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      .-.||+|||++|.+.+++......
T Consensus       190 ~~~v~vcGp~~~~~~v~~~l~~~G  213 (224)
T cd06187         190 DHDIYICGPPAMVDATVDALLARG  213 (224)
T ss_pred             cCEEEEECCHHHHHHHHHHHHHcC
Confidence            456999999999999999987764


No 36 
>PRK11872 antC anthranilate dioxygenase reductase; Provisional
Probab=92.84  E-value=0.065  Score=46.11  Aligned_cols=23  Identities=22%  Similarity=0.647  Sum_probs=20.1

Q ss_pred             eEEEEeCChhhHHHHHhhccccc
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      ..||.||||+|.+.+.+.+....
T Consensus       302 ~~vy~CGp~~mv~~~~~~L~~~G  324 (340)
T PRK11872        302 FDMYLCGPPPMVEAVKQWLDEQA  324 (340)
T ss_pred             CEEEEeCCHHHHHHHHHHHHHcC
Confidence            45999999999999999997763


No 37 
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=92.48  E-value=0.12  Score=41.75  Aligned_cols=30  Identities=23%  Similarity=0.462  Sum_probs=24.1

Q ss_pred             EEEEeCChhhHHHHHhhccccc--eeEeccCC
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG--FSFRKEVF  156 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~--F~fhkEnF  156 (156)
                      .||.|||++|.+.+.+......  -.+|.|.|
T Consensus       169 ~vyicGp~~m~~~~~~~L~~~g~~~~i~~e~f  200 (233)
T cd06220         169 AIYVCGPEIMMYKVLEILDERGVRAQFSLERY  200 (233)
T ss_pred             EEEEECCHHHHHHHHHHHHhcCCcEEEEeccc
Confidence            6999999999999999987764  35666654


No 38 
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=91.99  E-value=0.15  Score=41.69  Aligned_cols=32  Identities=19%  Similarity=0.322  Sum_probs=25.3

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccc--eeEeccC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFG--FSFRKEV  155 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~--F~fhkEn  155 (156)
                      ..-.||.|||++|.+.+++.+....  ..++.|+
T Consensus       179 ~~~~vyiCGp~~mv~~~~~~L~~~Gv~~~~~~~~  212 (246)
T cd06218         179 RPDVVYACGPEPMLKAVAELAAERGVPCQVSLEE  212 (246)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHhcCCCEEEEecc
Confidence            3568999999999999999998764  4555554


No 39 
>PRK05713 hypothetical protein; Provisional
Probab=91.45  E-value=0.12  Score=43.91  Aligned_cols=23  Identities=17%  Similarity=0.345  Sum_probs=19.9

Q ss_pred             eEEEEeCChhhHHHHHhhccccc
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      --||.|||++|.+.+.+.+....
T Consensus       275 ~~vyiCGp~~mv~~~~~~L~~~G  297 (312)
T PRK05713        275 TMALLCGSPASVERFARRLYLAG  297 (312)
T ss_pred             eEEEEeCCHHHHHHHHHHHHHcC
Confidence            45999999999999999987653


No 40 
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional
Probab=90.71  E-value=0.16  Score=44.79  Aligned_cols=33  Identities=18%  Similarity=0.462  Sum_probs=24.8

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      ....||.|||++|.+.+.+.+....+   ..|.|.|
T Consensus       372 ~~~~vyiCGP~~m~~av~~~L~~~Gv~~~~I~~E~F  407 (409)
T PRK05464        372 EDCEYYMCGPPMMNAAVIKMLKDLGVEDENILLDDF  407 (409)
T ss_pred             CCeEEEEECCHHHHHHHHHHHHHcCCCHHHEEEccc
Confidence            45679999999999999999877642   2455544


No 41 
>KOG0534|consensus
Probab=90.68  E-value=0.87  Score=39.39  Aligned_cols=82  Identities=17%  Similarity=0.210  Sum_probs=45.7

Q ss_pred             CcceeEEEEEecCCcccchhHhhcCcccccc-CCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHH
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCSLPEDFK-MGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHL  118 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~eVe~~d~-~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v  118 (156)
                      ..++..+||=++..+. |+.+.|.++..++. +-.++-++..-.       +..     ++     .-|+++-+.|=+.+
T Consensus       185 ~tki~lly~N~te~DI-Llr~eL~~la~~~p~rf~~~y~v~~~~-------~~w-----~~-----~~g~It~~~i~~~l  246 (286)
T KOG0534|consen  185 TTKISLLYANKTEDDI-LLREELEELASKYPERFKVWYVVDQPP-------EIW-----DG-----SVGFITKDLIKEHL  246 (286)
T ss_pred             CcEEEEEEecCCcccc-chHHHHHHHHhhCcceEEEEEEEcCCc-------ccc-----cC-----ccCccCHHHHHhhC
Confidence            4566667777888887 44555666655543 223333332111       000     00     13566655444444


Q ss_pred             HhcCCCeeEEEEeCChhhHHH
Q psy8389         119 LDQKKGKVTVFYCGPPQLARI  139 (156)
Q Consensus       119 ~~~~~~~VGVF~CGP~~L~~~  139 (156)
                      ....+..+-|+.||||+|...
T Consensus       247 ~~~~~~~~~~liCGPp~m~~~  267 (286)
T KOG0534|consen  247 PPPKEGETLVLICGPPPMING  267 (286)
T ss_pred             CCCCCCCeEEEEECCHHHHhH
Confidence            433344788999999999974


No 42 
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in many organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in 
Probab=90.54  E-value=0.17  Score=39.42  Aligned_cols=24  Identities=29%  Similarity=0.656  Sum_probs=20.1

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      ..-.||+|||++|.+.+++.....
T Consensus       190 ~~~~~yvCGp~~m~~~~~~~L~~~  213 (223)
T cd00322         190 SGALVYICGPPAMAKAVREALVSL  213 (223)
T ss_pred             cCCEEEEECCHHHHHHHHHHHHHc
Confidence            456799999999999999887654


No 43 
>PRK10926 ferredoxin-NADP reductase; Provisional
Probab=90.38  E-value=0.18  Score=41.43  Aligned_cols=23  Identities=26%  Similarity=0.437  Sum_probs=19.6

Q ss_pred             eeEEEEeCChhhHHHHHhhcccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      .-.||.|||++|.+.+.+.+...
T Consensus       206 ~~~vy~CGp~~Mv~~~~~~l~~~  228 (248)
T PRK10926        206 TSHVMLCGNPQMVRDTQQLLKET  228 (248)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHh
Confidence            45599999999999999988653


No 44 
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit. This model represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=90.16  E-value=0.2  Score=44.22  Aligned_cols=33  Identities=18%  Similarity=0.497  Sum_probs=24.8

Q ss_pred             CeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                      ..-.||.|||++|.+.+.+.+....+   ..|.|.|
T Consensus       368 ~~~~vylCGP~~m~~av~~~L~~~Gv~~~~I~~E~F  403 (405)
T TIGR01941       368 EDCEFYMCGPPMMNAAVIKMLEDLGVERENILLDDF  403 (405)
T ss_pred             CCeEEEEeCCHHHHHHHHHHHHHcCCCHHHEEEecc
Confidence            34569999999999999999877643   3455544


No 45 
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed
Probab=90.14  E-value=0.2  Score=42.01  Aligned_cols=22  Identities=18%  Similarity=0.366  Sum_probs=19.1

Q ss_pred             EEEEeCChhhHHHHHhhccccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      -||.|||++|.+.+.+.+.+..
T Consensus       183 ~vy~CGP~~M~~~v~~~l~~~g  204 (281)
T PRK06222        183 RVVAIGPVIMMKFVAELTKPYG  204 (281)
T ss_pred             EEEEECCHHHHHHHHHHHHhcC
Confidence            4999999999999999887653


No 46 
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated
Probab=90.03  E-value=0.18  Score=42.92  Aligned_cols=24  Identities=25%  Similarity=0.397  Sum_probs=20.6

Q ss_pred             eeEEEEeCChhhHHHHHhhccccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      .-.||.|||++|.+.+.+......
T Consensus       298 ~~~vy~CGp~~m~~~~~~~l~~~G  321 (339)
T PRK07609        298 GHQVYACGSPVMVYAARDDFVAAG  321 (339)
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcC
Confidence            456999999999999999887764


No 47 
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=89.79  E-value=0.22  Score=39.33  Aligned_cols=22  Identities=18%  Similarity=0.588  Sum_probs=19.0

Q ss_pred             eEEEEeCChhhHHHHHhhcccc
Q psy8389         126 VTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      -.||.|||++|.+.+.+.+...
T Consensus       187 ~~vyiCGp~~m~~~~~~~l~~~  208 (218)
T cd06196         187 QHFYVCGPPPMEEAINGALKEL  208 (218)
T ss_pred             CEEEEECCHHHHHHHHHHHHHc
Confidence            4599999999999999888665


No 48 
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain. Ferredoxin-NADP+ reductase (FNR) is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins, such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2, which then
Probab=89.29  E-value=0.21  Score=41.84  Aligned_cols=23  Identities=13%  Similarity=0.231  Sum_probs=19.1

Q ss_pred             CeeEEEEeCChhhHHHHHhhccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      ..-.||.|||++|.+.|++++..
T Consensus       238 ~~~~vYiCGp~~m~~~v~~~L~~  260 (286)
T cd06208         238 DNTHVYICGLKGMEPGVDDALTS  260 (286)
T ss_pred             CCcEEEEeCCchHHHHHHHHHHH
Confidence            34459999999999999888765


No 49 
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hy
Probab=89.15  E-value=0.24  Score=40.06  Aligned_cols=23  Identities=26%  Similarity=0.348  Sum_probs=20.1

Q ss_pred             CeeEEEEeCChhhHHHHHhhccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      ...-||+|||++|.+.+++++..
T Consensus       197 ~~~~vyicGp~~mv~~v~~~l~~  219 (235)
T cd06193         197 GDGYVWIAGEAGAVRALRRHLRE  219 (235)
T ss_pred             CCeEEEEEccHHHHHHHHHHHHH
Confidence            45679999999999999999865


No 50 
>PLN03116 ferredoxin--NADP+ reductase; Provisional
Probab=89.08  E-value=0.24  Score=42.05  Aligned_cols=23  Identities=9%  Similarity=0.348  Sum_probs=18.1

Q ss_pred             eeEEEEeCChhhHHHHHhhcccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      .--||.|||++|.+.+.+++.+.
T Consensus       259 ~~~vYiCGp~~mv~~v~~~L~~~  281 (307)
T PLN03116        259 GAHIYFCGLKGMMPGIQDTLKRV  281 (307)
T ss_pred             CcEEEEeCCHHHHHHHHHHHHHH
Confidence            34599999999999887776553


No 51 
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide.  Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH.  Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal  FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via F
Probab=88.35  E-value=0.3  Score=41.18  Aligned_cols=22  Identities=14%  Similarity=0.356  Sum_probs=17.8

Q ss_pred             eeEEEEeCChhhHHHHHhhccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      .--||.|||++|.+.+.+.+.+
T Consensus       245 ~~~vyiCGp~~M~~~v~~~L~~  266 (289)
T cd06201         245 GAQIMVCGSRAMAQGVAAVLEE  266 (289)
T ss_pred             CcEEEEECCHHHHHHHHHHHHH
Confidence            3459999999999988877654


No 52 
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (formi
Probab=88.26  E-value=0.33  Score=39.24  Aligned_cols=22  Identities=9%  Similarity=0.212  Sum_probs=19.3

Q ss_pred             eEEEEeCChhhHHHHHhhcccc
Q psy8389         126 VTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      .-||.|||++|.+.+++..+.+
T Consensus       179 ~~v~icGp~~mv~~~~~~l~~~  200 (243)
T cd06192         179 DRIIVAGSDIMMKAVVEALDEW  200 (243)
T ss_pred             CEEEEECCHHHHHHHHHHHHhh
Confidence            4699999999999999988765


No 53 
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal  FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD
Probab=88.13  E-value=0.27  Score=40.23  Aligned_cols=21  Identities=19%  Similarity=0.419  Sum_probs=17.4

Q ss_pred             eEEEEeCCh-hhHHHHHhhccc
Q psy8389         126 VTVFYCGPP-QLARILRLKCDQ  146 (156)
Q Consensus       126 VGVF~CGP~-~L~~~l~~~c~~  146 (156)
                      --||.|||+ +|.+.+.+...+
T Consensus       203 ~~vy~CGp~~~m~~~v~~~l~~  224 (245)
T cd06200         203 AAIYVCGSLQGMAPGVDAVLDE  224 (245)
T ss_pred             cEEEEECCchhhhHHHHHHHHH
Confidence            359999999 999999887654


No 54 
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPOR has a C-terminal ferredoxin reducatase (FNR)- like FAD and NAD binding module, an FMN-binding domain, and an additional conecting domain (inserted within the FAD binding region) that orients the FNR and FMN binding domains. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria and participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-t
Probab=87.35  E-value=0.3  Score=40.71  Aligned_cols=21  Identities=14%  Similarity=0.414  Sum_probs=17.3

Q ss_pred             EEEEeCChh-hHHHHHhhcccc
Q psy8389         127 TVFYCGPPQ-LARILRLKCDQF  147 (156)
Q Consensus       127 GVF~CGP~~-L~~~l~~~c~~~  147 (156)
                      .||+|||++ |.+.+.+.+.+.
T Consensus       216 ~vyvCGp~~~m~~~v~~~L~~~  237 (267)
T cd06182         216 HIYVCGDAKSMAKDVEDALVKI  237 (267)
T ss_pred             EEEEECCcccchHHHHHHHHHH
Confidence            799999999 988887776554


No 55 
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD,
Probab=85.60  E-value=0.55  Score=38.36  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=18.1

Q ss_pred             EEEEeCChhhHHHHHhhcccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~  147 (156)
                      -||.|||++|.+.+.+...+.
T Consensus       182 ~vyiCGP~~m~~~~~~~l~~~  202 (248)
T cd06219         182 LVIAIGPPIMMKAVSELTRPY  202 (248)
T ss_pred             EEEEECCHHHHHHHHHHHHHc
Confidence            499999999999999887654


No 56 
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR). NADPH cytochrome p450 reductase serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a la
Probab=85.50  E-value=0.45  Score=41.67  Aligned_cols=22  Identities=23%  Similarity=0.392  Sum_probs=18.1

Q ss_pred             eeEEEEeCChhhHHHHHhhccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      .--||+|||++|.+.|++...+
T Consensus       328 ~~~vyiCGp~~M~~~v~~~L~~  349 (384)
T cd06206         328 GARVYVCGDGRMAPGVREVLKR  349 (384)
T ss_pred             CcEEEEECCCchHHHHHHHHHH
Confidence            3459999999999999887654


No 57 
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed
Probab=85.10  E-value=0.58  Score=38.19  Aligned_cols=22  Identities=14%  Similarity=0.366  Sum_probs=19.1

Q ss_pred             EEEEeCChhhHHHHHhhccccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      -||.|||++|.+.++++..+..
T Consensus       183 ~vyvCGp~~m~~~v~~~l~~~G  204 (250)
T PRK00054        183 AIYSCGPEIMMKKVVEILKEKK  204 (250)
T ss_pred             EEEEeCCHHHHHHHHHHHHHcC
Confidence            5999999999999999887653


No 58 
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion]
Probab=85.08  E-value=0.69  Score=39.12  Aligned_cols=31  Identities=29%  Similarity=0.573  Sum_probs=24.9

Q ss_pred             eEEEEeCChhhHHHHHhhccccc---eeEeccCC
Q psy8389         126 VTVFYCGPPQLARILRLKCDQFG---FSFRKEVF  156 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c~~~~---F~fhkEnF  156 (156)
                      =.+|.|||.+|-+.++..+.+..   =.+|.|.|
T Consensus       197 r~~y~CGp~~fm~av~~~l~~~g~~~~~vh~E~F  230 (266)
T COG1018         197 REVYLCGPGPFMQAVRLALEALGVPDDRVHLEGF  230 (266)
T ss_pred             CEEEEECCHHHHHHHHHHHHHcCCChhcEEEeec
Confidence            56999999999999999986664   24666665


No 59 
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion]
Probab=84.30  E-value=0.69  Score=38.38  Aligned_cols=24  Identities=29%  Similarity=0.736  Sum_probs=20.2

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      +.--||.||||+|.+.+.+.....
T Consensus       191 ~~~~v~~cGp~~M~~~v~~~~~~~  214 (252)
T COG0543         191 EVDDVYICGPPAMVKAVREKLKEY  214 (252)
T ss_pred             cCCEEEEECCHHHHHHHHHHHHhc
Confidence            346699999999999999887665


No 60 
>PRK08221 anaerobic sulfite reductase subunit B; Provisional
Probab=83.03  E-value=1.5  Score=36.44  Aligned_cols=24  Identities=21%  Similarity=0.375  Sum_probs=19.7

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      ..-.||.||||+|.+.+.+.....
T Consensus       191 ~~~~vylCGp~~mv~~~~~~L~~~  214 (263)
T PRK08221        191 DNMQVIVVGPPIMMKFTVLEFLKR  214 (263)
T ss_pred             CCeEEEEECCHHHHHHHHHHHHHc
Confidence            455699999999999988877654


No 61 
>PLN03115 ferredoxin--NADP(+) reductase; Provisional
Probab=82.72  E-value=0.91  Score=40.25  Aligned_cols=22  Identities=14%  Similarity=0.232  Sum_probs=17.4

Q ss_pred             eeEEEEeCChhhHHHHHhhccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      .--||+|||++|.+.|.++...
T Consensus       319 ~~~vYiCGp~~M~~~V~~~l~~  340 (367)
T PLN03115        319 NTYVYMCGLKGMEKGIDDIMVS  340 (367)
T ss_pred             CeEEEEeCCHHHHHHHHHHHHH
Confidence            4569999999998888776544


No 62 
>PLN02292 ferric-chelate reductase
Probab=82.18  E-value=1.9  Score=41.59  Aligned_cols=41  Identities=5%  Similarity=-0.097  Sum_probs=29.1

Q ss_pred             cceeEEEEEecCCcccchhHhhcCccc-----cccCCcceeEEecc
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPE-----DFKMGNIGVYCFSL   81 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~-----~d~~~~IhiylT~~   81 (156)
                      -+++.||.+|+..+..|..++..+++.     +....++++|+|..
T Consensus       465 ~~V~LIw~vR~~~Dl~~ld~l~~e~~~~~~l~~~~~~~i~iyvTr~  510 (702)
T PLN02292        465 PKITLICAFKNSSDLSMLDLILPTSGLETELSSFIDIQIKAFVTRE  510 (702)
T ss_pred             CcEEEEEEECCHHHhhHHHHHHHhhhhHHHHhhcCCceEEEEEeCC
Confidence            467888888999988887666655531     22356788999954


No 63 
>PTZ00274 cytochrome b5 reductase; Provisional
Probab=82.13  E-value=0.84  Score=39.62  Aligned_cols=18  Identities=28%  Similarity=0.517  Sum_probs=15.3

Q ss_pred             eEEEEeCChhhHHHHHhh
Q psy8389         126 VTVFYCGPPQLARILRLK  143 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~  143 (156)
                      -.||.|||++|.+.+...
T Consensus       264 ~~vylCGPp~Mm~av~~~  281 (325)
T PTZ00274        264 KIIMLCGPDQLLNHVAGT  281 (325)
T ss_pred             cEEEEeCCHHHHHHhcCC
Confidence            459999999999998655


No 64 
>TIGR02911 sulfite_red_B sulfite reductase, subunit B. Members of this protein family include the B subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum.
Probab=81.97  E-value=0.95  Score=37.51  Aligned_cols=24  Identities=17%  Similarity=0.259  Sum_probs=20.1

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      ..-.||.|||++|.+.+++...+.
T Consensus       189 ~~~~v~lCGp~~mv~~~~~~L~~~  212 (261)
T TIGR02911       189 EEVQAIVVGPPIMMKFTVQELLKK  212 (261)
T ss_pred             cceEEEEECCHHHHHHHHHHHHHc
Confidence            345699999999999999887665


No 65 
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein. Members of this protein family are BoxA, the A component of the BoxAB benzoyl-CoA oxygenase/reductase. This oxygen-requiring enzyme acts in an aerobic pathway of benzoate catabolism via coenzyme A ligation. BoxA is a homodimeric iron-sulphur-flavoprotein and acts as an NADPH-dependent reductase for BoxB.
Probab=81.75  E-value=0.86  Score=40.65  Aligned_cols=19  Identities=11%  Similarity=0.228  Sum_probs=13.8

Q ss_pred             eEEEEeCChhhHHHHHhhc
Q psy8389         126 VTVFYCGPPQLARILRLKC  144 (156)
Q Consensus       126 VGVF~CGP~~L~~~l~~~c  144 (156)
                      --||.|||++|.+.+.+..
T Consensus       364 ~~vYiCGp~~M~~~v~~~L  382 (411)
T TIGR03224       364 TYIYICGLKGMEEGVLDAF  382 (411)
T ss_pred             cEEEEECCHHHHHHHHHHH
Confidence            4599999999955554444


No 66 
>PRK05802 hypothetical protein; Provisional
Probab=80.89  E-value=1.1  Score=38.59  Aligned_cols=19  Identities=16%  Similarity=0.079  Sum_probs=17.7

Q ss_pred             EEEeCChhhHHHHHhhccc
Q psy8389         128 VFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       128 VF~CGP~~L~~~l~~~c~~  146 (156)
                      ||.|||++|.+.|.+...+
T Consensus       257 vy~CGP~~M~k~v~~~l~~  275 (320)
T PRK05802        257 IHCGGSDILHYKIIEYLDK  275 (320)
T ss_pred             EEEECCHHHHHHHHHHHhh
Confidence            9999999999999998876


No 67 
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced fe
Probab=80.32  E-value=0.78  Score=40.15  Aligned_cols=22  Identities=9%  Similarity=0.347  Sum_probs=17.9

Q ss_pred             eEEEEeCChh-hHHHHHhhcccc
Q psy8389         126 VTVFYCGPPQ-LARILRLKCDQF  147 (156)
Q Consensus       126 VGVF~CGP~~-L~~~l~~~c~~~  147 (156)
                      .-||+|||+. |.+.|++...+.
T Consensus       330 ~~vYvCG~~~~M~~~V~~~L~~~  352 (382)
T cd06207         330 GVIYVCGSTWKMPPDVQEAFEEI  352 (382)
T ss_pred             CEEEEECCcccccHHHHHHHHHH
Confidence            3599999998 999998876543


No 68 
>PTZ00319 NADH-cytochrome B5 reductase; Provisional
Probab=79.03  E-value=1.5  Score=37.19  Aligned_cols=22  Identities=27%  Similarity=0.742  Sum_probs=15.9

Q ss_pred             eeEEEEeCChhhHH-HHHhhccc
Q psy8389         125 KVTVFYCGPPQLAR-ILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP~~L~~-~l~~~c~~  146 (156)
                      +-.||.|||++|.+ .+.+.-..
T Consensus       267 ~~~vyiCGp~~mv~~~~~~~L~~  289 (300)
T PTZ00319        267 KVMALMCGPPPMLQMAVKPNLEK  289 (300)
T ss_pred             CeEEEEECCHHHHHHHHHHHHHH
Confidence            45799999999987 45544433


No 69 
>cd06199 SiR Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain.
Probab=78.61  E-value=0.96  Score=39.37  Aligned_cols=21  Identities=14%  Similarity=0.358  Sum_probs=16.7

Q ss_pred             eEEEEeCCh-hhHHHHHhhccc
Q psy8389         126 VTVFYCGPP-QLARILRLKCDQ  146 (156)
Q Consensus       126 VGVF~CGP~-~L~~~l~~~c~~  146 (156)
                      --||+|||+ .|.+.|+++...
T Consensus       308 ~~vYvCG~~~~M~~~V~~~L~~  329 (360)
T cd06199         308 AHFYVCGDAKRMAKDVDAALLD  329 (360)
T ss_pred             CEEEEECCCccccHHHHHHHHH
Confidence            349999999 899888877543


No 70 
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain. The reductase portion is similar in structure to NADPH dependent cytochrome-450 reductase (CYPOR), having an  inserted connecting sub-domain within the FAD binding portion of FNR. NOS differs from CYPOR in a requirement for the cofactor tetrahydrobiopterin and unlike most CYPOR is dimeric. Nitric oxide synthase produces nitric oxide in the conversion of L-arginine to L-citruline. NOS has been implicated in a variety of processes including cytotoxicity, anti-inflamation, neurotransmission, and vascular smooth muscle relaxation.
Probab=78.56  E-value=1.3  Score=39.22  Aligned_cols=22  Identities=14%  Similarity=0.323  Sum_probs=17.3

Q ss_pred             eeEEEEeCChhhHHHHHhhccc
Q psy8389         125 KVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      .--||+|||+.|.+.|++....
T Consensus       350 ~~~iYvCG~~~M~~~V~~~L~~  371 (406)
T cd06202         350 GGHIYVCGDVTMAEDVSQTIQR  371 (406)
T ss_pred             CCEEEEeCCCchHHHHHHHHHH
Confidence            3459999999999888876543


No 71 
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredo
Probab=76.81  E-value=1.3  Score=39.46  Aligned_cols=21  Identities=19%  Similarity=0.430  Sum_probs=16.7

Q ss_pred             eEEEEeCChh-hHHHHHhhccc
Q psy8389         126 VTVFYCGPPQ-LARILRLKCDQ  146 (156)
Q Consensus       126 VGVF~CGP~~-L~~~l~~~c~~  146 (156)
                      --||+|||+. |.+.|++....
T Consensus       364 ~~vYvCGp~~~M~~~V~~~L~~  385 (416)
T cd06204         364 AYIYVCGDAKNMARDVEKTLLE  385 (416)
T ss_pred             CEEEEECCcccchHHHHHHHHH
Confidence            4599999998 98888776544


No 72 
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional
Probab=75.30  E-value=1.9  Score=42.69  Aligned_cols=22  Identities=27%  Similarity=0.519  Sum_probs=19.3

Q ss_pred             EEEEeCChhhHHHHHhhccccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      -||.|||++|.+.+.+.+....
T Consensus       849 ~Vy~CGP~~Mmkav~~~l~~~G  870 (944)
T PRK12779        849 EVIAIGPPLMMRAVSDLTKPYG  870 (944)
T ss_pred             EEEEECCHHHHHHHHHHHHHcC
Confidence            4999999999999999887653


No 73 
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=75.16  E-value=1.9  Score=41.01  Aligned_cols=22  Identities=27%  Similarity=0.611  Sum_probs=19.0

Q ss_pred             EEEEeCChhhHHHHHhhccccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      -||.|||++|.+.+.+.+....
T Consensus       183 ~vy~CGP~~M~~~v~~~l~~~g  204 (752)
T PRK12778        183 KVFAIGPAIMMKFVCLLTKKYG  204 (752)
T ss_pred             EEEEECCHHHHHHHHHHHHHcC
Confidence            4899999999999999887653


No 74 
>TIGR01715 phage_lam_T phage tail assembly protein T. This model represents a translation of the T gene in phage lambda and related phage. A translational frameshift from the upstream gene G into the frame of T produces a minor protein gpG-T, essential in tail assembly but not found in the mature virion.
Probab=72.32  E-value=1.9  Score=32.04  Aligned_cols=15  Identities=27%  Similarity=0.780  Sum_probs=13.0

Q ss_pred             cCCCChHHHHHHHHh
Q psy8389         106 AGRPNWDRVFKHLLD  120 (156)
Q Consensus       106 fGRPnw~~if~~v~~  120 (156)
                      ||||||+..+.++..
T Consensus         1 f~rpdWR~mLa~MSs   15 (100)
T TIGR01715         1 FGRPDWRAMLAGMSS   15 (100)
T ss_pred             CCCchHHHHHHhccH
Confidence            799999999987764


No 75 
>PF06223 Phage_tail_T:  Minor tail protein T;  InterPro: IPR009350 This family represents the minor tail protein T of Lambda-like viruses and their prophage. The minor tail protein T is located at the distal end and is involved in the assembly of the initiator complex for tail polymerisation. The protein is essential for tail assembly but is not found in the mature virion [].
Probab=71.83  E-value=1.9  Score=32.27  Aligned_cols=16  Identities=31%  Similarity=0.897  Sum_probs=13.8

Q ss_pred             ccCCCChHHHHHHHHh
Q psy8389         105 NAGRPNWDRVFKHLLD  120 (156)
Q Consensus       105 hfGRPnw~~if~~v~~  120 (156)
                      -||||||+..+.++..
T Consensus         5 Ef~R~dWR~MLa~MSs   20 (103)
T PF06223_consen    5 EFGRPDWRRMLAEMSS   20 (103)
T ss_pred             HhcCchHHHHHHhcCH
Confidence            5899999999987764


No 76 
>PTZ00306 NADH-dependent fumarate reductase; Provisional
Probab=70.82  E-value=2.6  Score=42.44  Aligned_cols=24  Identities=25%  Similarity=0.538  Sum_probs=20.3

Q ss_pred             CeeEEEEeCChhhHHHHHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      ..-.||.|||++|.+.+.+.....
T Consensus      1128 ~~~~vyiCGP~~mv~~v~~~L~~~ 1151 (1167)
T PTZ00306       1128 KDLLVAICGPPVMQRAVKADLLAL 1151 (1167)
T ss_pred             CCeEEEEeCCHHHHHHHHHHHHHc
Confidence            355699999999999999887664


No 77 
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate. In MSR, electrons are transferred from NADPH to FAD to FMN to cob(II)alamin. MSR resembles proteins of the cytochrome p450 family including nitric oxide synthase, the alpha subunit of sulfite reductase, but contains an extended hinge region. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. CYPORs resemble ferredoxin reductase (FNR) but have a connecting subdomain inserted within the flavin binding region, which helps orient the FMN binding doamin with the FNR module. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme
Probab=69.48  E-value=2.8  Score=37.06  Aligned_cols=22  Identities=18%  Similarity=0.422  Sum_probs=17.0

Q ss_pred             eeEEEEeCC-hhhHHHHHhhccc
Q psy8389         125 KVTVFYCGP-PQLARILRLKCDQ  146 (156)
Q Consensus       125 ~VGVF~CGP-~~L~~~l~~~c~~  146 (156)
                      .--||+||| +.|.+.|+++..+
T Consensus       345 ~~~iYvCG~~~~M~~~V~~~l~~  367 (398)
T cd06203         345 NAKIYVCGDAKGMAKDVRDTFVD  367 (398)
T ss_pred             CcEEEEECCcchhhHHHHHHHHH
Confidence            344999999 5899998887653


No 78 
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component. This model describes an NADPH-dependent sulfite reductase flavoprotein subunit. Most members of this family are found in Cys biosynthesis gene clusters. The closest homologs below the trusted cutoff are designated as subunits nitrate reductase.
Probab=68.34  E-value=2.4  Score=39.70  Aligned_cols=20  Identities=15%  Similarity=0.434  Sum_probs=16.8

Q ss_pred             EEEEeC-ChhhHHHHHhhccc
Q psy8389         127 TVFYCG-PPQLARILRLKCDQ  146 (156)
Q Consensus       127 GVF~CG-P~~L~~~l~~~c~~  146 (156)
                      -||+|| |+.|.+.|++....
T Consensus       546 ~vYvCG~~~~M~~~V~~~L~~  566 (597)
T TIGR01931       546 HIYVCGDAKKMAKDVHQALLD  566 (597)
T ss_pred             EEEEECCCccccHHHHHHHHH
Confidence            499999 89999998887654


No 79 
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=60.60  E-value=5.6  Score=39.62  Aligned_cols=22  Identities=23%  Similarity=0.283  Sum_probs=18.9

Q ss_pred             EEEEeCChhhHHHHHhhccccc
Q psy8389         127 TVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus       127 GVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      -||.|||++|.+.+.+..+.+.
T Consensus       183 ~vy~CGP~~Mm~av~~~~~~~g  204 (1006)
T PRK12775        183 LVVAIGPLPMMNACVETTRPFG  204 (1006)
T ss_pred             EEEEECCHHHHHHHHHHHHHCC
Confidence            3999999999999999887653


No 80 
>PLN02252 nitrate reductase [NADPH]
Probab=60.37  E-value=10  Score=37.57  Aligned_cols=24  Identities=17%  Similarity=0.573  Sum_probs=17.7

Q ss_pred             CeeEEEEeCChhhHHH-HHhhcccc
Q psy8389         124 GKVTVFYCGPPQLARI-LRLKCDQF  147 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~-l~~~c~~~  147 (156)
                      ..--||.|||++|.+. +...+..+
T Consensus       854 ~~~~vyiCGPp~Mi~~av~~~L~~~  878 (888)
T PLN02252        854 DETLALMCGPPPMIEFACQPNLEKM  878 (888)
T ss_pred             CCeEEEEeCCHHHHHHHHHHHHHHc
Confidence            3456999999999984 66666554


No 81 
>PRK06214 sulfite reductase; Provisional
Probab=54.10  E-value=9.3  Score=35.62  Aligned_cols=21  Identities=14%  Similarity=0.371  Sum_probs=15.4

Q ss_pred             eEEEEeCCh-hhHHHHHhhccc
Q psy8389         126 VTVFYCGPP-QLARILRLKCDQ  146 (156)
Q Consensus       126 VGVF~CGP~-~L~~~l~~~c~~  146 (156)
                      --||+|||. .|.+.|++....
T Consensus       478 a~iYVCGp~~~M~~~V~~~L~~  499 (530)
T PRK06214        478 AHFYVCGDAKRMAKDVERALVD  499 (530)
T ss_pred             cEEEEeCChHHHHHHHHHHHHH
Confidence            359999996 588888775533


No 82 
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional
Probab=51.64  E-value=9.1  Score=35.44  Aligned_cols=12  Identities=42%  Similarity=1.132  Sum_probs=10.5

Q ss_pred             CCCeeEEEEeCC
Q psy8389         122 KKGKVTVFYCGP  133 (156)
Q Consensus       122 ~~~~VGVF~CGP  133 (156)
                      .+.+|++|+|||
T Consensus        20 ~~~~v~mYvCGp   31 (490)
T PRK14536         20 EHGHVRLYGCGP   31 (490)
T ss_pred             CCCceEEEeeCC
Confidence            356899999999


No 83 
>PLN02946 cysteine-tRNA ligase
Probab=46.93  E-value=12  Score=35.26  Aligned_cols=11  Identities=45%  Similarity=1.066  Sum_probs=10.0

Q ss_pred             CCeeEEEEeCC
Q psy8389         123 KGKVTVFYCGP  133 (156)
Q Consensus       123 ~~~VGVF~CGP  133 (156)
                      +.+|++|+|||
T Consensus        78 ~~~v~~Y~CGp   88 (557)
T PLN02946         78 EGKVGMYVCGV   88 (557)
T ss_pred             CCceeEEEeCC
Confidence            47899999999


No 84 
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional
Probab=43.67  E-value=14  Score=34.76  Aligned_cols=20  Identities=15%  Similarity=0.443  Sum_probs=15.6

Q ss_pred             EEEEeCCh-hhHHHHHhhccc
Q psy8389         127 TVFYCGPP-QLARILRLKCDQ  146 (156)
Q Consensus       127 GVF~CGP~-~L~~~l~~~c~~  146 (156)
                      -||+|||. .|++.|+++...
T Consensus       549 ~~YVCG~~~~M~~~V~~~L~~  569 (600)
T PRK10953        549 HIYVCGDANRMAKDVEQALLE  569 (600)
T ss_pred             EEEEECCCccchHHHHHHHHH
Confidence            49999996 699888876543


No 85 
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=43.28  E-value=15  Score=34.01  Aligned_cols=12  Identities=50%  Similarity=1.234  Sum_probs=10.4

Q ss_pred             CCCeeEEEEeCC
Q psy8389         122 KKGKVTVFYCGP  133 (156)
Q Consensus       122 ~~~~VGVF~CGP  133 (156)
                      .+.+|.+|+|||
T Consensus        19 ~~~~V~mYvCGp   30 (464)
T COG0215          19 DPGKVKMYVCGP   30 (464)
T ss_pred             CCCeEEEEecCC
Confidence            456799999999


No 86 
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional
Probab=40.67  E-value=15  Score=34.03  Aligned_cols=10  Identities=50%  Similarity=1.212  Sum_probs=9.2

Q ss_pred             CeeEEEEeCC
Q psy8389         124 GKVTVFYCGP  133 (156)
Q Consensus       124 ~~VGVF~CGP  133 (156)
                      .+|++|+|||
T Consensus        20 ~~v~mY~CGp   29 (481)
T PRK14534         20 SDVKVYACGP   29 (481)
T ss_pred             CceEEEeCCC
Confidence            4899999999


No 87 
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional
Probab=37.21  E-value=20  Score=34.84  Aligned_cols=11  Identities=27%  Similarity=0.724  Sum_probs=9.9

Q ss_pred             CCeeEEEEeCC
Q psy8389         123 KGKVTVFYCGP  133 (156)
Q Consensus       123 ~~~VGVF~CGP  133 (156)
                      +++|++|+|||
T Consensus       246 ~~~V~mYvCGP  256 (699)
T PRK14535        246 PENVRMYVCGM  256 (699)
T ss_pred             CCceEEEecCC
Confidence            36899999999


No 88 
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion]
Probab=36.90  E-value=36  Score=30.43  Aligned_cols=25  Identities=16%  Similarity=0.433  Sum_probs=21.4

Q ss_pred             CCeeEEEEeCChhhHHHHHhhcccc
Q psy8389         123 KGKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       123 ~~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      |+.---|.||||-|..+|-++.+.+
T Consensus       372 PEDceyYmCGPp~mNasvikmL~dl  396 (410)
T COG2871         372 PEDCEYYMCGPPLMNASVIKMLKDL  396 (410)
T ss_pred             chheeEEeeCcchhhHHHHHHHHhc
Confidence            4788899999999999998877665


No 89 
>PRK11104 hemG protoporphyrinogen oxidase; Provisional
Probab=35.77  E-value=45  Score=26.15  Aligned_cols=39  Identities=13%  Similarity=0.075  Sum_probs=23.5

Q ss_pred             cccccCCccccccCCCChH--HHHHHHHhc-CCCeeEEEEeCC
Q psy8389          94 RDLITGLKTRTNAGRPNWD--RVFKHLLDQ-KKGKVTVFYCGP  133 (156)
Q Consensus        94 ~d~iTgLrs~ThfGRPnw~--~if~~v~~~-~~~~VGVF~CGP  133 (156)
                      .|.+ -+-+.||+|+|.-.  .+++..... ...+|++|.||.
T Consensus        47 yD~v-IlGspi~~G~~~~~~~~fl~~~~~~l~~K~v~~F~v~l   88 (177)
T PRK11104         47 YDRV-VIGASIRYGHFHSALYKFVKKHATQLNQMPSAFFSVNL   88 (177)
T ss_pred             CCEE-EEECccccCCcCHHHHHHHHHHHHHhCCCeEEEEEech
Confidence            4443 24457788887632  444443322 247999999994


No 90 
>PRK06703 flavodoxin; Provisional
Probab=35.57  E-value=69  Score=23.82  Aligned_cols=36  Identities=25%  Similarity=0.241  Sum_probs=24.7

Q ss_pred             Cccccc-cCCC--ChHHHHHHHHhcC--CCeeEEEEeCChh
Q psy8389         100 LKTRTN-AGRP--NWDRVFKHLLDQK--KGKVTVFYCGPPQ  135 (156)
Q Consensus       100 Lrs~Th-fGRP--nw~~if~~v~~~~--~~~VGVF~CGP~~  135 (156)
                      +-+.|+ .|+|  ++..+++.+....  ..+|+||-||...
T Consensus        54 igspt~~~g~~p~~~~~f~~~l~~~~l~~k~~~vfg~g~~~   94 (151)
T PRK06703         54 LGSYTWGDGDLPYEAEDFHEDLENIDLSGKKVAVFGSGDTA   94 (151)
T ss_pred             EEECCCCCCcCcHHHHHHHHHHhcCCCCCCEEEEEccCCCC
Confidence            334666 5766  4888888887543  3689999988643


No 91 
>PHA03302 envelope glycoprotein L; Provisional
Probab=33.69  E-value=31  Score=29.55  Aligned_cols=43  Identities=23%  Similarity=0.563  Sum_probs=33.9

Q ss_pred             cccccCCccccccCCCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccccc
Q psy8389          94 RDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFG  148 (156)
Q Consensus        94 ~d~iTgLrs~ThfGRPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~~~  148 (156)
                      +-++|-+++   =++|||-+++....++.+ +.+||-|        |++.|++++
T Consensus       107 RtLLTLlrS---d~ap~Wm~fl~GY~~C~~-~~~IyTC--------V~dvCr~yd  149 (253)
T PHA03302        107 RTLLTLLRS---DSAPDWMKFLNGYSQCGD-SSTIYTC--------VDDVCRQYD  149 (253)
T ss_pred             HHHHHHHcc---cCcccHHHHhcChhhcCC-CCceEEe--------hhhhhhhcC
Confidence            444566653   369999999999999877 8889998        788898873


No 92 
>PLN02844 oxidoreductase/ferric-chelate reductase
Probab=33.55  E-value=22  Score=34.47  Aligned_cols=41  Identities=10%  Similarity=-0.047  Sum_probs=30.3

Q ss_pred             cceeEEEEEecCCcccchhHhhcCcccc---ccCCcceeEEecc
Q psy8389          41 IRGKMVVFKNHHGASGYTNESFCSLPED---FKMGNIGVYCFSL   81 (156)
Q Consensus        41 ~k~kkVyFiR~~~~feWf~dll~eVe~~---d~~~~IhiylT~~   81 (156)
                      -++..||.+|+..+..|+.++..++.++   ....++++|+|+.
T Consensus       457 ~~V~LIw~vR~~~dL~~~del~~~l~~~~~~~~~lkl~iyVTRE  500 (722)
T PLN02844        457 KRVQLIYVVKKSQDICLLNPISSLLLNQSSNQLNLKLKVFVTQE  500 (722)
T ss_pred             CcEEEEEEECCHHHhhhHHHHHHHhHHhHHHhcCceEEEEECCC
Confidence            3577888889999999999887555432   1246788999943


No 93 
>PF03031 NIF:  NLI interacting factor-like phosphatase;  InterPro: IPR004274 The function of this domain is unclear. It is found in proteins of diverse function including phosphatases some of which may be active in active in ternary elongation complexes and a number of NLI interacting factors. In the phospatases this domain is often present N-terminal to the BRCT domain (IPR001357 from INTERPRO).; GO: 0005515 protein binding; PDB: 3L0Y_A 2GHQ_A 3PGL_A 3L0C_B 1TA0_A 2GHT_A 3L0B_B 1T9Z_A 3QLE_A 2Q5E_E ....
Probab=32.89  E-value=80  Score=23.45  Aligned_cols=38  Identities=18%  Similarity=0.230  Sum_probs=28.8

Q ss_pred             CCCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhccc
Q psy8389         107 GRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQ  146 (156)
Q Consensus       107 GRPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~~  146 (156)
                      -||.++.+++.+++.  -.|.||..|.+.-+..+-+....
T Consensus        37 ~RP~l~~FL~~l~~~--~ev~i~T~~~~~ya~~v~~~ldp   74 (159)
T PF03031_consen   37 LRPGLDEFLEELSKH--YEVVIWTSASEEYAEPVLDALDP   74 (159)
T ss_dssp             E-TTHHHHHHHHHHH--CEEEEE-SS-HHHHHHHHHHHTT
T ss_pred             eCchHHHHHHHHHHh--ceEEEEEeehhhhhhHHHHhhhh
Confidence            599999999999754  58999999998888877766654


No 94 
>PF14980 TIP39:  TIP39 peptide
Probab=32.52  E-value=46  Score=21.76  Aligned_cols=17  Identities=41%  Similarity=0.765  Sum_probs=13.5

Q ss_pred             chHHHHHHHHHHHHhhh
Q psy8389           2 DNKVKKRQRLLATLERK   18 (156)
Q Consensus         2 ~~~~~~~~~~~~~~~~~   18 (156)
                      |.....|.|||+.|||.
T Consensus        20 DaAFrerarLl~amER~   36 (51)
T PF14980_consen   20 DAAFRERARLLTAMERQ   36 (51)
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            34457789999999985


No 95 
>PF11892 DUF3412:  Domain of unknown function (DUF3412);  InterPro: IPR021826  This presumed domain is functionally uncharacterised. This domain is found in bacteria. This domain is about 120 amino acids in length. This domain is found associated with PF03641 from PFAM. ; PDB: 3BQ9_A 2PMB_D 3GH1_D.
Probab=32.31  E-value=17  Score=27.97  Aligned_cols=21  Identities=48%  Similarity=0.602  Sum_probs=16.9

Q ss_pred             HHHHHHHHhhhhccceecCcc
Q psy8389           8 RQRLLATLERKFSGKVLGGGK   28 (156)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~   28 (156)
                      ...|.|.|.|-|||-|-|-=|
T Consensus        50 ~~~LAanLRrAFSGIVAGNVK   70 (123)
T PF11892_consen   50 PHELAANLRRAFSGIVAGNVK   70 (123)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHhccccccccC
Confidence            357899999999999988544


No 96 
>PF01251 Ribosomal_S7e:  Ribosomal protein S7e;  InterPro: IPR000554 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic ribosomal proteins can be grouped on the basis of sequence similarities []. One of these families consists of Xenopus S8, and mammalian, insect and yeast S7. These proteins have about 200 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XZN_3 2XZM_3 3U5G_H 3U5C_H.
Probab=32.04  E-value=27  Score=28.71  Aligned_cols=15  Identities=60%  Similarity=0.939  Sum_probs=13.4

Q ss_pred             HHHHHHHHhhhhccc
Q psy8389           8 RQRLLATLERKFSGK   22 (156)
Q Consensus         8 ~~~~~~~~~~~~~~~   22 (156)
                      -+||...||.||||+
T Consensus        72 q~rLv~ELEKKfsgk   86 (189)
T PF01251_consen   72 QVRLVRELEKKFSGK   86 (189)
T ss_dssp             CHHHHHHHHHCTTTC
T ss_pred             HHHHHHHHHhhcCCC
Confidence            468999999999996


No 97 
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism]
Probab=31.55  E-value=28  Score=33.05  Aligned_cols=20  Identities=15%  Similarity=0.370  Sum_probs=16.4

Q ss_pred             EEEEeC-ChhhHHHHHhhccc
Q psy8389         127 TVFYCG-PPQLARILRLKCDQ  146 (156)
Q Consensus       127 GVF~CG-P~~L~~~l~~~c~~  146 (156)
                      -+|+|| +..|++.|+++-..
T Consensus       536 ~~YVCGd~~~Ma~dV~~AL~~  556 (587)
T COG0369         536 HIYVCGDAKGMAKDVEEALLD  556 (587)
T ss_pred             EEEEeCCCccchHHHHHHHHH
Confidence            489999 99999998877543


No 98 
>PF02675 AdoMet_dc:  S-adenosylmethionine decarboxylase ;  InterPro: IPR003826 Polyamines such as spermidine and spermine are essential for cellular growth under most conditions, being implicated in a large number of cellular processes including DNA, RNA and protein synthesis. S-adenosylmethionine decarboxylase (AdoMetDC) plays an essential regulatory role in the polyamine biosynthetic pathway by generating the n-propylamine residue required for the synthesis of spermidine and spermine from putrescein [, ]. Unlike many amino acid decarboxylases AdoMetDC uses a covalently bound pyruvate residue as a cofactor rather than the more common pyridoxal 5'-phosphate. These proteins can be divided into two main groups which show little sequence similarity either to each other, or to other pyruvoyl-dependent amino acid decarboxylases: class I enzymes found in bacteria and archaea, and class II enzymes found in eukaryotes. In both groups the active enzyme is generated by the post-translational autocatalytic cleavage of a precursor protein. This cleavage generates the pyruvate precursor from an internal serine residue and results in the formation of two non-identical subunits termed alpha and beta which form the active enzyme. Members of this family are related to the amino terminus of Escherichia coli S-adenosylmethionine decarboxylase.; GO: 0004014 adenosylmethionine decarboxylase activity, 0008295 spermidine biosynthetic process; PDB: 1VR7_A 3IWC_D 3IWD_D 3IWB_C 1TMI_A 1TLU_A 2III_A.
Probab=31.53  E-value=42  Score=24.21  Aligned_cols=17  Identities=24%  Similarity=0.565  Sum_probs=11.7

Q ss_pred             CeeEEEEeCChhhHHHH
Q psy8389         124 GKVTVFYCGPPQLARIL  140 (156)
Q Consensus       124 ~~VGVF~CGP~~L~~~l  140 (156)
                      ..|+||.||+-...+.+
T Consensus        70 ~avDiftC~~~~p~~a~   86 (106)
T PF02675_consen   70 AAVDIFTCGEFDPEKAI   86 (106)
T ss_dssp             EEEEEEEESTHHHHHHH
T ss_pred             EEEEEEEcCCCCHHHHH
Confidence            47999999993333333


No 99 
>PF12724 Flavodoxin_5:  Flavodoxin domain
Probab=30.63  E-value=58  Score=24.23  Aligned_cols=40  Identities=28%  Similarity=0.283  Sum_probs=26.9

Q ss_pred             ccccccCCccccccCCCCh--HHHHHHHHhc-CCCeeEEEEeCC
Q psy8389          93 KRDLITGLKTRTNAGRPNW--DRVFKHLLDQ-KKGKVTVFYCGP  133 (156)
Q Consensus        93 ~~d~iTgLrs~ThfGRPnw--~~if~~v~~~-~~~~VGVF~CGP  133 (156)
                      ..|.+ .+-+.+|.|++..  .++.+..... ...+|.+|.||-
T Consensus        43 ~yD~v-i~gspiy~g~~~~~~~~fi~~~~~~l~~k~v~~f~~~~   85 (143)
T PF12724_consen   43 DYDAV-IFGSPIYAGRIPGEMREFIKKNKDNLKNKKVALFSVGG   85 (143)
T ss_pred             cCCEE-EEEEEEECCcCCHHHHHHHHHHHHHHcCCcEEEEEEeC
Confidence            34443 3556889999877  6777766543 347899988763


No 100
>PRK09267 flavodoxin FldA; Validated
Probab=30.08  E-value=71  Score=24.23  Aligned_cols=34  Identities=29%  Similarity=0.404  Sum_probs=24.2

Q ss_pred             CCcccccc-CCC--ChHHHHHHHHhcC--CCeeEEEEeC
Q psy8389          99 GLKTRTNA-GRP--NWDRVFKHLLDQK--KGKVTVFYCG  132 (156)
Q Consensus        99 gLrs~Thf-GRP--nw~~if~~v~~~~--~~~VGVF~CG  132 (156)
                      -+-+.|+. |+|  +|..+++.+....  ..+|+||.||
T Consensus        51 i~g~pt~~~G~~~~~~~~fl~~~~~~~l~~k~vaifg~g   89 (169)
T PRK09267         51 ILGIPTWGYGELQCDWDDFLPELEEIDFSGKKVALFGLG   89 (169)
T ss_pred             EEEecCcCCCCCCHHHHHHHHHHhcCCCCCCEEEEEecC
Confidence            34567775 875  5888888775432  4789999998


No 101
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase. Members of this protein family are MshC, l-cysteine:1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase, an enzyme that uses ATP to ligate a Cys residue to a mycothiol precursor molecule, in the second to last step in mycothiol biosynthesis. This enzyme shows considerable homology to Cys--tRNA ligases, and many instances are misannotated as such. Mycothiol is found in Mycobacterium tuberculosis, Corynebacterium glutamicum, Streptomyces coelicolor, and various other members of the Actinobacteria. Mycothiol is an analog to glutathione.
Probab=28.92  E-value=32  Score=31.26  Aligned_cols=12  Identities=17%  Similarity=0.520  Sum_probs=10.3

Q ss_pred             CCeeEEEEeCCh
Q psy8389         123 KGKVTVFYCGPP  134 (156)
Q Consensus       123 ~~~VGVF~CGP~  134 (156)
                      +.+|++|+|||-
T Consensus        34 ~~~v~~YvCGpT   45 (411)
T TIGR03447        34 GPEAGMYVCGIT   45 (411)
T ss_pred             CCcceEEEeCCc
Confidence            468999999993


No 102
>TIGR03330 SAM_DCase_Bsu S-adenosylmethionine decarboxylase proenzyme, Bacillus form. Members of this protein family are the single chain precursor of the two chains of the mature S-adenosylmethionine decarboxylase as found in Methanocaldococcus jannaschii, Bacillus subtilis, and a wide range of other species. It differs substantially in architecture from the form as found in Escherichia coli, and lacks any extended homology to the eukaryotic form (TIGR00535).
Probab=28.79  E-value=36  Score=25.19  Aligned_cols=11  Identities=45%  Similarity=0.857  Sum_probs=9.6

Q ss_pred             CeeEEEEeCCh
Q psy8389         124 GKVTVFYCGPP  134 (156)
Q Consensus       124 ~~VGVF~CGP~  134 (156)
                      ..|+||.||+.
T Consensus        75 aavDiftCg~~   85 (112)
T TIGR03330        75 AAVDVFTCGDH   85 (112)
T ss_pred             EEEEEEecCCC
Confidence            58999999984


No 103
>TIGR01752 flav_long flavodoxin, long chain. Flavodoxins are small redox-active proteins with a flavin mononucleotide (FMN) prosthetic group. They can act in nitrogen fixation by nitrogenase, in sulfite reduction, and light-dependent NADP+ reduction in during photosynthesis, among other roles. This model describes the long chain type, typical for nitrogen fixation but associated with pyruvate formate-lyase activation and cobalamin-dependent methionine synthase activity in E. coli.
Probab=28.46  E-value=75  Score=24.36  Aligned_cols=34  Identities=26%  Similarity=0.377  Sum_probs=23.9

Q ss_pred             CCccccc-cCCC--ChHHHHHHHHhcC--CCeeEEEEeC
Q psy8389          99 GLKTRTN-AGRP--NWDRVFKHLLDQK--KGKVTVFYCG  132 (156)
Q Consensus        99 gLrs~Th-fGRP--nw~~if~~v~~~~--~~~VGVF~CG  132 (156)
                      .+-+.|+ .|+|  +|..+++.+....  ..+|+||-||
T Consensus        49 i~gspty~~g~~p~~~~~fl~~l~~~~l~gk~v~~fg~g   87 (167)
T TIGR01752        49 ILGTPTWGVGELQEDWEDFLPTLEELDFTGKTVALFGLG   87 (167)
T ss_pred             EEEecCCCCCcCcHHHHHHHHHhhcCCCCCCEEEEEecC
Confidence            3556676 5765  5778888776432  4789999997


No 104
>PRK12359 flavodoxin FldB; Provisional
Probab=26.26  E-value=82  Score=24.95  Aligned_cols=33  Identities=24%  Similarity=0.385  Sum_probs=25.3

Q ss_pred             cccc-cCCC--ChHHHHHHHHhcC--CCeeEEEEeCCh
Q psy8389         102 TRTN-AGRP--NWDRVFKHLLDQK--KGKVTVFYCGPP  134 (156)
Q Consensus       102 s~Th-fGRP--nw~~if~~v~~~~--~~~VGVF~CGP~  134 (156)
                      +.|. .|.+  +|..+++.+....  ..+|+||=||..
T Consensus        53 ~pTw~~Gel~~d~~~~~~~l~~~dl~gK~vAlFG~Gd~   90 (172)
T PRK12359         53 IPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGMGDQ   90 (172)
T ss_pred             ecccCCCcCcHHHHHHHHHHhhCCCCCCEEEEEeCCCC
Confidence            4553 5654  8999999988764  479999999996


No 105
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional
Probab=26.08  E-value=41  Score=32.16  Aligned_cols=11  Identities=36%  Similarity=0.875  Sum_probs=9.9

Q ss_pred             CCeeEEEEeCC
Q psy8389         123 KGKVTVFYCGP  133 (156)
Q Consensus       123 ~~~VGVF~CGP  133 (156)
                      +.+|+.|+|||
T Consensus        58 ~~~v~~Y~CGP   68 (651)
T PTZ00399         58 GRQVRWYTCGP   68 (651)
T ss_pred             CCeeEEEEeCC
Confidence            46899999999


No 106
>PF00650 CRAL_TRIO:  CRAL/TRIO domain;  InterPro: IPR001251 This entry defines the C-terminal of various retinaldehyde/retinal-binding proteins that may be functional components of the visual cycle. Cellular retinaldehyde-binding protein (CRALBP) carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes []. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains []. Trio is a multifunctional protein that integrates and amplifies signals involved in coordinating actin remodeling, which is necessary for cell migration and growth. Other members of the family are transfer proteins that include, guanine nucleotide exchange factor that may function as an effector of RAC1, phosphatidylinositol/phosphatidylcholine transfer protein that is required for the transport of secretory proteins from the golgi complex and alpha-tocopherol transfer protein that enhances the transfer of the ligand between separate membranes.; PDB: 1OIZ_A 1R5L_A 1OIP_A 3HX3_A 3HY5_A 1OLM_E 1O6U_E 3Q8G_A 3B7Q_B 3B7Z_A ....
Probab=25.50  E-value=1.3e+02  Score=21.73  Aligned_cols=40  Identities=15%  Similarity=0.287  Sum_probs=30.8

Q ss_pred             CCChHHHHHHHHhcCCCeeE-EEEeCChhhHHHHHhhcccc
Q psy8389         108 RPNWDRVFKHLLDQKKGKVT-VFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus       108 RPnw~~if~~v~~~~~~~VG-VF~CGP~~L~~~l~~~c~~~  147 (156)
                      ...++.+++-++...|++++ ||++-+|.+.+.+-+.++.+
T Consensus        82 ~~~~k~~~~~~~~~yP~rl~~i~iin~p~~~~~~~~~~~~~  122 (159)
T PF00650_consen   82 ISFLKKIIQLLQDHYPERLGKIYIINAPWFFRVLWKIVKPF  122 (159)
T ss_dssp             HHHHHHHHHHHHHHSTTTEEEEEEES--TTHHHHHHHHGGG
T ss_pred             hhhhhhhhhhhcccCCccceeEEEEecChhhhhhHhHHHhh
Confidence            33456677777777899887 99999999999999999877


No 107
>PRK00458 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=25.28  E-value=45  Score=25.38  Aligned_cols=19  Identities=21%  Similarity=0.524  Sum_probs=12.7

Q ss_pred             CeeEEEEeCCh-hhHHHHHh
Q psy8389         124 GKVTVFYCGPP-QLARILRL  142 (156)
Q Consensus       124 ~~VGVF~CGP~-~L~~~l~~  142 (156)
                      ..|+||.||+. ...+.++.
T Consensus        88 aavDiftCg~~~~p~~a~~~  107 (127)
T PRK00458         88 ATVDVYTCGEHTDPQKAFEY  107 (127)
T ss_pred             EEEEEEecCCCCCHHHHHHH
Confidence            58999999984 33344433


No 108
>TIGR00435 cysS cysteinyl-tRNA synthetase. This model finds the cysteinyl-tRNA synthetase from most but not from all species. The enzyme from one archaeal species, Archaeoglobus fulgidus, is found but the equivalent enzymes from some other Archaea, including Methanococcus jannaschii, are not found, although biochemical evidence suggests that tRNA(Cys) in these species are charged directly with Cys rather than through a misacylation and correction pathway as for tRNA(Gln).
Probab=24.26  E-value=44  Score=30.42  Aligned_cols=12  Identities=50%  Similarity=1.232  Sum_probs=10.4

Q ss_pred             CCCeeEEEEeCC
Q psy8389         122 KKGKVTVFYCGP  133 (156)
Q Consensus       122 ~~~~VGVF~CGP  133 (156)
                      .+++|.+|+|||
T Consensus        18 ~~~~v~~yvcgp   29 (465)
T TIGR00435        18 VQGKVKMYVCGP   29 (465)
T ss_pred             CCCcceEEEecC
Confidence            456899999999


No 109
>PF01337 Barstar:  Barstar (barnase inhibitor);  InterPro: IPR000468 Barstar is a small single chain protein. Barnase is the extracellular ribonuclease IPR001887 from INTERPRO of Bacillus amyloliquefaciens, and barstar its specific intracellular inhibitor [, ]. Expression of barstar is necessary to counter the lethal effect of expressed active barnase. The structure of the barnase-barstar complex is known [].; PDB: 2CX6_A 1B2U_F 1A19_A 1X1U_F 1B27_E 1X1W_F 1BGS_E 1X1Y_D 1B3S_D 1B2S_D ....
Probab=24.17  E-value=1.4e+02  Score=20.45  Aligned_cols=35  Identities=20%  Similarity=0.378  Sum_probs=27.6

Q ss_pred             ccccCCCChHHHHHHHHhc---CCCeeEEEEeCChhhHH
Q psy8389         103 RTNAGRPNWDRVFKHLLDQ---KKGKVTVFYCGPPQLAR  138 (156)
Q Consensus       103 ~ThfGRPnw~~if~~v~~~---~~~~VGVF~CGP~~L~~  138 (156)
                      +-+||| ||+.+.+-+...   .+..+-|.+.+...+.+
T Consensus        25 P~yfG~-NlDAl~D~L~d~~~~~~~~~~i~~~~~~~~~~   62 (90)
T PF01337_consen   25 PDYFGR-NLDALWDCLTDLSWIPEEPIVIIWENADKLKK   62 (90)
T ss_dssp             -TTSSS-SHHHHHHHHHCT---S-SSEEEEEETHHHHHH
T ss_pred             CchhcC-CHHHHHHHhcCcccCCCCCEEEEEcCcHHHHH
Confidence            558998 999999999987   34788899988877655


No 110
>PRK05568 flavodoxin; Provisional
Probab=24.15  E-value=1.5e+02  Score=21.47  Aligned_cols=52  Identities=12%  Similarity=0.148  Sum_probs=31.4

Q ss_pred             cccccCCccccccCC----CChHHHHHHHHhcC-CCeeEEEEe---CChhhHHHHHhhccc
Q psy8389          94 RDLITGLKTRTNAGR----PNWDRVFKHLLDQK-KGKVTVFYC---GPPQLARILRLKCDQ  146 (156)
Q Consensus        94 ~d~iTgLrs~ThfGR----Pnw~~if~~v~~~~-~~~VGVF~C---GP~~L~~~l~~~c~~  146 (156)
                      .|.| .+-++|+++.    +.+..+++.+.... ..++++|.|   +.....+.+.+.+..
T Consensus        49 ~d~i-ilgsp~y~~~~~~~~~~~~f~~~~~~~~~~k~~~~f~t~G~~~~~~~~~~~~~l~~  108 (142)
T PRK05568         49 ADVV-ALGSPAMGDEVLEEGEMEPFVESISSLVKGKKLVLFGSYGWGDGEWMRDWVERMEG  108 (142)
T ss_pred             CCEE-EEECCccCcccccchhHHHHHHHhhhhhCCCEEEEEEccCCCCChHHHHHHHHHHH
Confidence            4443 3556777765    36889999886443 468888886   323344555555443


No 111
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated
Probab=24.03  E-value=46  Score=30.20  Aligned_cols=12  Identities=50%  Similarity=1.254  Sum_probs=10.4

Q ss_pred             CCCeeEEEEeCC
Q psy8389         122 KKGKVTVFYCGP  133 (156)
Q Consensus       122 ~~~~VGVF~CGP  133 (156)
                      ++++|.+|+|||
T Consensus        20 ~~~~v~~yvcgP   31 (463)
T PRK00260         20 EPGKVKMYVCGP   31 (463)
T ss_pred             CCCcceEEEeCC
Confidence            357899999999


No 112
>KOG3829|consensus
Probab=23.97  E-value=28  Score=32.18  Aligned_cols=49  Identities=29%  Similarity=0.379  Sum_probs=37.3

Q ss_pred             CCccccccCCCChH--HHHHHHHhcC---C---CeeEEEEeCChhhHHHHHhhcccc
Q psy8389          99 GLKTRTNAGRPNWD--RVFKHLLDQK---K---GKVTVFYCGPPQLARILRLKCDQF  147 (156)
Q Consensus        99 gLrs~ThfGRPnw~--~if~~v~~~~---~---~~VGVF~CGP~~L~~~l~~~c~~~  147 (156)
                      .|-.---||||+.+  +|+.-+.++-   +   .+.-+|.=||..|++.+++...+-
T Consensus       380 hLDngr~FGrp~~De~sILaPL~QCCliRkST~~~L~~f~~gpk~Lt~~l~esl~qD  436 (486)
T KOG3829|consen  380 HLDNGRAFGRPSHDELSILAPLYQCCLIRKSTWDRLQVFSNGPKVLTEALDESLSQD  436 (486)
T ss_pred             EeccccccCCCCcchHHHHHHHHhhheeeHHHHHHHHHHhcCChhHHHHHHHHhccC
Confidence            44444469999997  5688888763   2   378899999999999998876553


No 113
>COG3871 Uncharacterized stress protein (general stress protein 26) [General function prediction only]
Probab=23.66  E-value=1.1e+02  Score=24.13  Aligned_cols=66  Identities=9%  Similarity=0.031  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHHHhhhhccceecCcccCCCCCCCCCCCcceeEEEEEecCCcccch-hHhhcCccccccCCcceeEEe
Q psy8389           4 KVKKRQRLLATLERKFSGKVLGGGKQNGGTGGSVDANIRGKMVVFKNHHGASGYT-NESFCSLPEDFKMGNIGVYCF   79 (156)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~kkVyFiR~~~~feWf-~dll~eVe~~d~~~~IhiylT   79 (156)
                      -+++++++++...=-.-+.|..+|..+.-.=+-..-..+ ..+||.      +|- +..-.+|+..   +.|++++-
T Consensus         6 ~~~~~~~~~e~~kv~~l~tv~~~g~phsRpM~f~hdg~~-~tiwf~------T~kds~~v~eik~n---~~v~v~~~   72 (145)
T COG3871           6 ALQALAELLEGSKVGMLATVQENGHPHSRPMTFNHDGPK-GTIWFF------TNKDSRKVEEIKKN---PKVCVLFG   72 (145)
T ss_pred             HHHHHHHHHhhCceEEEEEecCCCCccccceeccCCCCc-ccEEee------ccCchHHHHHHhhC---CcEEEEEe
Confidence            356666666654333334444444444322221122333 678887      333 4556677766   88888765


No 114
>PF09652 Cas_VVA1548:  Putative CRISPR-associated protein (Cas_VVA1548);  InterPro: IPR013443 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry represents a conserved region of about 95 amino acids found exclusively in species with CRISPR repeats. In all bacterial species that contain this entry, the genes encoding the proteins are in the midst of a cluster of cas genes.
Probab=23.38  E-value=28  Score=25.58  Aligned_cols=14  Identities=29%  Similarity=0.503  Sum_probs=12.9

Q ss_pred             EEE-ecCCcccchhH
Q psy8389          47 VFK-NHHGASGYTNE   60 (156)
Q Consensus        47 yFi-R~~~~feWf~d   60 (156)
                      ||| |.+|..||+..
T Consensus         1 ~fIsRH~GAieW~~~   15 (93)
T PF09652_consen    1 WFISRHPGAIEWAKQ   15 (93)
T ss_pred             CeeeecccHHHHHHH
Confidence            899 99999999966


No 115
>PRK04025 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=23.11  E-value=57  Score=25.28  Aligned_cols=21  Identities=14%  Similarity=0.380  Sum_probs=13.7

Q ss_pred             CeeEEEEeCCh-hhHHHHHhhc
Q psy8389         124 GKVTVFYCGPP-QLARILRLKC  144 (156)
Q Consensus       124 ~~VGVF~CGP~-~L~~~l~~~c  144 (156)
                      ..|+||.||+. ...+.+....
T Consensus        76 aavDIftCg~~~~p~~a~~~L~   97 (139)
T PRK04025         76 AALDVYTCGEKADPEKAVDYIL   97 (139)
T ss_pred             EEEEEEecCCCCCHHHHHHHHH
Confidence            58999999995 4444443333


No 116
>PHA02629 A-type inclusion body protein; Provisional
Probab=22.69  E-value=74  Score=21.22  Aligned_cols=20  Identities=50%  Similarity=0.926  Sum_probs=12.8

Q ss_pred             HHHHHhhhhccceecCcccCCCCC
Q psy8389          11 LLATLERKFSGKVLGGGKQNGGTG   34 (156)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~   34 (156)
                      -+|.||+|..    -||.+|||.|
T Consensus         4 kiadle~klr----d~gng~~gng   23 (61)
T PHA02629          4 KIADLEKKLR----DGGNGNGGNG   23 (61)
T ss_pred             hHHHHHHHHH----ccCCCCCCCC
Confidence            4688999865    3555555554


No 117
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the Pfam model pfam03031.
Probab=22.65  E-value=1.6e+02  Score=22.48  Aligned_cols=38  Identities=16%  Similarity=0.153  Sum_probs=31.7

Q ss_pred             cCCCChHHHHHHHHhcCCCeeEEEEeCChhhHHHHHhhcc
Q psy8389         106 AGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCD  145 (156)
Q Consensus       106 fGRPnw~~if~~v~~~~~~~VGVF~CGP~~L~~~l~~~c~  145 (156)
                      +-||-..++++.+++.  -.|+||.-|++..++.+-+.-.
T Consensus        42 ~~RPgl~eFL~~l~~~--yei~I~Ts~~~~yA~~il~~ld   79 (162)
T TIGR02251        42 FKRPHVDEFLERVSKW--YELVIFTASLEEYADPVLDILD   79 (162)
T ss_pred             EECCCHHHHHHHHHhc--CEEEEEcCCcHHHHHHHHHHHC
Confidence            3799999999999865  5899999999998877766544


No 118
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=22.64  E-value=74  Score=26.94  Aligned_cols=26  Identities=15%  Similarity=0.522  Sum_probs=15.2

Q ss_pred             HHHHHHhcCCCee-EEEEeCChhhHHH
Q psy8389         114 VFKHLLDQKKGKV-TVFYCGPPQLARI  139 (156)
Q Consensus       114 if~~v~~~~~~~V-GVF~CGP~~L~~~  139 (156)
                      +|-..+....+.+ -+.++|||+++|.
T Consensus        38 i~i~aa~~r~~~l~h~lf~GPPG~GKT   64 (233)
T PF05496_consen   38 ILIRAAKKRGEALDHMLFYGPPGLGKT   64 (233)
T ss_dssp             HHHHHHHCTTS---EEEEESSTTSSHH
T ss_pred             HHHHHHHhcCCCcceEEEECCCccchh
Confidence            3444444334444 4899999988764


No 119
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=22.22  E-value=70  Score=24.53  Aligned_cols=29  Identities=10%  Similarity=0.215  Sum_probs=21.8

Q ss_pred             hHHHHHHHHhcCCCeeEEEEeCChhhHHH
Q psy8389         111 WDRVFKHLLDQKKGKVTVFYCGPPQLARI  139 (156)
Q Consensus       111 w~~if~~v~~~~~~~VGVF~CGP~~L~~~  139 (156)
                      .+++++.+...-+....|++||++.++++
T Consensus       113 i~eL~~~l~~~l~~~~~~~~~G~~nvGKS  141 (190)
T cd01855         113 VEELINAIKKLAKKGGDVYVVGATNVGKS  141 (190)
T ss_pred             HHHHHHHHHHHhhcCCcEEEEcCCCCCHH
Confidence            57788888776555677999999886554


No 120
>PF02190 LON:  ATP-dependent protease La (LON) domain;  InterPro: IPR003111 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature defines the N-terminal domain of the archael, bacterial and eukaryotic lon proteases, which are ATP-dependent serine peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SF). In the eukaryotes the majority of the proteins are located in the mitochondrial matrix [, ]. In yeast, Pim1, is located in the mitochondrial matrix, is required for mitochondrial function, is constitutively expressed but is increased after thermal stress, suggesting that Pim1 may play a role in the heat shock response [].; GO: 0004176 ATP-dependent peptidase activity, 0006508 proteolysis; PDB: 3LJC_A 2ANE_G 1ZBO_A 3M65_A.
Probab=21.72  E-value=66  Score=24.38  Aligned_cols=36  Identities=19%  Similarity=0.311  Sum_probs=27.1

Q ss_pred             cccCCccccccCCCChHHHHHHHHhcCCCeeEEEEe
Q psy8389          96 LITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYC  131 (156)
Q Consensus        96 ~iTgLrs~ThfGRPnw~~if~~v~~~~~~~VGVF~C  131 (156)
                      ++.|.....+.++|.+.+.++.+-......||++++
T Consensus        12 lfPg~~~~i~i~~~~~~~~l~~~~~~~~~~~~i~~~   47 (205)
T PF02190_consen   12 LFPGQTLPIHIFEPRYIALLKRALDNNNPYFGIFLV   47 (205)
T ss_dssp             --TTBEEEEEE-SHHHHHHHHHHHTTTSE-EEEEEE
T ss_pred             cCCCeeEEEEECCHHHHHHHHHHHhcCCCceeEEee
Confidence            567888888999999999999888764336999999


No 121
>PRK01236 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=21.59  E-value=59  Score=24.92  Aligned_cols=11  Identities=36%  Similarity=0.915  Sum_probs=9.6

Q ss_pred             CeeEEEEeCCh
Q psy8389         124 GKVTVFYCGPP  134 (156)
Q Consensus       124 ~~VGVF~CGP~  134 (156)
                      ..|+||.||+.
T Consensus        77 aavDiftCg~~   87 (131)
T PRK01236         77 VTLDVYTCGDP   87 (131)
T ss_pred             EEEEEEecCCC
Confidence            48999999985


No 122
>PRK02770 S-adenosylmethionine decarboxylase proenzyme; Provisional
Probab=21.10  E-value=67  Score=24.90  Aligned_cols=19  Identities=26%  Similarity=0.473  Sum_probs=12.8

Q ss_pred             CeeEEEEeCCh-hhHHHHHh
Q psy8389         124 GKVTVFYCGPP-QLARILRL  142 (156)
Q Consensus       124 ~~VGVF~CGP~-~L~~~l~~  142 (156)
                      ..|+||.||+. ...+.++.
T Consensus        89 aavDiftCg~~~~p~~a~~~  108 (139)
T PRK02770         89 AAVDVFTCGDHTMPEKACQY  108 (139)
T ss_pred             EEEEEEecCCCCCHHHHHHH
Confidence            58999999995 33333333


No 123
>PRK01706 S-adenosylmethionine decarboxylase proenzyme; Validated
Probab=21.01  E-value=68  Score=24.26  Aligned_cols=11  Identities=18%  Similarity=0.748  Sum_probs=9.5

Q ss_pred             CeeEEEEeCCh
Q psy8389         124 GKVTVFYCGPP  134 (156)
Q Consensus       124 ~~VGVF~CGP~  134 (156)
                      ..|+||.||+.
T Consensus        78 aavDiftCg~~   88 (123)
T PRK01706         78 AAIDCYTCGTT   88 (123)
T ss_pred             EEEEEEecCCC
Confidence            48999999984


No 124
>KOG0733|consensus
Probab=20.90  E-value=47  Score=32.48  Aligned_cols=20  Identities=35%  Similarity=0.673  Sum_probs=15.4

Q ss_pred             eeEEEEeCChhhHHHHHhhc
Q psy8389         125 KVTVFYCGPPQLARILRLKC  144 (156)
Q Consensus       125 ~VGVF~CGP~~L~~~l~~~c  144 (156)
                      .-||+.||||+-++.|-..+
T Consensus       545 PsGvLL~GPPGCGKTLlAKA  564 (802)
T KOG0733|consen  545 PSGVLLCGPPGCGKTLLAKA  564 (802)
T ss_pred             CCceEEeCCCCccHHHHHHH
Confidence            46899999999877765444


No 125
>KOG1158|consensus
Probab=20.38  E-value=61  Score=31.26  Aligned_cols=21  Identities=14%  Similarity=0.363  Sum_probs=16.7

Q ss_pred             eEEEEeCChh-hHHHHHhhccc
Q psy8389         126 VTVFYCGPPQ-LARILRLKCDQ  146 (156)
Q Consensus       126 VGVF~CGP~~-L~~~l~~~c~~  146 (156)
                      =-||+||+.. |++.|..+-.+
T Consensus       593 g~iYvCGd~~~Ma~dV~~~L~~  614 (645)
T KOG1158|consen  593 GHIYVCGDAKGMAKDVQDALVR  614 (645)
T ss_pred             cEEEEecCCccchHHHHHHHHH
Confidence            3499999999 99988876543


Done!