Query         psy8407
Match_columns 92
No_of_seqs    184 out of 1023
Neff          8.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:58:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8407.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8407hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00405 cytochrome c; Provisi 100.0   5E-34 1.1E-38  174.8   7.8   91    2-92     24-114 (114)
  2 COG3474 Cytochrome c2 [Energy  100.0 4.9E-34 1.1E-38  176.2   6.6   90    2-91     40-131 (135)
  3 PTZ00048 cytochrome c; Provisi 100.0 2.9E-31 6.3E-36  162.9   8.6   89    2-91     25-113 (115)
  4 KOG3453|consensus               99.8 2.1E-21 4.5E-26  116.6   4.6   91    1-91     18-108 (110)
  5 PRK14487 cbb3-type cytochrome   99.6   3E-16 6.4E-21  104.5   5.0   58   15-92    101-160 (217)
  6 PRK13617 psbV cytochrome c-550  99.5 3.2E-14   7E-19   91.9   5.8   76    1-92     68-157 (170)
  7 TIGR02603 CxxCH_TIGR02603 puta  99.5   6E-14 1.3E-18   87.9   5.0   23    2-25     13-35  (133)
  8 TIGR00781 ccoO cytochrome c ox  99.4 2.9E-13 6.3E-18   90.9   4.9   58   14-91     99-158 (232)
  9 TIGR03872 cytochrome_MoxG cyto  99.4 1.4E-12 3.1E-17   81.8   6.5   70    1-92     53-123 (133)
 10 CHL00133 psbV photosystem II c  99.4 1.1E-12 2.4E-17   84.6   5.8   74    1-90     61-148 (163)
 11 PRK14486 putative bifunctional  99.4 7.5E-13 1.6E-17   92.5   5.4   57   15-91    101-187 (294)
 12 TIGR03045 PS_II_C550 cytochrom  99.4 1.2E-12 2.7E-17   84.2   5.6   75    1-91     60-148 (159)
 13 PF00034 Cytochrom_C:  Cytochro  99.3 6.9E-15 1.5E-19   84.4  -5.2   79    2-91     11-91  (91)
 14 PRK13620 psbV cytochrome c-550  99.3 4.3E-12 9.3E-17   84.1   6.3   74    1-91    113-201 (215)
 15 PRK13618 psbV cytochrome c-550  99.3 8.5E-12 1.8E-16   80.5   5.9   76    1-91     61-149 (163)
 16 PRK13621 psbV cytochrome c-550  99.2 9.4E-12   2E-16   80.4   4.3   41   50-90    109-154 (170)
 17 CHL00183 petJ cytochrome c553;  99.2 4.3E-11 9.2E-16   72.3   4.4   69    1-91     35-104 (108)
 18 TIGR03874 4cys_cytochr c-type   99.2 1.1E-10 2.3E-15   74.0   6.1   68    2-90     43-115 (143)
 19 TIGR03046 PS_II_psbV2 photosys  99.1 4.6E-11 9.9E-16   76.5   4.0   41   50-90     98-143 (155)
 20 PF13442 Cytochrome_CBB3:  Cyto  99.1 1.2E-11 2.7E-16   68.6   1.0   54    2-87     13-67  (67)
 21 PRK13697 cytochrome c6; Provis  99.1 7.3E-11 1.6E-15   71.4   4.1   68    2-91     38-106 (111)
 22 TIGR00782 ccoP cytochrome c ox  99.1 2.9E-10 6.3E-15   79.0   7.1   69    1-91    212-282 (285)
 23 TIGR00782 ccoP cytochrome c ox  98.9 2.5E-09 5.4E-14   74.4   6.1   70    2-91    117-193 (285)
 24 PRK14486 putative bifunctional  98.9 3.1E-09 6.7E-14   74.4   5.9   67    2-92    225-292 (294)
 25 COG2863 Cytochrome c553 [Energ  98.9 3.1E-09 6.7E-14   65.5   4.2   66    2-91     34-101 (121)
 26 COG2857 CYT1 Cytochrome c1 [En  98.8   8E-09 1.7E-13   70.9   5.7   78    2-91    133-213 (250)
 27 PF02433 FixO:  Cytochrome C ox  98.7 2.1E-08 4.5E-13   67.5   3.8   56   15-90    100-157 (226)
 28 COG2010 CccA Cytochrome c, mon  98.6 4.1E-08   9E-13   61.6   4.0   24    1-24     60-85  (150)
 29 COG4654 Cytochrome c551/c552 [  98.6 3.1E-08 6.8E-13   59.1   3.1   72    1-90     33-105 (110)
 30 PRK13619 psbV cytochrome c-550  98.6   1E-07 2.2E-12   61.1   4.6   75    2-91     61-148 (160)
 31 PRK14485 putative bifunctional  98.5 4.1E-07 8.9E-12   70.1   6.2   56   15-90    587-647 (712)
 32 PRK13622 psbV cytochrome c-550  98.4 6.9E-07 1.5E-11   58.6   5.8   42   49-90    104-158 (180)
 33 COG2993 CcoO Cbb3-type cytochr  98.4 1.7E-07 3.8E-12   62.0   2.7   58   14-91    101-160 (227)
 34 COG3258 Cytochrome c [Energy p  97.9 1.6E-05 3.4E-10   54.9   4.3   34   51-92    215-253 (293)
 35 TIGR03791 TTQ_mauG tryptophan   97.8 0.00019   4E-09   50.5   8.2   47   44-91    231-279 (291)
 36 PF14495 Cytochrom_C550:  Cytoc  97.3 0.00015 3.2E-09   45.3   2.3   42   49-90     67-121 (135)
 37 PF09098 Dehyd-heme_bind:  Quin  96.9 0.00039 8.5E-09   45.0   1.2   15   75-89     51-65  (167)
 38 TIGR03806 chp_HNE_0200 conserv  96.3   0.011 2.4E-07   42.1   5.2   26   65-90    290-317 (317)
 39 COG3258 Cytochrome c [Energy p  96.2    0.01 2.2E-07   41.3   4.4   73    2-91     64-136 (293)
 40 PF10643 Cytochrome-c551:  Phot  96.0  0.0019 4.1E-08   43.4   0.0   20   69-89    212-231 (233)
 41 COG3748 Predicted membrane pro  95.9  0.0085 1.8E-07   43.0   2.9   65    2-90    334-403 (407)
 42 COG3245 CycB Cytochrome c5 [En  95.8    0.04 8.8E-07   34.0   5.2   24   67-90     98-124 (126)
 43 PF09086 DUF1924:  Domain of un  94.9   0.008 1.7E-07   35.8   0.1   33   49-87     66-98  (98)
 44 PF14376 Haem_bd:  Haem-binding  94.6   0.027 5.9E-07   35.4   2.1   17   74-90    120-136 (137)
 45 PF02167 Cytochrom_C1:  Cytochr  88.8    0.13 2.8E-06   35.0   0.1   42   49-90    112-182 (219)
 46 PF02167 Cytochrom_C1:  Cytochr  88.5     1.9 4.2E-05   29.3   5.6    9    2-10     25-33  (219)
 47 TIGR02162 torC trimethylamine-  87.9     0.4 8.7E-06   35.2   2.1   20   70-90    358-377 (386)
 48 PF07635 PSCyt1:  Planctomycete  85.3    0.53 1.2E-05   25.2   1.2   10    3-12      1-10  (59)
 49 PRK15032 trimethylamine N-oxid  82.4       1 2.2E-05   33.2   2.0   20   70-90    355-374 (390)
 50 PF09722 DUF2384:  Protein of u  79.2     1.7 3.7E-05   22.6   1.7   42   49-91     10-51  (54)
 51 PF02433 FixO:  Cytochrome C ox  75.8     1.8 3.9E-05   29.6   1.5   16   76-91    207-222 (226)
 52 PRK14487 cbb3-type cytochrome   74.6     2.2 4.8E-05   29.0   1.7   15   77-91    193-207 (217)
 53 TIGR00781 ccoO cytochrome c ox  74.1     2.3   5E-05   29.2   1.7   15   77-91    207-221 (232)
 54 COG1858 MauG Cytochrome c pero  73.2     8.5 0.00018   28.2   4.5   11    1-11    231-241 (364)
 55 PF06537 DUF1111:  Protein of u  71.7     2.5 5.4E-05   32.2   1.5   19   71-90    481-499 (499)
 56 cd07321 Extradiol_Dioxygenase_  71.3       2 4.3E-05   24.4   0.8   32   48-85     14-45  (77)
 57 PRK11586 napB nitrate reductas  69.0       2 4.3E-05   27.5   0.5   11    1-11     81-91  (149)
 58 COG3043 NapB Nitrate reductase  68.6     1.6 3.4E-05   28.1  -0.1   11    1-11     87-97  (155)
 59 PF03150 CCP_MauG:  Di-haem cyt  67.9    0.94   2E-05   29.1  -1.2   17   74-90    125-141 (159)
 60 PF06943 zf-LSD1:  LSD1 zinc fi  66.8     2.4 5.2E-05   19.0   0.4    8    2-9      18-25  (25)
 61 PF07627 PSCyt3:  Protein of un  66.3     1.1 2.3E-05   26.9  -1.1    9    2-10     71-79  (101)
 62 KOG3052|consensus               64.5     1.4 3.1E-05   30.8  -0.9   14   77-90    249-262 (311)
 63 cd07922 CarBa CarBa is the A s  63.9     3.1 6.6E-05   24.0   0.5   33   46-84     13-45  (81)
 64 TIGR01905 paired_CXXCH_1 doubl  63.5     3.3 7.2E-05   20.6   0.6   10    2-11      8-17  (41)
 65 PF11845 DUF3365:  Protein of u  61.4     2.1 4.5E-05   27.6  -0.5    8    1-8     147-154 (188)
 66 PF09832 DUF2059:  Uncharacteri  61.0     7.8 0.00017   20.6   1.8   15   75-89     17-31  (64)
 67 PF07583 PSCyt2:  Protein of un  60.5     3.1 6.6E-05   28.0   0.2    9    2-10    176-184 (208)
 68 PF07128 DUF1380:  Protein of u  58.6      22 0.00048   22.6   3.8   34   46-90     25-58  (139)
 69 PF09699 Paired_CXXCH_1:  Doubl  57.9       3 6.5E-05   20.4  -0.2   10    2-11      8-17  (41)
 70 TIGR02161 napC_nirT periplasmi  57.6       4 8.6E-05   27.0   0.3   10    1-10    136-145 (185)
 71 PRK10617 cytochrome c-type pro  55.0       5 0.00011   26.9   0.4   10    1-10    145-154 (200)
 72 COG3005 TorC Nitrate/TMAO redu  54.0       4 8.7E-05   27.2  -0.1   11    1-11    135-145 (190)
 73 TIGR01053 LSD1 zinc finger dom  53.4     5.2 0.00011   18.8   0.2    9    2-10     21-29  (31)
 74 PHA02119 hypothetical protein   52.4      10 0.00022   21.4   1.3   10   81-90     57-66  (87)
 75 TIGR02251 HIF-SF_euk Dullard-l  51.5      22 0.00048   22.5   3.0   24   69-92    136-159 (162)
 76 PF03892 NapB:  Nitrate reducta  51.4     3.2   7E-05   26.1  -0.8   10    2-11     71-80  (133)
 77 cd07921 PCA_45_Doxase_A_like S  50.5     8.6 0.00019   23.3   0.9   31   49-85     25-55  (106)
 78 PF13821 DUF4187:  Domain of un  48.6      16 0.00035   19.4   1.7   17   74-90     10-26  (55)
 79 KOG1200|consensus               47.4      23 0.00049   24.4   2.6   20   70-89    218-237 (256)
 80 PF13435 Cytochrome_C554:  Cyto  47.4     8.4 0.00018   22.3   0.6   11    1-11     49-59  (130)
 81 PF14522 Cytochrome_C7:  Cytoch  46.6     9.7 0.00021   19.9   0.7    9    2-10     14-22  (65)
 82 PF11829 DUF3349:  Protein of u  45.5     7.2 0.00016   23.2   0.1   14   75-88     36-49  (96)
 83 PRK14485 putative bifunctional  44.0      15 0.00033   29.3   1.6   46   45-91    648-698 (712)
 84 PF08090 Enterotoxin_HS1:  Heat  43.0     9.6 0.00021   18.1   0.3    9    2-10     21-29  (36)
 85 PF15182 OTOS:  Otospiralin      42.9      52  0.0011   18.2   3.1   24   67-91     15-38  (69)
 86 TIGR02245 HAD_IIID1 HAD-superf  42.7      50  0.0011   22.0   3.7   36   54-91    140-179 (195)
 87 cd02642 R3H_encore_like R3H do  42.7      16 0.00035   19.6   1.2   13   49-61      8-20  (63)
 88 TIGR02826 RNR_activ_nrdG3 anae  42.6      61  0.0013   20.4   4.0   10    2-11     28-37  (147)
 89 PF07746 LigA:  Aromatic-ring-o  41.8     6.7 0.00015   22.9  -0.4   31   48-84      9-39  (88)
 90 PF13822 ACC_epsilon:  Acyl-CoA  41.2      40 0.00088   18.1   2.6   18   73-90      9-26  (62)
 91 TIGR03153 cytochr_NrfH cytochr  39.9     6.9 0.00015   24.4  -0.6   10    1-10    103-112 (135)
 92 PF14537 Cytochrom_c3_2:  Cytoc  39.2      14 0.00031   19.9   0.6    9    2-10      8-16  (80)
 93 COG5204 SPT4 Transcription elo  39.0      45 0.00097   20.0   2.7   34   49-83     62-96  (112)
 94 CHL00037 petA cytochrome f      38.9      10 0.00022   27.1   0.0    9    3-11     56-64  (320)
 95 PF03264 Cytochrom_NNT:  NapC/N  38.9       9 0.00019   24.7  -0.3   10    2-11     37-46  (173)
 96 PF15161 Neuropep_like:  Neurop  38.4     7.3 0.00016   21.0  -0.6   10    1-10     14-23  (65)
 97 COG3445 Acid-induced glycyl ra  38.2      33 0.00071   20.7   2.1   38   47-85     77-120 (127)
 98 PRK02693 apocytochrome f; Revi  37.6      11 0.00024   26.7   0.1    9    3-11     49-57  (312)
 99 COG2996 Predicted RNA-bindinin  36.7      36 0.00078   24.2   2.4   31   49-84    226-256 (287)
100 PF14769 CLAMP:  Flagellar C1a   36.6      44 0.00095   19.6   2.5   18   72-89     61-78  (101)
101 COG1579 Zn-ribbon protein, pos  36.5      14 0.00031   25.5   0.4   11    1-11    198-208 (239)
102 PRK06393 rpoE DNA-directed RNA  36.4      19 0.00042   19.8   0.9   11    1-11      6-16  (64)
103 PF12797 Fer4_2:  4Fe-4S bindin  36.1      16 0.00034   15.8   0.4    7    2-8       9-15  (22)
104 PF10281 Ish1:  Putative stress  36.1      54  0.0012   15.6   3.8   13   47-59      3-15  (38)
105 PF02375 JmjN:  jmjN domain;  I  35.6      17 0.00036   17.4   0.5   16   76-91      6-21  (34)
106 cd07923 Gallate_dioxygenase_C   35.4      18 0.00039   21.5   0.7   30   49-84     17-46  (94)
107 PF08263 LRRNT_2:  Leucine rich  33.3      44 0.00096   16.1   1.9   15   77-91      2-16  (43)
108 COG1137 YhbG ABC-type (unclass  32.9      88  0.0019   21.7   3.7   20   70-89    166-187 (243)
109 KOG3831|consensus               31.2      40 0.00087   21.9   1.8   44   46-89     94-147 (196)
110 COG3488 Predicted thiol oxidor  31.1      36 0.00079   25.1   1.8   19   71-90    463-481 (481)
111 PF11256 DUF3055:  Protein of u  31.1      56  0.0012   18.8   2.2   18   72-90     64-81  (81)
112 PRK13767 ATP-dependent helicas  30.8      92   0.002   25.4   4.1   35   46-89    440-474 (876)
113 smart00545 JmjN Small domain f  30.7      33 0.00072   17.1   1.1   16   76-91      8-23  (42)
114 COG3183 Predicted restriction   30.4      13 0.00028   26.1  -0.5    8    3-10    244-251 (272)
115 PF10180 DUF2373:  Uncharacteri  30.0      68  0.0015   17.5   2.4   17   75-91     34-50  (65)
116 PF00432 Prenyltrans:  Prenyltr  29.5      58  0.0013   15.8   1.9   12   79-90      2-13  (44)
117 PF06883 RNA_pol_Rpa2_4:  RNA p  28.9      61  0.0013   17.3   2.0   17   75-91      4-20  (58)
118 TIGR03146 cyt_nit_nrfB cytochr  28.4      20 0.00043   22.5   0.1   10    2-11    111-120 (145)
119 PF04320 DUF469:  Protein with   28.4      62  0.0013   19.4   2.2   19   73-91     68-86  (101)
120 PRK08340 glucose-1-dehydrogena  28.0      67  0.0015   21.3   2.6   20   70-89    217-236 (259)
121 PF02085 Cytochrom_CIII:  Class  27.8      35 0.00077   19.7   1.1   10    2-11     49-58  (102)
122 KOG1605|consensus               27.7 1.1E+02  0.0024   21.4   3.7   35   55-91    213-247 (262)
123 PF15573 Imm27:  Immunity prote  27.7      58  0.0013   22.6   2.2   26   66-91    216-243 (259)
124 PF08538 DUF1749:  Protein of u  27.7      41 0.00088   24.1   1.5   15   76-90     86-100 (303)
125 PF14410 GH-E:  HNH/ENDO VII su  27.7      58  0.0013   18.0   1.9   21   45-65     38-58  (70)
126 COG1250 FadB 3-hydroxyacyl-CoA  27.7 1.6E+02  0.0035   21.1   4.6   44   49-92    122-176 (307)
127 PF09383 NIL:  NIL domain;  Int  27.0      68  0.0015   17.4   2.1   15   76-90     55-69  (76)
128 PRK11659 cytochrome c nitrite   26.5      21 0.00045   23.5  -0.1   10    2-11    134-143 (183)
129 PF14566 PTPlike_phytase:  Inos  26.3      63  0.0014   20.2   2.1   16   76-91    107-122 (149)
130 PF13561 adh_short_C2:  Enoyl-(  26.1      40 0.00086   22.2   1.2   20   70-89    204-223 (241)
131 PF13099 DUF3944:  Domain of un  25.9      78  0.0017   15.3   1.9   14   75-88     13-26  (35)
132 PRK06603 enoyl-(acyl carrier p  25.8      82  0.0018   21.1   2.7   20   70-89    216-235 (260)
133 cd08168 Cytochrom_C3 Heme-bind  25.5      32 0.00068   19.2   0.6    9    2-10     35-43  (85)
134 COG5469 Predicted metal-bindin  25.2      48   0.001   21.1   1.4   20    2-22     22-41  (143)
135 PF11427 HTH_Tnp_Tc3_1:  Tc3 tr  25.1      74  0.0016   16.5   1.9   18   46-63     30-47  (50)
136 PF11165 DUF2949:  Protein of u  24.3 1.3E+02  0.0028   16.2   3.2   40   49-88     16-57  (58)
137 PRK02955 small acid-soluble sp  23.9 1.3E+02  0.0029   16.7   2.8   42   48-89     16-65  (68)
138 PF13986 DUF4224:  Domain of un  23.8      47   0.001   16.9   1.0   13   74-86      2-14  (47)
139 CHL00136 rpl31 ribosomal prote  23.8      35 0.00076   18.9   0.5   10    2-11     37-46  (68)
140 cd06395 PB1_Map2k5 PB1 domain   23.7      82  0.0018   18.3   2.0   16   74-89     56-71  (91)
141 PF09256 BaffR-Tall_bind:  BAFF  23.4      17 0.00037   17.0  -0.7   10    1-10     15-24  (31)
142 PF10955 DUF2757:  Protein of u  23.3      25 0.00055   20.0  -0.1   16   71-87     29-44  (76)
143 COG0411 LivG ABC-type branched  23.2      88  0.0019   21.9   2.5   21   70-91    176-196 (250)
144 PF14098 SSPI:  Small, acid-sol  23.1      98  0.0021   17.1   2.2   41   49-89     15-63  (65)
145 TIGR03092 SASP_sspI small, aci  23.0      88  0.0019   17.3   2.0   42   48-89     13-62  (65)
146 PF10058 DUF2296:  Predicted in  23.0      35 0.00075   18.0   0.4   10    3-12     25-34  (54)
147 PRK05867 short chain dehydroge  22.9      96  0.0021   20.4   2.6   18   72-89    216-233 (253)
148 PF15614 WHIM3:  WSTF, HB1, Itc  22.8   1E+02  0.0022   15.8   2.1   13   75-87      5-17  (46)
149 PF13453 zf-TFIIB:  Transcripti  22.8      36 0.00079   16.5   0.4    7    3-9      22-28  (41)
150 PRK00019 rpmE 50S ribosomal pr  22.5      38 0.00083   19.0   0.5    9    3-11     38-46  (72)
151 PF09626 DHC:  Dihaem cytochrom  22.2      99  0.0021   19.0   2.3   16   75-90     39-54  (120)
152 KOG2112|consensus               22.0      90  0.0019   21.2   2.3   26   66-91    177-205 (206)
153 PF14982 UPF0731:  UPF0731 fami  21.6      41  0.0009   18.9   0.5   10    1-10     44-53  (79)
154 PF02335 Cytochrom_C552:  Cytoc  21.5      33 0.00072   25.8   0.1    7    2-8     274-280 (434)
155 TIGR02894 DNA_bind_RsfA transc  21.4      62  0.0013   21.1   1.4   12   80-91     82-93  (161)
156 PF07102 DUF1364:  Protein of u  21.4      15 0.00034   21.7  -1.3   10    2-11     53-62  (94)
157 TIGR03152 cyto_c552_HCOOH form  21.0      48   0.001   25.0   0.9   10    2-11    122-131 (439)
158 PRK02289 4-oxalocrotonate taut  20.8 1.3E+02  0.0028   15.6   2.4   14   73-87     11-24  (60)
159 PF05927 Penaeidin:  Penaeidin;  20.6      49  0.0011   18.5   0.7    9    2-10     45-53  (73)
160 KOG3309|consensus               20.6      32 0.00069   22.3  -0.1   10    2-11     86-95  (159)
161 PRK06997 enoyl-(acyl carrier p  20.5 1.1E+02  0.0024   20.5   2.5   21   70-90    215-235 (260)
162 PRK11702 hypothetical protein;  20.5 1.3E+02  0.0027   18.3   2.5   17   73-89     75-91  (108)
163 PF01645 Glu_synthase:  Conserv  20.3 1.7E+02  0.0036   21.6   3.5   22   70-91    180-201 (368)
164 PF07845 DUF1636:  Protein of u  20.2      52  0.0011   20.1   0.8   19   71-89     70-88  (116)
165 PRK12481 2-deoxy-D-gluconate 3  20.1 1.3E+02  0.0027   20.0   2.7   20   70-89    212-231 (251)
166 PF14053 DUF4248:  Domain of un  20.1      96  0.0021   17.1   1.8   38   51-88     26-67  (69)

No 1  
>PTZ00405 cytochrome c; Provisional
Probab=100.00  E-value=5e-34  Score=174.84  Aligned_cols=91  Identities=57%  Similarity=1.048  Sum_probs=85.8

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERG   81 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~   81 (92)
                      +|.+||++...+...+||+|.||++|..++.++|.||.++++.+++|+++.|..||.+|+.++||+.|+|.++.+++|++
T Consensus        24 ~C~aCH~~~~~~~~~vGP~L~gv~gR~~g~~~~~~YS~al~~~g~~wd~~~L~~~l~~P~~~~pgt~M~f~gl~~~~dr~  103 (114)
T PTZ00405         24 RAAQCHTATKGGSNGVGPNLFGIVNRKSGTVEGFAYSKANADSGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERA  103 (114)
T ss_pred             hhHhhCCCCCCCCCCcCCCccccccCccccccCccccHHHHhccCcCCHHHHHHHHHCHHhhCCCCCCCCCCCCCHHHHH
Confidence            69999998765557899999999999999999999999999999999999999999999999999999999999899999


Q ss_pred             HHHHHHhhccC
Q psy8407          82 DLIAYLEQASK   92 (92)
Q Consensus        82 ~liayL~sl~~   92 (92)
                      +||+||++|+.
T Consensus       104 ~liaYL~sl~~  114 (114)
T PTZ00405        104 DVIAYLETLKD  114 (114)
T ss_pred             HHHHHHHHhcC
Confidence            99999999873


No 2  
>COG3474 Cytochrome c2 [Energy production and conversion]
Probab=100.00  E-value=4.9e-34  Score=176.20  Aligned_cols=90  Identities=58%  Similarity=1.079  Sum_probs=86.7

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhc--CccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKK--GITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQE   79 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~--~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d   79 (92)
                      .|.+||+++.++...+||+|.+|+||+.++.+||.||.++++.  +++|+++.|..||.+|.+++|||.|.|.++.+++|
T Consensus        40 kC~~CH~i~~~g~nkvGP~L~gVvGR~ags~egf~YS~Amk~~~~g~vWd~~~L~~fL~~Pkk~vpGTkM~faGlkk~~d  119 (135)
T COG3474          40 KCQACHSIEKGGPNKVGPHLWGVVGRPAGSVEGFSYSAAMKKAGGGIVWDEDNLDEFLTAPKKYVPGTKMAFAGLKKDQD  119 (135)
T ss_pred             HHHHhhccccCCCCCCCCccccccCccccccCCcccCHHHHhccCCcccCHHHHHHHHhChhhhCCCcceeecCCCCHHH
Confidence            5999999998778899999999999999999999999999988  89999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcc
Q psy8407          80 RGDLIAYLEQAS   91 (92)
Q Consensus        80 ~~~liayL~sl~   91 (92)
                      |+|||+||+++.
T Consensus       120 radlIAYLk~~~  131 (135)
T COG3474         120 RADLIAYLKSLP  131 (135)
T ss_pred             HHHHHHHHHhcc
Confidence            999999999875


No 3  
>PTZ00048 cytochrome c; Provisional
Probab=99.97  E-value=2.9e-31  Score=162.92  Aligned_cols=89  Identities=67%  Similarity=1.183  Sum_probs=83.8

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERG   81 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~   81 (92)
                      +|.+||++++.+...+||+|.||++|..++ ++|.|+.+++.+++.|+++.|.+||.||+.++|++.|+|.++.+++|++
T Consensus        25 ~C~~CH~~~~~g~~~~GP~L~Gi~gR~~g~-~~~~ys~~~~~~g~~wt~~~L~~~l~~P~~~~pgt~M~~~gl~~~~~~~  103 (115)
T PTZ00048         25 KCAQCHTINKGGAVKQGPNLHGFYGRKSGS-ADFPYSDANKNSGIVWSDKHLFEYLVNPKLYIPGTKMVFAGIKKEKERA  103 (115)
T ss_pred             hhhhcCCCcCCCCCCcCCcccccccccccC-CCCccchhhhhcccccCHHHHHHHHhCcCccCCCCccCcCCCCCHHHHH
Confidence            699999998766678999999999999988 8999999998889999999999999999999999999999999899999


Q ss_pred             HHHHHHhhcc
Q psy8407          82 DLIAYLEQAS   91 (92)
Q Consensus        82 ~liayL~sl~   91 (92)
                      +||+||++++
T Consensus       104 ~liaYL~s~~  113 (115)
T PTZ00048        104 DLIAYLKEAS  113 (115)
T ss_pred             HHHHHHHHhc
Confidence            9999999985


No 4  
>KOG3453|consensus
Probab=99.84  E-value=2.1e-21  Score=116.63  Aligned_cols=91  Identities=74%  Similarity=1.263  Sum_probs=85.5

Q ss_pred             CCCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHH
Q psy8407           1 MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQER   80 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~   80 (92)
                      +.|..||+++..+.-.+||+|.++.+|..+...+|.|+.+++..|+.|.++.|.++|.+|..++||+.|-|.++-...|+
T Consensus        18 ~rc~qch~~~~~~~~k~~p~l~gl~g~~~g~~~~~sy~~a~KnKgV~wgE~tl~eyLenpkkyipGtKmifaGikk~~er   97 (110)
T KOG3453|consen   18 QRCAQCHTVEKGGFHKTGPNLHGLFGRQLGQAAGLSYTDANKNKGVTWGEDTLMEYLENPKKYIPGTKMIFAGIKKKAER   97 (110)
T ss_pred             eeccccccccCCcccccCCcchhhHHHhhccccCcceeecccCCceEEcchhHHHHHhCCCccccccceeecccCchHHH
Confidence            47999999998667789999999999999999999999999999999999999999999999999999999999877999


Q ss_pred             HHHHHHHhhcc
Q psy8407          81 GDLIAYLEQAS   91 (92)
Q Consensus        81 ~~liayL~sl~   91 (92)
                      .|+|+||.+.+
T Consensus        98 aDlIayl~ka~  108 (110)
T KOG3453|consen   98 ADLIAYLKKAT  108 (110)
T ss_pred             HHHHHHHHHhc
Confidence            99999998754


No 5  
>PRK14487 cbb3-type cytochrome c oxidase subunit II; Provisional
Probab=99.64  E-value=3e-16  Score=104.46  Aligned_cols=58  Identities=19%  Similarity=0.239  Sum_probs=48.9

Q ss_pred             CCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH--HHHHHHhhccC
Q psy8407          15 HKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERG--DLIAYLEQASK   92 (92)
Q Consensus        15 ~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~--~liayL~sl~~   92 (92)
                      .++||||+++++|.                    +.+++..||.||+.++|++.||-...+.+++++  +|.+||+++++
T Consensus       101 ~RtGPDLt~vG~R~--------------------s~~w~~~hl~nP~~v~PgS~MPay~~L~~~~ld~~~~~~~l~~l~~  160 (217)
T PRK14487        101 KRTGPDLARVGGRY--------------------SDEWHRNHLINPRSVVPESNMPAYPWLAENDLDGTDTAEKMTALRV  160 (217)
T ss_pred             CCCCcchhhhhccC--------------------CHHHHHHHHhCcccCCCCCCCCCCcccccccCCHHHHHHHHHHhhh
Confidence            47999999998875                    589999999999999999999954434477766  99999999863


No 6  
>PRK13617 psbV cytochrome c-550; Provisional
Probab=99.51  E-value=3.2e-14  Score=91.95  Aligned_cols=76  Identities=22%  Similarity=0.292  Sum_probs=56.2

Q ss_pred             CCCccCccccCC-CCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCC---------CCC---
Q psy8407           1 MKCAQCHTIEAG-GAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYI---------PGT---   67 (92)
Q Consensus         1 ~~C~~CH~~~~~-~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~---------p~~---   67 (92)
                      .+|.+||.+.+. ..+.+||+|..+..-.                ...-+.+.|.+||+||+.+.         |+.   
T Consensus        68 ~~C~~CH~~g~T~~n~~vg~dL~~L~aa~----------------p~r~nv~aLv~yikdP~sydg~~s~~e~~P~~~~~  131 (170)
T PRK13617         68 TSCGTCHAGGITKTNQNVGLDPETLALAT----------------PARDNVDALVDYLKDPTSYDGEYSIADLHPSMRSA  131 (170)
T ss_pred             cchhhhccCCCcCCCCCcCCCHHHHhccC----------------CCCCCHHHHHHHHhChHhhcchhhccccCcccccc
Confidence            379999988863 2458999996653211                01236899999999997766         654   


Q ss_pred             -CCCCCCCCCHHHHHHHHHHHhhccC
Q psy8407          68 -KMIFAGIKKPQERGDLIAYLEQASK   92 (92)
Q Consensus        68 -~Mp~~~~~~~~d~~~liayL~sl~~   92 (92)
                       .||-...++++|+++|++||..++|
T Consensus       132 ~imP~~~~LsdeeL~alAayLl~~~k  157 (170)
T PRK13617        132 DLYPAMRDLNDEDLRLMAGYILVAPK  157 (170)
T ss_pred             ccCcccCCCCHHHHHHHHHHHHhccc
Confidence             7885444569999999999998854


No 7  
>TIGR02603 CxxCH_TIGR02603 putative heme-binding domain, Pirellula/Verrucomicrobium type. This model represents a domain limited to very few species but expanded into large paralogous families in some species that conain it. We find it in over 20 copies each in Pirellula sp. strain 1 (phylum Planctomycetes) and Verrucomicrobium spinosum DSM 4136 (phylum Verrucomicrobia), and no matches above trusted cutoff an any other species so far. This domain, about 140 amino acids long, contains an absolutely conserved motif CxxCH, the cytochrome c family heme-binding site signature (PS00190).
Probab=99.48  E-value=6e-14  Score=87.92  Aligned_cols=23  Identities=43%  Similarity=0.915  Sum_probs=19.6

Q ss_pred             CCccCccccCCCCCCCCCCccCcc
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLI   25 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~   25 (92)
                      +|.+||++++.+ ..+||+|.++.
T Consensus        13 ~C~~CH~~~g~g-~~~gP~L~~~~   35 (133)
T TIGR02603        13 RCYVCHRIGGEG-VDVGPDLTGVG   35 (133)
T ss_pred             HHHHhCCCCCCC-CccCCCccccc
Confidence            599999999754 57899999985


No 8  
>TIGR00781 ccoO cytochrome c oxidase, cbb3-type, subunit II. This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups).
Probab=99.41  E-value=2.9e-13  Score=90.87  Aligned_cols=58  Identities=17%  Similarity=0.230  Sum_probs=43.7

Q ss_pred             CCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHH--HHHHHHHHHhhcc
Q psy8407          14 AHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQ--ERGDLIAYLEQAS   91 (92)
Q Consensus        14 ~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~--d~~~liayL~sl~   91 (92)
                      .+++||||+.+++|.                    +.+|+..||.||+.+.|++.||....+.++  |..++.+.|+.++
T Consensus        99 s~RtGPDLt~vG~R~--------------------s~~wh~~hl~nPr~v~PgSiMP~y~~L~~~~ld~~~~~~~~~~~~  158 (232)
T TIGR00781        99 SKRTGPDLARVGGRY--------------------SDEWHVKHLFDPRSVVPESIMPAYKHLATKKVDVDTAYAEAKTQK  158 (232)
T ss_pred             CCCcCcCcccccccC--------------------CHHHHHHHHhCccccCCCCCCCCCcccccccCCHHHHHHHHHHHH
Confidence            358999999998875                    578999999999999999999943322233  3446677776654


No 9  
>TIGR03872 cytochrome_MoxG cytochrome c(L), periplasmic. This model describes a periplasmic c-type cytochrome that serves as the primary electron acceptor for the quinoprotein methanol dehydrogenase, a PQQ enzyme. The member from Paracoccus denitrificans is also characterized as an electron acceptor for methylamine dehydrogenase, a tryptophan tryptophylquinone enzyme. This protein is called cytochrome c(L) in methylotrophic bacteria such Methylobacterium extorquens, but c551i in Paracoccus denitrificans.
Probab=99.38  E-value=1.4e-12  Score=81.82  Aligned_cols=70  Identities=21%  Similarity=0.238  Sum_probs=47.9

Q ss_pred             CCCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHHH
Q psy8407           1 MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQE   79 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~d   79 (92)
                      ++|++||..++.  +.+||+|.+......         .       .-..+.|.+.|.+..    ..+|| |...++++|
T Consensus        53 ~~CAaCHG~~g~--G~~gP~L~~~~~~~~---------~-------~~~~~~l~~~i~~G~----~g~Mp~~~~~Lsdee  110 (133)
T TIGR03872        53 TACSGCHGHLAE--GKLGPGLNDDYWTYP---------K-------NTTDKGLFETIFGGA----NGMMGPQYGNLTLDE  110 (133)
T ss_pred             HhhHHhCCCCCC--CCCCCCCcCcccccC---------C-------cccHHHHHHHHHcCC----CCCCcccccCCCHHH
Confidence            379999999864  457899987432111         0       013455777776542    23686 556677999


Q ss_pred             HHHHHHHHhhccC
Q psy8407          80 RGDLIAYLEQASK   92 (92)
Q Consensus        80 ~~~liayL~sl~~   92 (92)
                      |.+|++||+++++
T Consensus       111 I~aLaaYI~sl~~  123 (133)
T TIGR03872       111 MLQIMAWIRHLYT  123 (133)
T ss_pred             HHHHHHHHHHhCC
Confidence            9999999999864


No 10 
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=99.38  E-value=1.1e-12  Score=84.58  Aligned_cols=74  Identities=15%  Similarity=0.151  Sum_probs=50.7

Q ss_pred             CCCccCccccCC-CCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCC-------------CCCC
Q psy8407           1 MKCAQCHTIEAG-GAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKK-------------YIPG   66 (92)
Q Consensus         1 ~~C~~CH~~~~~-~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~-------------~~p~   66 (92)
                      ++|++||..... ....+||+|..+.+-.                ....+.++|.+||+||+.             ..++
T Consensus        61 ~~CaaCH~~G~~~~~p~vgl~l~~L~~A~----------------~~r~~~~~Lv~~iknP~~ydg~~~i~~~~~~~K~~  124 (163)
T CHL00133         61 ASCGACHVGGITKTNPNVGLDPEALSLAT----------------PPRDNIEALVDYMKNPTTYDGLESIAEIHPSIKSA  124 (163)
T ss_pred             hhHHHhCCCCCCCCCCCCCCCHHHHhhcC----------------CCcccHHHHHHHHhCcccccchHHHHHhhcccCcc
Confidence            479999963211 1335566666553310                012368999999999987             4566


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHhhc
Q psy8407          67 TKMIFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        67 ~~Mp~~~~~~~~d~~~liayL~sl   90 (92)
                      ..||..+.++++|+++|++||...
T Consensus       125 ~~MPa~~~LsdeEL~aVAaYIl~q  148 (163)
T CHL00133        125 DIFPKMRSLTDEDLYAIAGHILLQ  148 (163)
T ss_pred             ccCCCCCCCCHHHHHHHHHHHHhc
Confidence            789955656699999999999754


No 11 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=99.38  E-value=7.5e-13  Score=92.47  Aligned_cols=57  Identities=21%  Similarity=0.493  Sum_probs=45.1

Q ss_pred             CCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CC----C-CC-------------
Q psy8407          15 HKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FA----G-IK-------------   75 (92)
Q Consensus        15 ~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~----~-~~-------------   75 (92)
                      .++||+|+++++|.                    +++|+..+|.||+.+.|++.|| |.    . +.             
T Consensus       101 ~r~GPDL~~vG~r~--------------------~~~w~~~~l~~P~~~~p~s~MP~~~~l~~~~~~~~~~~~~~~~~~~  160 (294)
T PRK14486        101 KRTGPDLARIGGKY--------------------PDAWHYAHFEDPQAVVPRSNMPAYAFLKGKPLDAALTQRKMRALGF  160 (294)
T ss_pred             CCCCCchhhhcccC--------------------CHHHHHHHHhCcccCCCCCCCCCCHHHhhccCcHHHHHHhhhhcCC
Confidence            57899999988775                    6899999999999999999998 21    1 10             


Q ss_pred             --C---------HHHHHHHHHHHhhcc
Q psy8407          76 --K---------PQERGDLIAYLEQAS   91 (92)
Q Consensus        76 --~---------~~d~~~liayL~sl~   91 (92)
                        +         ..|+++|++||++|.
T Consensus       161 py~~~~~~~~~~~~e~~AlvAYl~~L~  187 (294)
T PRK14486        161 PYTDADLAALAGKTEMDAMVAYMQSLG  187 (294)
T ss_pred             CCCHHHHHHhcccHHHHHHHHHHHHhc
Confidence              1         136789999999885


No 12 
>TIGR03045 PS_II_C550 cytochrome c-550. Members of this protein family are cytochrome c-550, the PsbV extrinsic protein of photosystem II, from both Cyanobacteria and chloroplasts. A paralog to this protein, PsbV2, is found in some species in addition to PsbV itself.
Probab=99.37  E-value=1.2e-12  Score=84.17  Aligned_cols=75  Identities=16%  Similarity=0.193  Sum_probs=52.0

Q ss_pred             CCCccCccccCC-CCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCC-------------CCC
Q psy8407           1 MKCAQCHTIEAG-GAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKY-------------IPG   66 (92)
Q Consensus         1 ~~C~~CH~~~~~-~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~-------------~p~   66 (92)
                      ++|++||..... ....+||+|..+.+-..                ...+.++|..||+||..+             .+.
T Consensus        60 ~~Ca~CH~~G~~~~~p~vgl~l~~L~~A~~----------------~r~~v~~Lv~~iknP~~~dg~~~~~~~hp~~k~~  123 (159)
T TIGR03045        60 TACGTCHVGGITKTNPNVGLDPEALALATP----------------PRDNVEALVDYMKNPTSYDGEESIAELHPSIRSA  123 (159)
T ss_pred             HHHHHhCCCCCCCCCCCCCCChhhHHhcCC----------------CccCHHHHHHHHhCcccccccchhhhcccccCcc
Confidence            379999954321 13466777666543110                123688999999999755             456


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          67 TKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        67 ~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      ..||..+-++++|+++|++||....
T Consensus       124 ~~mP~~~~LsdeEL~avAaYIl~q~  148 (159)
T TIGR03045       124 DIFPKMRNLTDEDLRLIAGHILVQP  148 (159)
T ss_pred             cccCCcCCCCHHHHHHHHHHHHHhc
Confidence            7898665556999999999998764


No 13 
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=99.35  E-value=6.9e-15  Score=84.35  Aligned_cols=79  Identities=24%  Similarity=0.326  Sum_probs=41.8

Q ss_pred             CCccCccccCCCCCCC-CCCccCccCCCCCCCCCCcchHHhhhcCccccHH-HHHHHHhCCCCCCCCCCCCCCCCCCHHH
Q psy8407           2 KCAQCHTIEAGGAHKV-GPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKD-TLFEYLENPKKYIPGTKMIFAGIKKPQE   79 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~-GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~-~l~~~i~~P~~~~p~~~Mp~~~~~~~~d   79 (92)
                      +|++||++++.+.... +|+|.++..+....     +...      .|... .+......+........||....++++|
T Consensus        11 ~C~~CH~~~~~~~~~~~~p~l~~~~~~~~~~-----~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ls~~e   79 (91)
T PF00034_consen   11 NCAACHGADGNGDGGGPGPDLTGIGKRYSYD-----WIGR------YITNPEAISPPAHMPDAMPMFPMMPMPKILSDEE   79 (91)
T ss_dssp             HTTTTHBTSTTSSSSSTSHBHTTHTHHBTTH-----HTHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSHHH
T ss_pred             cChhcCCCCCcCCccccCccccCccccchHH-----HHHH------HHHHHhhhccccchhhccCcccCCcccCCCCHHH
Confidence            6999999997653333 69999987664311     0000      00111 0110000000000112233221456999


Q ss_pred             HHHHHHHHhhcc
Q psy8407          80 RGDLIAYLEQAS   91 (92)
Q Consensus        80 ~~~liayL~sl~   91 (92)
                      +++|++||+|||
T Consensus        80 ~~~l~ayl~slk   91 (91)
T PF00034_consen   80 IADLAAYLRSLK   91 (91)
T ss_dssp             HHHHHHHHHHTS
T ss_pred             HHHHHHHHHHhC
Confidence            999999999997


No 14 
>PRK13620 psbV cytochrome c-550; Provisional
Probab=99.33  E-value=4.3e-12  Score=84.05  Aligned_cols=74  Identities=19%  Similarity=0.265  Sum_probs=54.3

Q ss_pred             CCCccCccccC-C-CCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCC-------------
Q psy8407           1 MKCAQCHTIEA-G-GAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIP-------------   65 (92)
Q Consensus         1 ~~C~~CH~~~~-~-~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p-------------   65 (92)
                      +.|++|| +.+ . .+..+||+|..+..-.   .+             .++.+.|..||+||+.+.|             
T Consensus       113 ~~Ca~CH-VgG~Tktnp~vgpdLt~LaaAt---pp-------------Rdn~e~Lv~wLkdP~sydg~~siae~HPs~~s  175 (215)
T PRK13620        113 YACGQCH-VGGITKTDPNVGLDPEALALAT---PP-------------RDSVESLVDYLHNPTTYDGEREISELHPSTKS  175 (215)
T ss_pred             hhhhhcc-CCCCCCCCCCCCCCHHHHhccC---CC-------------CCCHHHHHHHHhCccccCCcchhhhcCccccc
Confidence            3699999 543 2 2357899998552111   11             2478999999999999888             


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          66 GTKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        66 ~~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      +..||-.+.++++|+++|++|+.-..
T Consensus       176 ~d~mP~~r~LtdedL~aIa~~IL~qp  201 (215)
T PRK13620        176 TDIFPKMRNLTEDDLVAISGHILLQP  201 (215)
T ss_pred             cccccccCCCCHHHHHHHHHHHhccc
Confidence            78899665456999999999987543


No 15 
>PRK13618 psbV cytochrome c-550; Provisional
Probab=99.28  E-value=8.5e-12  Score=80.51  Aligned_cols=76  Identities=18%  Similarity=0.223  Sum_probs=52.3

Q ss_pred             CCCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCC-------------CCCC
Q psy8407           1 MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKY-------------IPGT   67 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~-------------~p~~   67 (92)
                      ++|++|| +.  |...++|++.+  ++..-  ++.        ....-+.+.|..||+||..+             .+..
T Consensus        61 ~~Ca~CH-~~--G~~~~~p~~~l--~~~~L--a~a--------~p~rd~v~~l~~yik~P~~~Dg~~~~~~~h~~ik~~~  125 (163)
T PRK13618         61 YACAQCH-AG--GVTKTNQNVGL--EPEAL--ALA--------TPNRDNIEGLVDYMKNPTTYDGEEEISEIHPSIKSAD  125 (163)
T ss_pred             HHHHHhc-CC--CCCCCCCCcCC--Chhhh--ccC--------CCCccCHHHHHHHHhCchhccccchhcccccccCccc
Confidence            3699999 44  34677888774  22211  111        00011578999999999886             6778


Q ss_pred             CCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          68 KMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        68 ~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      .||..+-++|+|+++|++||....
T Consensus       126 ~mP~~~~Lsd~eL~ava~yll~~~  149 (163)
T PRK13618        126 IFTAMRNLTDKDLEAIAGHILVQP  149 (163)
T ss_pred             cCCCCCCCCHHHHHHHHHHHHhcc
Confidence            898666556999999999998654


No 16 
>PRK13621 psbV cytochrome c-550; Provisional
Probab=99.24  E-value=9.4e-12  Score=80.43  Aligned_cols=41  Identities=22%  Similarity=0.344  Sum_probs=33.7

Q ss_pred             HHHHHHHHhCCCCCCC-----CCCCCCCCCCCHHHHHHHHHHHhhc
Q psy8407          50 KDTLFEYLENPKKYIP-----GTKMIFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        50 ~~~l~~~i~~P~~~~p-----~~~Mp~~~~~~~~d~~~liayL~sl   90 (92)
                      .++|.+||++|..+.|     +..||....++++|+++|++||...
T Consensus       109 I~~LV~~iknPms~kg~~~~~~~~mps~~~LSdeEL~aIAaYLL~q  154 (170)
T PRK13621        109 IAALVAYQRDPMSYDGSEESYGCRQVPEDWMTDEELQNLAAFILRA  154 (170)
T ss_pred             HHHHHHHhhCCCCCCcccccccccCCccCCCCHHHHHHHHHHHHhh
Confidence            4789999999999876     5667755556699999999999764


No 17 
>CHL00183 petJ cytochrome c553; Provisional
Probab=99.16  E-value=4.3e-11  Score=72.34  Aligned_cols=69  Identities=19%  Similarity=0.232  Sum_probs=47.0

Q ss_pred             CCCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHHH
Q psy8407           1 MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQE   79 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~d   79 (92)
                      ++|++||...   .+.++|++....             ..+... ...+.+.|..+|+++..     .|| |.+.++++|
T Consensus        35 ~~Ca~CHg~g---~~~~~P~~~~~~-------------~~l~~~-~~~~~~~i~~~i~~G~~-----~MP~f~~~Ls~~e   92 (108)
T CHL00183         35 ANCAACHAGG---NNVIMPEKTLKK-------------DALEAN-SMNSIEAITYQVTNGKN-----AMPAFGGRLSDED   92 (108)
T ss_pred             HHHHHHCCCC---CCCCCCCcccCH-------------HHHhhC-cCCCHHHHHHHHHcCcc-----ccccccCCCCHHH
Confidence            3799999953   356788875311             111111 12357889999998752     587 656677999


Q ss_pred             HHHHHHHHhhcc
Q psy8407          80 RGDLIAYLEQAS   91 (92)
Q Consensus        80 ~~~liayL~sl~   91 (92)
                      +++|++||.++.
T Consensus        93 i~~i~aYi~~~~  104 (108)
T CHL00183         93 IEDVANYVLSQA  104 (108)
T ss_pred             HHHHHHHHHHhh
Confidence            999999999864


No 18 
>TIGR03874 4cys_cytochr c-type cytochrome, methanol metabolism-related. This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Probab=99.16  E-value=1.1e-10  Score=73.98  Aligned_cols=68  Identities=21%  Similarity=0.370  Sum_probs=49.0

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCC---CCCCCC-CCCCCCH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYI---PGTKMI-FAGIKKP   77 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~---p~~~Mp-~~~~~~~   77 (92)
                      +|++||..++.|. ...|+|.+...+                    -+.+.|.+.|.+.....   ....|| |...+++
T Consensus        43 ~CAaCHG~dG~G~-~~~P~Lans~v~--------------------~s~~nli~vIl~G~~~~~~~~~~~MPaF~~~LsD  101 (143)
T TIGR03874        43 ECHVCHGPDGMGS-TYAPALKDSVKR--------------------MSYGDFLGVVANGRQNVSAAQNNVMPAFGDNPNV  101 (143)
T ss_pred             HHHHhCCCCCCCC-CCCCCCCCcccc--------------------CCHHHHHHHHHhCCCCCCCCCCCCCCCccccCCc
Confidence            6999999998653 368999753322                    15778888888754321   124698 7677777


Q ss_pred             H-HHHHHHHHHhhc
Q psy8407          78 Q-ERGDLIAYLEQA   90 (92)
Q Consensus        78 ~-d~~~liayL~sl   90 (92)
                      + ||++|+.||+.-
T Consensus       102 ~~eIa~L~~YLR~~  115 (143)
T TIGR03874       102 MCYLDDLYVYLRAR  115 (143)
T ss_pred             HHHHHHHHHHHHhc
Confidence            6 999999999864


No 19 
>TIGR03046 PS_II_psbV2 photosystem II cytochrome PsbV2. Members of this protein family are PsbV2, a protein closely related cytochrome c-550 (PsbV), a protein important to the water-splitting and oxygen-evolving activity of photosystem II. Mutant studies in Thermosynechococcus elongatus showed PsbV2 can partially replace PsbV, from which it appears to have arisen first by duplication, then by intergenic recombination with a different gene.
Probab=99.14  E-value=4.6e-11  Score=76.48  Aligned_cols=41  Identities=22%  Similarity=0.356  Sum_probs=33.9

Q ss_pred             HHHHHHHHhCCCCCCC-----CCCCCCCCCCCHHHHHHHHHHHhhc
Q psy8407          50 KDTLFEYLENPKKYIP-----GTKMIFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        50 ~~~l~~~i~~P~~~~p-----~~~Mp~~~~~~~~d~~~liayL~sl   90 (92)
                      .+.|.+||++|..+.+     +..||....++++|+++|++||...
T Consensus        98 I~~Lv~~iknP~s~kG~~~~~~~~mp~~~~LsdeEL~aIAaYLl~q  143 (155)
T TIGR03046        98 IQSLVAYQRDPMSYDGSEESYGCRPVPEDWMDDEEVENLAAFILRA  143 (155)
T ss_pred             HHHHHHHhhCCcccCcccccccccCCcccCCCHHHHHHHHHHHHHh
Confidence            4789999999999876     5667766556699999999999864


No 20 
>PF13442 Cytochrome_CBB3:  Cytochrome C oxidase, cbb3-type, subunit III ; PDB: 1KB0_A 2DGE_D 2CE1_A 2CE0_A 2V07_A 1W2L_A 2ZOO_A 2ZBO_G 1DVV_A 2EXV_A ....
Probab=99.14  E-value=1.2e-11  Score=68.62  Aligned_cols=54  Identities=33%  Similarity=0.687  Sum_probs=41.2

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQER   80 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~d~   80 (92)
                      +|++||+.+     ..||+|.+.                      .|+++.|..+|.++.     ..|| |...++++|+
T Consensus        13 ~C~~CH~~~-----~~gp~l~~~----------------------~~~~~~l~~~i~~g~-----~~Mp~~~~~ls~~e~   60 (67)
T PF13442_consen   13 NCASCHGPG-----GAGPSLAGK----------------------DWSPEELYNIIRNGR-----GGMPPFGGQLSDEEI   60 (67)
T ss_dssp             HTHHHHGTG-----SSSSTSTHH----------------------HHHHHHHHHHHHHTB-----TTBSCTTTTSTHHHH
T ss_pred             HhHHhcCCC-----ccCccchhh----------------------hhhHHHHHHHHHhCc-----CCCCCCCCCCCHHHH
Confidence            699999933     346888852                      256789999999875     2577 4445679999


Q ss_pred             HHHHHHH
Q psy8407          81 GDLIAYL   87 (92)
Q Consensus        81 ~~liayL   87 (92)
                      ++|++||
T Consensus        61 ~~l~~yi   67 (67)
T PF13442_consen   61 EALAAYI   67 (67)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHC
Confidence            9999997


No 21 
>PRK13697 cytochrome c6; Provisional
Probab=99.12  E-value=7.3e-11  Score=71.38  Aligned_cols=68  Identities=22%  Similarity=0.312  Sum_probs=45.5

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQER   80 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~d~   80 (92)
                      +|.+||..+.. ....||+|....-+..                ..|+.+.|...|+++.     ..|| |.+.++++|+
T Consensus        38 ~C~~CHg~g~~-~~~~~p~l~~~~~~~~----------------~~~~~~~l~~~i~~g~-----~~Mp~~~~~ls~~di   95 (111)
T PRK13697         38 NCASCHAGGKN-LVNAGKTLKKADLEKY----------------GMYSLEAITAQVTNGK-----NAMPAFKDRLSPDQI   95 (111)
T ss_pred             HHHHhCCCCCC-CCCCCCCCCHHHHHhc----------------CCCCHHHHHHHHHcCC-----CCCCCCcCCCCHHHH
Confidence            69999996421 2234676663211110                1356788999998864     3587 5556679999


Q ss_pred             HHHHHHHhhcc
Q psy8407          81 GDLIAYLEQAS   91 (92)
Q Consensus        81 ~~liayL~sl~   91 (92)
                      ++|++||.+++
T Consensus        96 ~~l~~Yi~~~~  106 (111)
T PRK13697         96 EDVAAYVLEQA  106 (111)
T ss_pred             HHHHHHHHHHH
Confidence            99999999864


No 22 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=99.11  E-value=2.9e-10  Score=79.05  Aligned_cols=69  Identities=20%  Similarity=0.300  Sum_probs=47.9

Q ss_pred             CCCccCccccCCCCCCC-CCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHH
Q psy8407           1 MKCAQCHTIEAGGAHKV-GPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQ   78 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~-GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~   78 (92)
                      ++|++||..++.|.... .|+|.+......                  -+.+.+.+.|++..    ...|| |...++++
T Consensus       212 ~~Ca~CHG~~G~G~~~~gaP~L~~~~~~y~------------------~~~~~i~~~i~~G~----~g~Mp~~~~~Ls~~  269 (285)
T TIGR00782       212 DNCTTCHGEDGKGLQELGAPNLTDDVWLYG------------------GDLKTITTTITNGR----GGVMPAWGPRLSEA  269 (285)
T ss_pred             ccchhhCCCCCCCCCCCCCCCCCcchhhcC------------------CCHHHHHHHHHhCC----CCCCCCccccCCHH
Confidence            36999999997654334 499987432211                  03556777777643    23688 55566799


Q ss_pred             HHHHHHHHHhhcc
Q psy8407          79 ERGDLIAYLEQAS   91 (92)
Q Consensus        79 d~~~liayL~sl~   91 (92)
                      ||++|++||.+|+
T Consensus       270 ei~~La~Yv~sL~  282 (285)
T TIGR00782       270 QIKALAAYVHSLG  282 (285)
T ss_pred             HHHHHHHHHHHhc
Confidence            9999999999986


No 23 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=98.93  E-value=2.5e-09  Score=74.39  Aligned_cols=70  Identities=24%  Similarity=0.271  Sum_probs=46.2

Q ss_pred             CCccCccccCCCCCCCC-CCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCC----CCC-CCCCC-CCCC
Q psy8407           2 KCAQCHTIEAGGAHKVG-PNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKK----YIP-GTKMI-FAGI   74 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~G-P~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~----~~p-~~~Mp-~~~~   74 (92)
                      +|++||..++.+  ..| |+|.+.....                  ..+.+.|...|++...    ... ...|| |...
T Consensus       117 ~Ca~CHG~~g~G--~~g~P~L~~~~~~~------------------g~~~~~i~~~i~~G~~~~~~~~~~~~~Mp~~~~~  176 (285)
T TIGR00782       117 WCAQCHGSGAGG--AKGFPNLLDNDWLW------------------GGTLEGIHTTIKHGIRDPDDGDTYVGEMPAFGPL  176 (285)
T ss_pred             HhHHhCCCCCCC--CCCCCCCCCCcccc------------------CCCHHHHHHHHHhCccCcccCCcCCCCCCccccc
Confidence            699999998753  334 8887632111                  0146677777765432    111 24687 5456


Q ss_pred             CCHHHHHHHHHHHhhcc
Q psy8407          75 KKPQERGDLIAYLEQAS   91 (92)
Q Consensus        75 ~~~~d~~~liayL~sl~   91 (92)
                      ++++|+++|++||+++.
T Consensus       177 LsdeeI~aVaaYv~sl~  193 (285)
T TIGR00782       177 LEEADIKDVASYVMSLS  193 (285)
T ss_pred             cChHHHHHHHHHHHHhc
Confidence            77999999999999875


No 24 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=98.91  E-value=3.1e-09  Score=74.42  Aligned_cols=67  Identities=21%  Similarity=0.360  Sum_probs=45.8

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQER   80 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~d~   80 (92)
                      +|++||..++.  +..||++..+....                   ...+.+...|++...   +..|| |...++++|+
T Consensus       225 ~Ca~CHg~~g~--G~~gp~p~~~~~~~-------------------~~~~~~~~~I~~G~~---~~~MP~f~~~Lsdeei  280 (294)
T PRK14486        225 NCAACHGDEAQ--GQEGVALNDIDDGD-------------------LPDAAYFGMIKGGSD---AKGMPGFGGDLSDDDI  280 (294)
T ss_pred             HHHHhcCCCCC--CCCCCCccccccCC-------------------CcHHHHHHHHHcCCC---cCCCCcccccCCHHHH
Confidence            69999998864  45677666542211                   134456677877543   24688 5555679999


Q ss_pred             HHHHHHHhhccC
Q psy8407          81 GDLIAYLEQASK   92 (92)
Q Consensus        81 ~~liayL~sl~~   92 (92)
                      .+|++||.+++.
T Consensus       281 ~~LaaYV~sl~~  292 (294)
T PRK14486        281 WAIVAYIRSQKA  292 (294)
T ss_pred             HHHHHHHHhccC
Confidence            999999999863


No 25 
>COG2863 Cytochrome c553 [Energy production and conversion]
Probab=98.87  E-value=3.1e-09  Score=65.54  Aligned_cols=66  Identities=26%  Similarity=0.349  Sum_probs=45.6

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCC-CCCCCCCCCC-CCCCCCHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENP-KKYIPGTKMI-FAGIKKPQE   79 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P-~~~~p~~~Mp-~~~~~~~~d   79 (92)
                      .|++||..++.+....=|.|.+.                        ++++|...|++= .+..++..|- ...-++|+|
T Consensus        34 ~Ca~CHG~~g~~~~~~~P~Lagq------------------------~~~yl~~~L~a~k~g~r~~~vM~~~a~~LsD~D   89 (121)
T COG2863          34 SCAACHGADGNSPAPGYPKLAGQ------------------------SEAYLEKQLKAYKDGKRPGPVMNAIASGLSDED   89 (121)
T ss_pred             hhhhccCCCCCCccCCCCCcCCC------------------------CHHHHHHHHHHHHcCCCCcchHHHHHHhCCHHH
Confidence            49999999976544444666543                        477788777742 2334555674 444456999


Q ss_pred             HHHHHHHHhhcc
Q psy8407          80 RGDLIAYLEQAS   91 (92)
Q Consensus        80 ~~~liayL~sl~   91 (92)
                      |++|.+|+.+++
T Consensus        90 i~~lAa~~a~~~  101 (121)
T COG2863          90 IADLAAYYAAQK  101 (121)
T ss_pred             HHHHHHHHHhCC
Confidence            999999999876


No 26 
>COG2857 CYT1 Cytochrome c1 [Energy production and conversion]
Probab=98.83  E-value=8e-09  Score=70.88  Aligned_cols=78  Identities=27%  Similarity=0.284  Sum_probs=55.5

Q ss_pred             CCccCccccCC-CCCCCCC-CccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCCCHH
Q psy8407           2 KCAQCHTIEAG-GAHKVGP-NLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIKKPQ   78 (92)
Q Consensus         2 ~C~~CH~~~~~-~~~~~GP-~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~~~~   78 (92)
                      -|..||+..+. .....|+ +|.....+..... .          -....+.++..||+||+...|++.|| +..+. ||
T Consensus       133 ~~~~ch~~~~~~~~~~t~~~~l~p~g~~~~~g~-~----------~~~~~~~~~~~~i~~p~~~k~~~~m~~~~~~t-dq  200 (250)
T COG2857         133 FYARCHGVPDYINSLLTGYVDLPPAGLRTPQGT-S----------YNPYFEGELGIFIADPLKDKPGTYMPGNPALT-DQ  200 (250)
T ss_pred             HHhhcccCCCCcCeeecCCCCCCCcccccCCcc-c----------ccccchhhHhhhccCccccCCcCCCCCChhhH-HH
Confidence            47789999863 2445666 5665555543221 0          12234556999999999999999998 55555 99


Q ss_pred             HHHHHHHHHhhcc
Q psy8407          79 ERGDLIAYLEQAS   91 (92)
Q Consensus        79 d~~~liayL~sl~   91 (92)
                      ++++|++||++++
T Consensus       201 ~~~dlvaYL~~~~  213 (250)
T COG2857         201 EVKDLVAYLKWAA  213 (250)
T ss_pred             HHHHHHHHHHHcc
Confidence            9999999999875


No 27 
>PF02433 FixO:  Cytochrome C oxidase, mono-heme subunit/FixO;  InterPro: IPR003468 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO) []. Cytochrome cbb3 oxidases are required both to support symbiotic nitrogen fixation, whilst ensuring that the oxygen-labile nitrogenase is not compromised. Cytochrome cbb3 oxidases consist of four subunits: FixN (or CcoN), FixO (or CcoO), FixP (or CcoP) and FixQ (or CcoQ). The catalytic core is comprised of subunits FixN, FixO and FixP, where FixN acts as the catalytic subunit, and Fix O and FixP are membrane-bound mono- and di-haem cytochromes c, respectively. The FixQ subunit protects the core complex in the presence of oxygen from proteolytic degradation []. This entry represents the mono-haem FixO subunit.
Probab=98.68  E-value=2.1e-08  Score=67.53  Aligned_cols=56  Identities=25%  Similarity=0.421  Sum_probs=38.8

Q ss_pred             CCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCC-CHHHHHHHHHHHhhc
Q psy8407          15 HKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIK-KPQERGDLIAYLEQA   90 (92)
Q Consensus        15 ~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~-~~~d~~~liayL~sl   90 (92)
                      .+.||||+.+++|.                    +++|-..-+.||..+.|++.|| |.-+. .+.|..++.+.|+.+
T Consensus       100 kRtGPDLarvG~r~--------------------s~~Wh~~Hl~~Pr~v~p~SiMP~Y~~L~~~~~d~~~~~~~~~~l  157 (226)
T PF02433_consen  100 KRTGPDLARVGGRY--------------------SDDWHLAHLYNPRSVVPGSIMPSYPWLFENKLDGEDIQAKMKAL  157 (226)
T ss_pred             CCcCccHHHHhccC--------------------ChHHHHHHhhChHhhCCCCCCCCChhHhhccCcHHHHHHHHHHH
Confidence            46788888777665                    5778888899999999999999 33232 122445666665554


No 28 
>COG2010 CccA Cytochrome c, mono- and diheme variants [Energy production and conversion]
Probab=98.63  E-value=4.1e-08  Score=61.63  Aligned_cols=24  Identities=38%  Similarity=0.616  Sum_probs=16.4

Q ss_pred             CCCccCccccC--CCCCCCCCCccCc
Q psy8407           1 MKCAQCHTIEA--GGAHKVGPNLHGL   24 (92)
Q Consensus         1 ~~C~~CH~~~~--~~~~~~GP~L~~i   24 (92)
                      .+|++||+.+.  .+....||.|.+.
T Consensus        60 ~~C~~CHg~~~~g~~~~~~~~~l~~~   85 (150)
T COG2010          60 GNCAACHGPNLGGAGPLLDGPALAGG   85 (150)
T ss_pred             ccchhccCCCCCCCCCcCcchhhhCC
Confidence            48999999993  2222447888764


No 29 
>COG4654 Cytochrome c551/c552 [Energy production and conversion]
Probab=98.63  E-value=3.1e-08  Score=59.10  Aligned_cols=72  Identities=17%  Similarity=0.226  Sum_probs=47.7

Q ss_pred             CCCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCC-CCCCCCCCCCHHH
Q psy8407           1 MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPG-TKMIFAGIKKPQE   79 (92)
Q Consensus         1 ~~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~-~~Mp~~~~~~~~d   79 (92)
                      +.|.+||.++.   ..+||++..|..+..+..               =..+.|...|+......-+ -.||.....++.|
T Consensus        33 kgC~~CHq~~v---ktVGPS~kdIAakYag~~---------------~~~~kl~q~i~~g~~g~wg~ipMppqp~~sd~~   94 (110)
T COG4654          33 KGCVACHQPDV---KTVGPSYKDIAAKYAGKA---------------GALAKLAQGIKPGGVGVWGPIPMPPQPAISDAD   94 (110)
T ss_pred             ccchhhccccc---cccCccHHHHHHHHccch---------------hHHHHHHHhccccCcCccccCCCCCcccccchH
Confidence            46999999984   589999999987765321               1345666666643322222 4688664445888


Q ss_pred             HHHHHHHHhhc
Q psy8407          80 RGDLIAYLEQA   90 (92)
Q Consensus        80 ~~~liayL~sl   90 (92)
                      .+.++.|+...
T Consensus        95 a~~~~kwvl~~  105 (110)
T COG4654          95 AKTLAKWVLAF  105 (110)
T ss_pred             HHHHHHHHHhc
Confidence            88888877653


No 30 
>PRK13619 psbV cytochrome c-550; Provisional
Probab=98.58  E-value=1e-07  Score=61.10  Aligned_cols=75  Identities=23%  Similarity=0.286  Sum_probs=48.8

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCC-----C----C----CCC
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKY-----I----P----GTK   68 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~-----~----p----~~~   68 (92)
                      +|++||...   ...++|++.--..-....            +.-.-+-+.|+.|+++|..+     .    |    ...
T Consensus        61 ~Ca~CH~gG---~nk~~Pnl~L~~~~L~~a------------tP~RdnV~aLVdymk~PtsyDG~~~~a~~hpsi~~~di  125 (160)
T PRK13619         61 ECTQCHLQG---KTKTNNNVSLGLEDLAGA------------EPPRDNVLALVDYLKHPTSYDGEDDYSELHPNVSRPDI  125 (160)
T ss_pred             HHHHcccCC---CCCcCCCCCcCHHHHHhc------------CCCcccHHHHHHHHhCCcccccchhhhhhccccccccc
Confidence            699999994   568899877311100000            11122577899999999876     1    1    135


Q ss_pred             CCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          69 MIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        69 Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      ||...-++|+|+.+|.+|+....
T Consensus       126 ~P~mr~LtdedL~~iAg~IL~~p  148 (160)
T PRK13619        126 FPELRNFTEDDLYDVAGYMLVAP  148 (160)
T ss_pred             ccccCCCCHHHHHHHHHHHHhcc
Confidence            66543356999999999987643


No 31 
>PRK14485 putative bifunctional cbb3-type cytochrome c oxidase subunit I/II; Provisional
Probab=98.47  E-value=4.1e-07  Score=70.09  Aligned_cols=56  Identities=18%  Similarity=0.309  Sum_probs=41.7

Q ss_pred             CCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-C----CCCCCHHHHHHHHHHHhh
Q psy8407          15 HKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-F----AGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        15 ~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~----~~~~~~~d~~~liayL~s   89 (92)
                      .+.||||..+++|+                    ++++-..-+.||+.+.|++.|| |    ...++.+++.+-+..++.
T Consensus       587 ~rtgpdl~~~g~~~--------------------~~~wh~~hl~~p~~~~p~s~mp~y~~l~~~~~~~~~~~~~~~~~~~  646 (712)
T PRK14485        587 KRTGPDLAREGGKY--------------------PDSWHYNHMEDPQSTSPGSIMPAYPWLLENELDISDTPAKIKAMQT  646 (712)
T ss_pred             CCcCcchhhhcCCC--------------------ChHHHHHHhcCchhcCCCCCCCCChhhhhCCCChHHHHHHHHHHHh
Confidence            46899999888876                    3577778899999999999998 2    234445666666666665


Q ss_pred             c
Q psy8407          90 A   90 (92)
Q Consensus        90 l   90 (92)
                      +
T Consensus       647 ~  647 (712)
T PRK14485        647 L  647 (712)
T ss_pred             c
Confidence            4


No 32 
>PRK13622 psbV cytochrome c-550; Provisional
Probab=98.43  E-value=6.9e-07  Score=58.55  Aligned_cols=42  Identities=17%  Similarity=0.260  Sum_probs=29.9

Q ss_pred             cHHHHHHHHhCCCCCC---------CC----CCCCCCCCCCHHHHHHHHHHHhhc
Q psy8407          49 NKDTLFEYLENPKKYI---------PG----TKMIFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~---------p~----~~Mp~~~~~~~~d~~~liayL~sl   90 (92)
                      +.+.|..++++|..+-         |.    ..||-.+.++|+|+++|.+|+...
T Consensus       104 nv~AIv~yLk~p~tYdg~~~~~e~~p~~~~~~~~p~~~~LsdeEI~~VA~yIl~q  158 (180)
T PRK13622        104 NVLAIVDYIKNPVTYDGVESLLEYHPNTQLLSEYPRLRNLTDEDLKLIAGYILVQ  158 (180)
T ss_pred             cHHHHHHHHhcccccCCccchhhccccchhccccccccCCCHHHHHHHHHHHHhC
Confidence            4678889999987432         22    135544456799999999999764


No 33 
>COG2993 CcoO Cbb3-type cytochrome oxidase, cytochrome c subunit [Energy production and conversion]
Probab=98.41  E-value=1.7e-07  Score=61.96  Aligned_cols=58  Identities=22%  Similarity=0.318  Sum_probs=44.0

Q ss_pred             CCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCC-CCCCC-CHHHHHHHHHHHhhcc
Q psy8407          14 AHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMI-FAGIK-KPQERGDLIAYLEQAS   91 (92)
Q Consensus        14 ~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp-~~~~~-~~~d~~~liayL~sl~   91 (92)
                      ..+.||||..+++|.                    +.+|=..-+.||..++|.+.|| |.-+. ++-|++++.+-++.++
T Consensus       101 SKRTGPDLaRVG~ry--------------------S~dWH~~Hl~~PR~vVPeSiMPsY~~L~~~~ld~~d~~~~~~~~r  160 (227)
T COG2993         101 SKRTGPDLARVGGRY--------------------SDDWHRAHLLDPRSVVPESIMPSYPWLFDNKLDVDDIGAELKALR  160 (227)
T ss_pred             CCccCcchhhhcccc--------------------ccHHHHHHccCchhcCccccCcccHHHhcCCCchHHHHHHHHhhc
Confidence            457999999998886                    4667777788999999999999 43332 3447788877777654


No 34 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=97.93  E-value=1.6e-05  Score=54.89  Aligned_cols=34  Identities=24%  Similarity=0.461  Sum_probs=24.6

Q ss_pred             HHHHHHHhCCCCCCCCCCCCCC-----CCCCHHHHHHHHHHHhhccC
Q psy8407          51 DTLFEYLENPKKYIPGTKMIFA-----GIKKPQERGDLIAYLEQASK   92 (92)
Q Consensus        51 ~~l~~~i~~P~~~~p~~~Mp~~-----~~~~~~d~~~liayL~sl~~   92 (92)
                      -.+.+||+.        -||+.     .++++||.-||++|+.+..|
T Consensus       215 ~t~A~Fi~~--------nMP~g~~~~~P~Lsd~dA~DiAay~~~~pR  253 (293)
T COG3258         215 NTLARFIKA--------NMPYGFSGTNPILSDQDAWDIAAYVNSQPR  253 (293)
T ss_pred             HHHHHHHHh--------cCCCCcCccCCccChHHHHHHHHHHcCCCC
Confidence            356778763        37742     24789999999999987643


No 35 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=97.81  E-value=0.00019  Score=50.47  Aligned_cols=47  Identities=26%  Similarity=0.308  Sum_probs=26.9

Q ss_pred             cCccccHHHHHHHHhCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          44 KGITWNKDTLFEYLENPKKYIPG--TKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        44 ~~~~~~~~~l~~~i~~P~~~~p~--~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      .|...+=+++.++...-....|+  ..+-... ++++|+++||+||+||+
T Consensus       231 dG~~~tL~evv~~y~~~g~~~~~~~~~~~~~~-Lt~~E~~dLvaFL~tLt  279 (291)
T TIGR03791       231 DGQLGSLDAVIDHYEKGGEKRPSISAEMKPFE-LSEREREDLIAFIETLD  279 (291)
T ss_pred             CCCcCCHHHHHHHHHccCccccccccccccCC-CCHHHHHHHHHHHHhcC
Confidence            35555666666655432221121  1111123 45999999999999986


No 36 
>PF14495 Cytochrom_C550:  Cytochrome c-550 domain; PDB: 3ARC_V 1IZL 3A0H_V 3A0B_v 1E29_A 1F1C_B 1S5L_V 4FBY_i 3PRR_V 3PRQ_V ....
Probab=97.35  E-value=0.00015  Score=45.34  Aligned_cols=42  Identities=24%  Similarity=0.446  Sum_probs=25.9

Q ss_pred             cHHHHHHHHhCCCCCC---------CCCCCC--C--CCCCCHHHHHHHHHHHhhc
Q psy8407          49 NKDTLFEYLENPKKYI---------PGTKMI--F--AGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~---------p~~~Mp--~--~~~~~~~d~~~liayL~sl   90 (92)
                      +-+.|+.|+++|..+-         |...-+  |  ..-++++|+.+|.+||.-.
T Consensus        67 Ni~~LVdYmk~PtsYDG~~~i~e~hp~~~s~di~p~mr~ltdddL~~iAg~IL~~  121 (135)
T PF14495_consen   67 NIEALVDYMKNPTSYDGEESISELHPSIKSADIFPKMRNLTDDDLYAIAGYILRQ  121 (135)
T ss_dssp             SHHHHHHHHHS-B-TTSSSBGTTTS-STTCTTTSGGGTS--HHHHHHHHHHHHHH
T ss_pred             cHHHHHHHhhCCCCcCCchhHHHhCcCcccchhhHhhcCCCHHHHHHHHHHHHhc
Confidence            6789999999997642         222112  2  2234699999999999753


No 37 
>PF09098 Dehyd-heme_bind:  Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding;  InterPro: IPR015182 Quinohemoprotein amine dehydrogenases (QHNDH) 1.4.99 from EC) are enzymes produced in the periplasmic space of certain Gram-negative bacteria, such as Paracoccus denitrificans and Pseudomonas putida, in response to primary amines, including n-butylamine and benzylamine. QHNDH catalyses the oxidative deamination of a wide range of aliphatic and aromatic amines through formation of a Schiff-base intermediate involving one of the quinone O atoms []. Catalysis requires the presence of a novel redox cofactor, cysteine tryptophylquinone (CTQ). CTQ is derived from the post-translational modification of specific residues, which involves the oxidation of the indole ring of a tryptophan residue to form tryptophylquinone, followed by covalent cross-linking with a cysteine residue []. There is one CTQ per subunit in QHNDH. In addition to CTQ, two haem c cofactors are present in QHNDH that mediate the transfer of the substrate-derived electrons from CTQ to an external electron acceptor, cytochrome c-550 [, ]. QHNDH is a heterotrimer of alpha, beta and gamma subunits. The alpha and beta subunits contain signal peptides necessary for the translocation of QHNDH to the periplasm. The alpha subunit is composed of four domains - domain 1 forming a dihaem cytochrome, and domains 2-4 forming antiparallel beta-barrel structures; the beta subunit is a 7-bladed beta-propeller that provides part of the active site; and the small, catalytic gamma subunit contains the novel cross-linked CTQ cofactor, in addition to additional thioester cross-links between Cys and Asp/Glu residues that encage CTQ. The gamma subunit assumes a globular secondary structure with two short alpha-helices having many turns and bends [].  This entry represents the dihaem cytochrome c domain of the QHNDH alpha subunit. The domain contain two cysteine residues that are involved in thioether linkages to haem []. ; PDB: 1PBY_A 1JJU_A 1JMZ_A 1JMX_A.
Probab=96.92  E-value=0.00039  Score=45.00  Aligned_cols=15  Identities=33%  Similarity=0.700  Sum_probs=10.2

Q ss_pred             CCHHHHHHHHHHHhh
Q psy8407          75 KKPQERGDLIAYLEQ   89 (92)
Q Consensus        75 ~~~~d~~~liayL~s   89 (92)
                      ++++|+.+||.||..
T Consensus        51 Is~eer~avVkYLAd   65 (167)
T PF09098_consen   51 ISPEERRAVVKYLAD   65 (167)
T ss_dssp             --HHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHH
Confidence            348888888888853


No 38 
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=96.30  E-value=0.011  Score=42.08  Aligned_cols=26  Identities=15%  Similarity=0.295  Sum_probs=19.9

Q ss_pred             CCCCCCCCC--CCCHHHHHHHHHHHhhc
Q psy8407          65 PGTKMIFAG--IKKPQERGDLIAYLEQA   90 (92)
Q Consensus        65 p~~~Mp~~~--~~~~~d~~~liayL~sl   90 (92)
                      ++..||..+  +..+++++-|-+||.+|
T Consensus       290 ~~~~MPp~G~~l~~~e~vaLI~~WI~~l  317 (317)
T TIGR03806       290 PGVRMPELGRSLVHQEGLALIRQWIASL  317 (317)
T ss_pred             ccccCCcCCCCCCCHHHHHHHHHHHHhC
Confidence            456798654  56568999999999875


No 39 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=96.20  E-value=0.01  Score=41.29  Aligned_cols=73  Identities=14%  Similarity=0.266  Sum_probs=40.4

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERG   81 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~   81 (92)
                      +|.+||...+.  ...+-+|.+++++...    |.    .+.-.++.-++.|.--+...   ..|..||    .+.-|++
T Consensus        64 ~C~sCHl~~Gt--~~~~~p~vgv~~~yPq----y~----~r~~kvitledRInGcf~~s---~nGk~~p----aDspEmk  126 (293)
T COG3258          64 NCVSCHLNAGT--KPYSSPFVGVYNKYPQ----YD----IRTMKVITLEDRINGCFERS---TNGKPLP----ADSPEMK  126 (293)
T ss_pred             ceeecccccCc--CcCCcchhheeccccc----cC----cccCceeeHHHHHHHHhhcC---CCCCCCC----CCCHHHH
Confidence            79999998853  3456667777766421    11    00011222244444333211   1233455    2358999


Q ss_pred             HHHHHHhhcc
Q psy8407          82 DLIAYLEQAS   91 (92)
Q Consensus        82 ~liayL~sl~   91 (92)
                      +|++|++-|+
T Consensus       127 AmlaY~kWL~  136 (293)
T COG3258         127 AMLAYMKWLK  136 (293)
T ss_pred             HHHHHHHHHH
Confidence            9999998875


No 40 
>PF10643 Cytochrome-c551:  Photosystem P840 reaction-centre cytochrome c-551;  InterPro: IPR019604  A photosynthetic reaction-centre complex is found in certain green sulphur bacteria such as Chlorobium vibrioforme, which are anaerobic photo-auto-trophic organisms. The primary electron donor is P840, a probable B-Chl a dimer, and the primary electron acceptor is a B-Chl monomer. Also on the donor side c-type cytochromes are known to function as electron donors to photo-oxidised P840. This family is thus the secondary endogenous donor of the photosynthetic reaction-centre complex and is a membrane-bound cytochrome containing a single haem group. ; PDB: 3A9F_A.
Probab=95.97  E-value=0.0019  Score=43.41  Aligned_cols=20  Identities=20%  Similarity=0.486  Sum_probs=14.0

Q ss_pred             CCCCCCCCHHHHHHHHHHHhh
Q psy8407          69 MIFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        69 Mp~~~~~~~~d~~~liayL~s   89 (92)
                      ||..++. ++|...|+.||..
T Consensus       212 ~PnSgIt-~eDa~~I~~YLne  231 (233)
T PF10643_consen  212 VPNSGIT-DEDAPQIMMYLNE  231 (233)
T ss_dssp             STT-----HHHHHHHHHHHHH
T ss_pred             CCCCCCC-HHHHHHHHHHHHh
Confidence            5666776 9999999999975


No 41 
>COG3748 Predicted membrane protein [Function unknown]
Probab=95.85  E-value=0.0085  Score=42.96  Aligned_cols=65  Identities=17%  Similarity=0.255  Sum_probs=38.1

Q ss_pred             CCccCccccCCCCCCCCCCccCccCCCCCCCCCCcchHHhhhcCccccHHHHHHHHhC--CCCCCCCCCCCCC---CCCC
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLEN--PKKYIPGTKMIFA---GIKK   76 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~~i~~r~~~~~~g~~y~~~~~~~~~~~~~~~l~~~i~~--P~~~~p~~~Mp~~---~~~~   76 (92)
                      +|..||+.+..-.+...|+..-..+                      ++++|...-+.  -+.. ....||..   ++. 
T Consensus       334 rCs~CHaa~P~~e~~~~~p~gv~ld----------------------t~~~iaa~A~~Iy~qA~-~s~~MP~gNvt~mT-  389 (407)
T COG3748         334 RCSMCHAAEPTWEGISAPPKGVMLD----------------------TDEQIAAHAREIYLQAG-RSHAMPPGNVTQMT-  389 (407)
T ss_pred             hhhhhhcCCCcccccccCCCceeec----------------------CHHHHHHHHHHHHHHHH-HhccCCCcccccCC-
Confidence            6999999987544455555433222                      34555433221  0111 13568743   454 


Q ss_pred             HHHHHHHHHHHhhc
Q psy8407          77 PQERGDLIAYLEQA   90 (92)
Q Consensus        77 ~~d~~~liayL~sl   90 (92)
                      |||++-|.+|+++-
T Consensus       390 ~eER~ll~aW~e~~  403 (407)
T COG3748         390 DEERALLAAWFESG  403 (407)
T ss_pred             HHHHHHHHHHHHhc
Confidence            99999999999864


No 42 
>COG3245 CycB Cytochrome c5 [Energy production and conversion]
Probab=95.77  E-value=0.04  Score=33.98  Aligned_cols=24  Identities=21%  Similarity=0.141  Sum_probs=18.1

Q ss_pred             CCCCCCCC---CCHHHHHHHHHHHhhc
Q psy8407          67 TKMIFAGI---KKPQERGDLIAYLEQA   90 (92)
Q Consensus        67 ~~Mp~~~~---~~~~d~~~liayL~sl   90 (92)
                      ..||..+.   .||+|+++.|.|+...
T Consensus        98 nAMPpkG~ca~cSdDe~kAaId~M~~~  124 (126)
T COG3245          98 NAMPPKGGCADCSDDEVKAAIDFMAAA  124 (126)
T ss_pred             cCCCCCCCcCCCCHHHHHHHHHHHHhc
Confidence            45886542   4699999999998754


No 43 
>PF09086 DUF1924:  Domain of unknown function (DUF1924);  InterPro: IPR015170 This entry is found in a set of bacterial proteins, including Cytochrome c-type protein. It is functionally uncharacterised. ; PDB: 1DW2_C 1DW1_A 1DW3_C 1DW0_A 1OAE_A 1GU2_B 1E8E_A.
Probab=94.87  E-value=0.008  Score=35.79  Aligned_cols=33  Identities=21%  Similarity=0.417  Sum_probs=18.6

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYL   87 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~liayL   87 (92)
                      +.+.+.+|++.--..+      +..-=+.+|-.|+++||
T Consensus        66 D~~kVEKwf~RNC~dv------lgReCTa~EKgD~l~yl   98 (98)
T PF09086_consen   66 DAAKVEKWFKRNCNDV------LGRECTAQEKGDVLAYL   98 (98)
T ss_dssp             SHHHHHHHHHHHHHHH------HSS---HHHHHHHHHHH
T ss_pred             CHHHHHHHHHccchhh------hcccCCHHHhcchheeC
Confidence            5667777776211000      11123589999999998


No 44 
>PF14376 Haem_bd:  Haem-binding domain
Probab=94.61  E-value=0.027  Score=35.43  Aligned_cols=17  Identities=12%  Similarity=0.358  Sum_probs=14.6

Q ss_pred             CCCHHHHHHHHHHHhhc
Q psy8407          74 IKKPQERGDLIAYLEQA   90 (92)
Q Consensus        74 ~~~~~d~~~liayL~sl   90 (92)
                      .++++|++.|++|+++.
T Consensus       120 ~Ls~~ek~~Ll~Wi~~~  136 (137)
T PF14376_consen  120 KLSEEEKQALLNWIKEQ  136 (137)
T ss_pred             CCCHHHHHHHHHHHHHc
Confidence            45699999999999864


No 45 
>PF02167 Cytochrom_C1:  Cytochrome C1 family;  InterPro: IPR002326 Cytochrome bc1 complex (ubiquinol:ferricytochrome c oxidoreductase) is found in mitochondria, photosynthetic bacteria and other prokaryotes. It is minimally composed of three subunits: cytochrome b, carrying a low- and a high-potential haem group; cytochrome c1 (cyt c1); and a high-potential Rieske iron-sulphur protein. The general function of the complex is electron transfer between two mobile redox carriers, ubiquinol and cytochrome c; the electron transfer is coupled with proton translocation across the membrane, thus generating proton-motive force in the form of an electrochemical potential that can drive ATP synthesis. In its structure and functions, the cytochrome bc1 complex bears extensive analogy to the cytochrome b6f complex of chloroplasts and cyanobacteria; cyt c1 plays an analogous role to cytochrome f, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1P84_D 2IBZ_D 1EZV_D 3CX5_O 3CXH_O 1KB9_D 1KYO_D 1ZRT_Q 2CA4_B 2C9X_B ....
Probab=88.80  E-value=0.13  Score=34.95  Aligned_cols=42  Identities=29%  Similarity=0.503  Sum_probs=25.5

Q ss_pred             cHHHHHHHHh----CCCC-----------CCCC--CCCCC---CC---------CCCHHHHHHHHHHHhhc
Q psy8407          49 NKDTLFEYLE----NPKK-----------YIPG--TKMIF---AG---------IKKPQERGDLIAYLEQA   90 (92)
Q Consensus        49 ~~~~l~~~i~----~P~~-----------~~p~--~~Mp~---~~---------~~~~~d~~~liayL~sl   90 (92)
                      ..++|+.+|+    +|.+           +.|+  ..||.   .+         -.-+|.++||++||...
T Consensus       112 G~dyiys~L~gy~~~p~~~~~~~~~~~N~~fpg~~iaMP~~L~~~~v~y~dGt~at~~q~a~DVv~FL~w~  182 (219)
T PF02167_consen  112 GADYIYSLLTGYYEDPAGVSVRPGGYYNPYFPGGAIAMPPPLSDGQVEYDDGTPATVDQMAKDVVNFLAWA  182 (219)
T ss_dssp             HHHHHHHHHCTBSS--TTGTTSTTSEEETTSTTSEESS--TSSTTSS-BTTTB---HHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHhccCCCcccccCCCCCccccccCCCcccchhhhhhhcccccCCCcchHHHHHHHHHHHHHHH
Confidence            5788988885    5652           4567  67872   11         11267889999999754


No 46 
>PF02167 Cytochrom_C1:  Cytochrome C1 family;  InterPro: IPR002326 Cytochrome bc1 complex (ubiquinol:ferricytochrome c oxidoreductase) is found in mitochondria, photosynthetic bacteria and other prokaryotes. It is minimally composed of three subunits: cytochrome b, carrying a low- and a high-potential haem group; cytochrome c1 (cyt c1); and a high-potential Rieske iron-sulphur protein. The general function of the complex is electron transfer between two mobile redox carriers, ubiquinol and cytochrome c; the electron transfer is coupled with proton translocation across the membrane, thus generating proton-motive force in the form of an electrochemical potential that can drive ATP synthesis. In its structure and functions, the cytochrome bc1 complex bears extensive analogy to the cytochrome b6f complex of chloroplasts and cyanobacteria; cyt c1 plays an analogous role to cytochrome f, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1P84_D 2IBZ_D 1EZV_D 3CX5_O 3CXH_O 1KB9_D 1KYO_D 1ZRT_Q 2CA4_B 2C9X_B ....
Probab=88.49  E-value=1.9  Score=29.30  Aligned_cols=9  Identities=44%  Similarity=1.309  Sum_probs=6.8

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|++||++.
T Consensus        25 ~C~~CHsl~   33 (219)
T PF02167_consen   25 VCASCHSLK   33 (219)
T ss_dssp             TGGGTSBCT
T ss_pred             HHhhccccc
Confidence            588888854


No 47 
>TIGR02162 torC trimethylamine-N-oxide reductase c-type cytochrome TorC. This family includes consists of TorC, a pentahemic c-type cytochrome subunit of periplasmic reductases for trimethylamine-N-oxide (TMAO). The N-terminal half is closely related to tetrahemic NapC (or NirT) subunits of periplasmic nitrate (or nitrite) reductases; some species have both TMAO and nitrate reductase complexes.
Probab=87.92  E-value=0.4  Score=35.20  Aligned_cols=20  Identities=15%  Similarity=0.346  Sum_probs=16.5

Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy8407          70 IFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~sl   90 (92)
                      +|..|. ++|.+-|+.||+.-
T Consensus       358 ~~t~l~-~~e~~lv~~YLQ~h  377 (386)
T TIGR02162       358 GFTNLD-KEQERLVLRYLQMH  377 (386)
T ss_pred             hhcCCC-HHHHHHHHHHHHHh
Confidence            567765 99999999999864


No 48 
>PF07635 PSCyt1:  Planctomycete cytochrome C;  InterPro: IPR011429 These proteins share a region of homology at their N terminus that contains the C-{CPWHF}-{CPWR}-C-H-{CFYW} motif typical of cytochrome c.
Probab=85.29  E-value=0.53  Score=25.20  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=8.5

Q ss_pred             CccCccccCC
Q psy8407           3 CAQCHTIEAG   12 (92)
Q Consensus         3 C~~CH~~~~~   12 (92)
                      |..||+-+..
T Consensus         1 C~~CHg~~~~   10 (59)
T PF07635_consen    1 CFSCHGPDKQ   10 (59)
T ss_pred             CcCCCCCCCc
Confidence            9999998853


No 49 
>PRK15032 trimethylamine N-oxide reductase cytochrome c-type subunit; Provisional
Probab=82.37  E-value=1  Score=33.17  Aligned_cols=20  Identities=25%  Similarity=0.489  Sum_probs=15.1

Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy8407          70 IFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~sl   90 (92)
                      .|..+. ++|.+-|+.||+.-
T Consensus       355 ~~t~ld-~~e~~ll~kYLQ~h  374 (390)
T PRK15032        355 GFTSLD-KREERTLLKYLQMN  374 (390)
T ss_pred             hccCCC-HHHHHHHHHHHHHh
Confidence            455655 88999999999754


No 50 
>PF09722 DUF2384:  Protein of unknown function (DUF2384);  InterPro: IPR024467 This domain is found predominantly in proteobacterial proteins. Its function in unknown.
Probab=79.19  E-value=1.7  Score=22.59  Aligned_cols=42  Identities=14%  Similarity=0.365  Sum_probs=29.5

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      +++....|+..|....-| .-|..-+.+...+..|.+||..+.
T Consensus        10 d~~~a~~Wl~~p~~~l~g-~~Plel~~t~~G~~~V~~~L~~~~   51 (54)
T PF09722_consen   10 DEDKARRWLRTPNPALGG-RTPLELLRTEAGAERVLDYLDRIE   51 (54)
T ss_pred             CHHHHHHHHHChHHHhCC-CCHHHHHcChHHHHHHHHHHHHHH
Confidence            678899999988765433 234333445888899999997653


No 51 
>PF02433 FixO:  Cytochrome C oxidase, mono-heme subunit/FixO;  InterPro: IPR003468 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO) []. Cytochrome cbb3 oxidases are required both to support symbiotic nitrogen fixation, whilst ensuring that the oxygen-labile nitrogenase is not compromised. Cytochrome cbb3 oxidases consist of four subunits: FixN (or CcoN), FixO (or CcoO), FixP (or CcoP) and FixQ (or CcoQ). The catalytic core is comprised of subunits FixN, FixO and FixP, where FixN acts as the catalytic subunit, and Fix O and FixP are membrane-bound mono- and di-haem cytochromes c, respectively. The FixQ subunit protects the core complex in the presence of oxygen from proteolytic degradation []. This entry represents the mono-haem FixO subunit.
Probab=75.79  E-value=1.8  Score=29.61  Aligned_cols=16  Identities=38%  Similarity=0.474  Sum_probs=13.7

Q ss_pred             CHHHHHHHHHHHhhcc
Q psy8407          76 KPQERGDLIAYLEQAS   91 (92)
Q Consensus        76 ~~~d~~~liayL~sl~   91 (92)
                      ...|+.+|||||+.|-
T Consensus       207 ~~~Ei~ALIAYLQ~LG  222 (226)
T PF02433_consen  207 EDTEIVALIAYLQRLG  222 (226)
T ss_pred             CccHHHHHHHHHHHcc
Confidence            3689999999999873


No 52 
>PRK14487 cbb3-type cytochrome c oxidase subunit II; Provisional
Probab=74.63  E-value=2.2  Score=29.02  Aligned_cols=15  Identities=40%  Similarity=0.499  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHhhcc
Q psy8407          77 PQERGDLIAYLEQAS   91 (92)
Q Consensus        77 ~~d~~~liayL~sl~   91 (92)
                      ..|+++|||||++|.
T Consensus       193 ~te~~AliAYLq~LG  207 (217)
T PRK14487        193 ITEMDALIAYLQSLG  207 (217)
T ss_pred             ccHHHHHHHHHHHhc
Confidence            589999999999874


No 53 
>TIGR00781 ccoO cytochrome c oxidase, cbb3-type, subunit II. This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups).
Probab=74.06  E-value=2.3  Score=29.18  Aligned_cols=15  Identities=33%  Similarity=0.485  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHHhhcc
Q psy8407          77 PQERGDLIAYLEQAS   91 (92)
Q Consensus        77 ~~d~~~liayL~sl~   91 (92)
                      ..|+++|||||++|.
T Consensus       207 ~tE~~ALiAYLQ~LG  221 (232)
T TIGR00781       207 LTEMDALVAYLQSLG  221 (232)
T ss_pred             chHHHHHHHHHHHhc
Confidence            689999999999874


No 54 
>COG1858 MauG Cytochrome c peroxidase [Inorganic ion transport and metabolism]
Probab=73.16  E-value=8.5  Score=28.22  Aligned_cols=11  Identities=36%  Similarity=0.736  Sum_probs=8.7

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      .+|++||....
T Consensus       231 ~~C~aCH~g~~  241 (364)
T COG1858         231 ANCAACHNGIN  241 (364)
T ss_pred             CCchhhccCcc
Confidence            37999998764


No 55 
>PF06537 DUF1111:  Protein of unknown function (DUF1111);  InterPro: IPR010538 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=71.71  E-value=2.5  Score=32.17  Aligned_cols=19  Identities=37%  Similarity=0.712  Sum_probs=15.6

Q ss_pred             CCCCCCHHHHHHHHHHHhhc
Q psy8407          71 FAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        71 ~~~~~~~~d~~~liayL~sl   90 (92)
                      |..+ +++|+++||+||.||
T Consensus       481 f~~L-~~~dR~aLi~FL~SL  499 (499)
T PF06537_consen  481 FRAL-SKEDRAALIAFLESL  499 (499)
T ss_pred             HHhC-CHHHHHHHHHHHhcC
Confidence            3444 499999999999987


No 56 
>cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings.  There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c
Probab=71.32  E-value=2  Score=24.38  Aligned_cols=32  Identities=19%  Similarity=0.393  Sum_probs=23.3

Q ss_pred             ccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q psy8407          48 WNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIA   85 (92)
Q Consensus        48 ~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~lia   85 (92)
                      .+++...+|+.||.++.     --.+++ ++|+++|.+
T Consensus        14 ~~~~~re~f~~dp~a~~-----~~~~Lt-~eE~~al~~   45 (77)
T cd07321          14 VKPEVKERFKADPEAVL-----AEYGLT-PEEKAALLA   45 (77)
T ss_pred             cCHHHHHHHHhCHHHHH-----HHcCCC-HHHHHHHHc
Confidence            46788889999997643     334665 899988753


No 57 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=69.04  E-value=2  Score=27.51  Aligned_cols=11  Identities=45%  Similarity=1.141  Sum_probs=9.1

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      ..|.+||+...
T Consensus        81 N~CL~CH~~~~   91 (149)
T PRK11586         81 NRCLQCHGVES   91 (149)
T ss_pred             CcCccCCCHhH
Confidence            36999999885


No 58 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=68.58  E-value=1.6  Score=28.05  Aligned_cols=11  Identities=36%  Similarity=1.102  Sum_probs=9.0

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      ..|.+||+.+.
T Consensus        87 N~CLsCH~~e~   97 (155)
T COG3043          87 NRCLSCHSVEN   97 (155)
T ss_pred             chhhhccCHHH
Confidence            36999999875


No 59 
>PF03150 CCP_MauG:  Di-haem cytochrome c peroxidase;  InterPro: IPR004852 This is a group of distinct cytochrome c peroxidases (CCPs) that contain two haem groups. Similar to other cytochrome c peroxidases, they reduce hydrogen peroxide to water using c-type haem as an oxidizable substrate. However, since they possess two, instead of one, haem prosthetic groups, bacterial CCPs reduce hydrogen peroxide without the need to generate semi-stable free radicals. The two haem groups have significantly different redox potentials. The high potential (+320 mV) haem feeds electrons from electron shuttle proteins to the low potential (-330 mV) haem, where peroxide is reduced (indeed, the low potential site is known as the peroxidatic site) []. The CCP protein itself is structured into two domains, each containing one c-type haem group, with a calcium-binding site at the domain interface. This family also includes MauG proteins, whose similarity to di-haem CCP was previously recognised [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IQC_A 2VHD_B 1EB7_A 3RN0_A 3SVW_B 3RMZ_A 3SJL_B 3PXW_A 3SLE_B 3PXS_A ....
Probab=67.91  E-value=0.94  Score=29.15  Aligned_cols=17  Identities=18%  Similarity=0.061  Sum_probs=11.5

Q ss_pred             CCCHHHHHHHHHHHhhc
Q psy8407          74 IKKPQERGDLIAYLEQA   90 (92)
Q Consensus        74 ~~~~~d~~~liayL~sl   90 (92)
                      +.-+.=.++|.+|.+|+
T Consensus       125 ~t~~~i~~Alaaf~~tl  141 (159)
T PF03150_consen  125 ITFENIGKALAAFERTL  141 (159)
T ss_dssp             CSHHHHHHHHHHHHTTT
T ss_pred             chHHHHHHHHHHHHhcc
Confidence            33344557888888876


No 60 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=66.84  E-value=2.4  Score=19.03  Aligned_cols=8  Identities=63%  Similarity=1.551  Sum_probs=6.1

Q ss_pred             CCccCccc
Q psy8407           2 KCAQCHTI    9 (92)
Q Consensus         2 ~C~~CH~~    9 (92)
                      .|+.||.+
T Consensus        18 rCa~C~~V   25 (25)
T PF06943_consen   18 RCACCHTV   25 (25)
T ss_pred             ECCccCcC
Confidence            48888875


No 61 
>PF07627 PSCyt3:  Protein of unknown function (DUF1588);  InterPro: IPR013039  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO.
Probab=66.28  E-value=1.1  Score=26.93  Aligned_cols=9  Identities=44%  Similarity=0.969  Sum_probs=7.4

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|++||..-
T Consensus        71 ~Ca~CH~~i   79 (101)
T PF07627_consen   71 ACASCHRKI   79 (101)
T ss_pred             cHHHHhhhh
Confidence            599999854


No 62 
>KOG3052|consensus
Probab=64.52  E-value=1.4  Score=30.83  Aligned_cols=14  Identities=29%  Similarity=0.449  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHhhc
Q psy8407          77 PQERGDLIAYLEQA   90 (92)
Q Consensus        77 ~~d~~~liayL~sl   90 (92)
                      .|..+|++.||.-.
T Consensus       249 sQ~aKDV~~FL~Wa  262 (311)
T KOG3052|consen  249 SQMAKDVVTFLHWA  262 (311)
T ss_pred             HHHHHHHHHHHHhc
Confidence            56678999999753


No 63 
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and   subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. 2-aminophenol 1,6-dioxygenase is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, the enzyme has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=63.85  E-value=3.1  Score=24.01  Aligned_cols=33  Identities=18%  Similarity=0.317  Sum_probs=24.6

Q ss_pred             ccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHH
Q psy8407          46 ITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLI   84 (92)
Q Consensus        46 ~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~li   84 (92)
                      +.++++...+|+.||+++     |-..+++ ++|+++|.
T Consensus        13 L~~dp~~rerF~~DPea~-----~~~~gLt-~eE~~aL~   45 (81)
T cd07922          13 LFKDPGLIERFQDDPSAV-----FEEYGLT-PAERAALR   45 (81)
T ss_pred             HhcCHHHHHHHHHCHHHH-----HHHcCCC-HHHHHHHH
Confidence            456888999999999864     3335665 89888774


No 64 
>TIGR01905 paired_CXXCH_1 doubled CXXCH domain. This model represents a domain of about 41 amino acids that contains, among other motifs, two copies of the motif CXXCH associated with heme binding. Almost every member of this family has at least three copies of this domain (at least six copies of CXXCH) is predicted to be a high molecular weight c-type cytochrome. Members are found mostly in species of Shewanella, Geobacter, and Vibrio.
Probab=63.50  E-value=3.3  Score=20.63  Aligned_cols=10  Identities=30%  Similarity=0.953  Sum_probs=8.4

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||..-+
T Consensus         8 ~C~~CH~pH~   17 (41)
T TIGR01905         8 DCTSCHDPHG   17 (41)
T ss_pred             Cccccccccc
Confidence            5999999874


No 65 
>PF11845 DUF3365:  Protein of unknown function (DUF3365);  InterPro: IPR021796  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 198 to 657 amino acids in length. 
Probab=61.45  E-value=2.1  Score=27.60  Aligned_cols=8  Identities=38%  Similarity=1.041  Sum_probs=6.8

Q ss_pred             CCCccCcc
Q psy8407           1 MKCAQCHT    8 (92)
Q Consensus         1 ~~C~~CH~    8 (92)
                      +.|..||+
T Consensus       147 ~~CL~CHg  154 (188)
T PF11845_consen  147 ESCLSCHG  154 (188)
T ss_pred             hHHHHccC
Confidence            35999999


No 66 
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=61.03  E-value=7.8  Score=20.63  Aligned_cols=15  Identities=20%  Similarity=0.359  Sum_probs=12.4

Q ss_pred             CCHHHHHHHHHHHhh
Q psy8407          75 KKPQERGDLIAYLEQ   89 (92)
Q Consensus        75 ~~~~d~~~liayL~s   89 (92)
                      .+++|+++|++|..|
T Consensus        17 ft~~El~~i~~FY~S   31 (64)
T PF09832_consen   17 FTEEELDAILAFYES   31 (64)
T ss_dssp             S-HHHHHHHHHHHHS
T ss_pred             CCHHHHHHHHHHHCC
Confidence            359999999999876


No 67 
>PF07583 PSCyt2:  Protein of unknown function (DUF1549);  InterPro: IPR011444 The function is not known. It is found associated with IPR022655 from INTERPRO. It is also found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO.
Probab=60.51  E-value=3.1  Score=28.05  Aligned_cols=9  Identities=56%  Similarity=1.217  Sum_probs=7.4

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      +|+.||.-.
T Consensus       176 ~CAqCHdHp  184 (208)
T PF07583_consen  176 QCAQCHDHP  184 (208)
T ss_pred             chhhccCCC
Confidence            699999765


No 68 
>PF07128 DUF1380:  Protein of unknown function (DUF1380);  InterPro: IPR009811 This family consists of several hypothetical bacterial proteins of around 140 residues in length. Members of this family seem to be specific to Enterobacteria. The function of this family is unknown.
Probab=58.61  E-value=22  Score=22.57  Aligned_cols=34  Identities=12%  Similarity=0.365  Sum_probs=23.7

Q ss_pred             ccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhhc
Q psy8407          46 ITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        46 ~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~liayL~sl   90 (92)
                      ++|+++.+...-..         |-+ . ++++|++.|+++|-..
T Consensus        25 lIWT~eDV~~~a~g---------me~-~-lTd~E~~aVL~~I~~~   58 (139)
T PF07128_consen   25 LIWTREDVRALADG---------MEY-N-LTDDEARAVLARIGDI   58 (139)
T ss_pred             EEecHHHHHHHHhc---------CCC-C-CCHHHHHHHHHHHhcC
Confidence            68999988776431         322 1 3589999999988764


No 69 
>PF09699 Paired_CXXCH_1:  Doubled CXXCH motif (Paired_CXXCH_1)
Probab=57.94  E-value=3  Score=20.36  Aligned_cols=10  Identities=30%  Similarity=0.986  Sum_probs=8.2

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||..-+
T Consensus         8 ~C~~CH~~H~   17 (41)
T PF09699_consen    8 QCTSCHDPHG   17 (41)
T ss_pred             ChhHhccccc
Confidence            5999998774


No 70 
>TIGR02161 napC_nirT periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family. Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Probab=57.62  E-value=4  Score=27.03  Aligned_cols=10  Identities=40%  Similarity=1.271  Sum_probs=8.3

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      ++|.+||+.+
T Consensus       136 ~~C~~CH~~~  145 (185)
T TIGR02161       136 LECRNCHNFE  145 (185)
T ss_pred             hhchhhcCcc
Confidence            4799999965


No 71 
>PRK10617 cytochrome c-type protein NapC; Provisional
Probab=54.96  E-value=5  Score=26.95  Aligned_cols=10  Identities=30%  Similarity=1.115  Sum_probs=8.3

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      ++|.+||+.+
T Consensus       145 ~~Cr~CH~~~  154 (200)
T PRK10617        145 QECRNCHNFD  154 (200)
T ss_pred             ccchhhcCcc
Confidence            4799999965


No 72 
>COG3005 TorC Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit [Energy production and conversion]
Probab=54.05  E-value=4  Score=27.20  Aligned_cols=11  Identities=36%  Similarity=1.096  Sum_probs=9.1

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      ++|.+||+++.
T Consensus       135 ~eCr~CH~~~~  145 (190)
T COG3005         135 AECRNCHNFDA  145 (190)
T ss_pred             hhhhhccchhh
Confidence            36999999984


No 73 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=53.40  E-value=5.2  Score=18.78  Aligned_cols=9  Identities=44%  Similarity=1.265  Sum_probs=7.0

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      +|+.||.+.
T Consensus        21 rCs~C~~vt   29 (31)
T TIGR01053        21 RCALCQTVN   29 (31)
T ss_pred             ECCCCCeEe
Confidence            488898875


No 74 
>PHA02119 hypothetical protein
Probab=52.40  E-value=10  Score=21.41  Aligned_cols=10  Identities=30%  Similarity=0.680  Sum_probs=8.5

Q ss_pred             HHHHHHHhhc
Q psy8407          81 GDLIAYLEQA   90 (92)
Q Consensus        81 ~~liayL~sl   90 (92)
                      +||++||++|
T Consensus        57 ~divdylr~l   66 (87)
T PHA02119         57 KDIVDYLRSL   66 (87)
T ss_pred             HHHHHHHHHc
Confidence            6789999987


No 75 
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the Pfam model pfam03031.
Probab=51.46  E-value=22  Score=22.54  Aligned_cols=24  Identities=25%  Similarity=0.209  Sum_probs=19.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhccC
Q psy8407          69 MIFAGIKKPQERGDLIAYLEQASK   92 (92)
Q Consensus        69 Mp~~~~~~~~d~~~liayL~sl~~   92 (92)
                      .||.+-.+|.++..|+.||.+|++
T Consensus       136 ~~f~~~~~D~~L~~l~~~L~~l~~  159 (162)
T TIGR02251       136 KSWFGDPNDTELLNLIPFLEGLRF  159 (162)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHhc
Confidence            357776779999999999999864


No 76 
>PF03892 NapB:  Nitrate reductase cytochrome c-type subunit (NapB);  InterPro: IPR005591 The napB gene encodes a dihaem cytochrome c, the small subunit of a heterodimeric periplasmic nitrate reductase [].; PDB: 3O5A_B 3ML1_B 1OGY_L 1JNI_A.
Probab=51.44  E-value=3.2  Score=26.13  Aligned_cols=10  Identities=50%  Similarity=1.125  Sum_probs=8.8

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||+...
T Consensus        71 ~Cl~CH~~~~   80 (133)
T PF03892_consen   71 KCLSCHSPEV   80 (133)
T ss_dssp             CCHHHHSTTT
T ss_pred             cCcccCCccc
Confidence            6999999985


No 77 
>cd07921 PCA_45_Doxase_A_like Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes. This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Probab=50.50  E-value=8.6  Score=23.33  Aligned_cols=31  Identities=6%  Similarity=0.202  Sum_probs=22.8

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIA   85 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~lia   85 (92)
                      ++++..+|+.||.++     |--.+++ +||+++|.+
T Consensus        25 ~a~~Re~F~aD~eAy-----~~~~gLT-eEe~~AV~~   55 (106)
T cd07921          25 KAENREAFKADEEAY-----CDKFGLT-EEQKQAVLD   55 (106)
T ss_pred             CHHHHHHHHhCHHHH-----HHHcCCC-HHHHHHHHh
Confidence            677888999999764     4345665 899888753


No 78 
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=48.55  E-value=16  Score=19.36  Aligned_cols=17  Identities=18%  Similarity=0.473  Sum_probs=13.5

Q ss_pred             CCCHHHHHHHHHHHhhc
Q psy8407          74 IKKPQERGDLIAYLEQA   90 (92)
Q Consensus        74 ~~~~~d~~~liayL~sl   90 (92)
                      +...+.+..|+.||++.
T Consensus        10 l~~~e~L~~l~~YLR~~   26 (55)
T PF13821_consen   10 LSPEERLDKLLSYLREE   26 (55)
T ss_pred             cCHHHHHHHHHHHHHhh
Confidence            34478899999999863


No 79 
>KOG1200|consensus
Probab=47.39  E-value=23  Score=24.38  Aligned_cols=20  Identities=15%  Similarity=0.383  Sum_probs=16.0

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy8407          70 IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~s   89 (92)
                      |...+=..||+++++.||.|
T Consensus       218 Pmgr~G~~EevA~~V~fLAS  237 (256)
T KOG1200|consen  218 PMGRLGEAEEVANLVLFLAS  237 (256)
T ss_pred             CccccCCHHHHHHHHHHHhc
Confidence            44455578999999999986


No 80 
>PF13435 Cytochrome_C554:  Cytochrome c554 and c-prime; PDB: 1BVB_A 1FT5_A 1FT6_A 1SP3_A.
Probab=47.39  E-value=8.4  Score=22.34  Aligned_cols=11  Identities=36%  Similarity=0.803  Sum_probs=8.6

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      ..|..||....
T Consensus        49 ~~C~~CH~~~~   59 (130)
T PF13435_consen   49 DSCTSCHTPGG   59 (130)
T ss_dssp             CCCGGGSCCTT
T ss_pred             CcccccCCCcc
Confidence            36999998874


No 81 
>PF14522 Cytochrome_C7:  Cytochrome c7; PDB: 3OV0_A 3OUQ_A 3H4N_A 3BXU_B 1OS6_A 2LDO_A 3OUE_A 3H33_A 1RWJ_A 1LM2_A ....
Probab=46.58  E-value=9.7  Score=19.93  Aligned_cols=9  Identities=44%  Similarity=1.110  Sum_probs=7.5

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|..||...
T Consensus        14 ~C~~CH~~~   22 (65)
T PF14522_consen   14 NCASCHSDT   22 (65)
T ss_dssp             CGCCTSTTT
T ss_pred             ChhhhCCCc
Confidence            699999884


No 82 
>PF11829 DUF3349:  Protein of unknown function (DUF3349);  InterPro: IPR021784  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 99 to 124 amino acids in length. ; PDB: 2KVC_A 3OL3_B 3OL4_A 2LKY_A.
Probab=45.53  E-value=7.2  Score=23.20  Aligned_cols=14  Identities=21%  Similarity=0.185  Sum_probs=10.2

Q ss_pred             CCHHHHHHHHHHHh
Q psy8407          75 KKPQERGDLIAYLE   88 (92)
Q Consensus        75 ~~~~d~~~liayL~   88 (92)
                      ++++|+..|++-|.
T Consensus        36 Ltd~ev~~Va~~L~   49 (96)
T PF11829_consen   36 LTDDEVAEVAAELA   49 (96)
T ss_dssp             S-HHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHH
Confidence            55888888888774


No 83 
>PRK14485 putative bifunctional cbb3-type cytochrome c oxidase subunit I/II; Provisional
Probab=44.01  E-value=15  Score=29.27  Aligned_cols=46  Identities=17%  Similarity=0.205  Sum_probs=25.5

Q ss_pred             CccccHHHHHHHHhCCCCC-CC-CCCC---CCCCCCCHHHHHHHHHHHhhcc
Q psy8407          45 GITWNKDTLFEYLENPKKY-IP-GTKM---IFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        45 ~~~~~~~~l~~~i~~P~~~-~p-~~~M---p~~~~~~~~d~~~liayL~sl~   91 (92)
                      |...+++++.+.-.+=++. .+ ...|   -+.+.. +.|+++|||||++|.
T Consensus       648 gvpy~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~-~~e~~aliaylq~lg  698 (712)
T PRK14485        648 GVPYTDGYEENAQADLREQAEAIAADLAADGFKVAP-DKEIVALIAYLQRLG  698 (712)
T ss_pred             CCCCCHHHHHHHHHHHHHhhhhhhhHHHhccCCCCc-chHHHHHHHHHHHhc
Confidence            6677777776544321110 00 0111   123332 789999999999874


No 84 
>PF08090 Enterotoxin_HS1:  Heat stable E.coli enterotoxin 1;  InterPro: IPR012557 Heat-stable toxin 1 of entero-aggregative Escherichia coli (EAST1) is a small toxin. It is not, however, solely associated with entero-aggregative E. coli but also with many other diarrhoeic E. coli families. Some studies have established the role of EAST1 in some human outbreaks of diarrhoea. Isolates from farm animals have been shown to carry the astA gene coding for EAST1. However, the relation between the presence of EAST1 and disease is not conclusive [].
Probab=43.04  E-value=9.6  Score=18.09  Aligned_cols=9  Identities=33%  Similarity=0.951  Sum_probs=6.7

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|++||.-.
T Consensus        21 ac~s~~grt   29 (36)
T PF08090_consen   21 ACGSCHGRT   29 (36)
T ss_pred             hhccCCCCc
Confidence            488888755


No 85 
>PF15182 OTOS:  Otospiralin
Probab=42.89  E-value=52  Score=18.18  Aligned_cols=24  Identities=8%  Similarity=0.181  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          67 TKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        67 ~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      ..||++..+ -.|.=.-|+|++++-
T Consensus        15 pa~PYWPfs-tsDFW~YveyFrtlG   38 (69)
T PF15182_consen   15 PAMPYWPFS-TSDFWNYVEYFRTLG   38 (69)
T ss_pred             CcCCcCCcc-chHHHHHHHHHHHhc
Confidence            359998877 588889999998874


No 86 
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245. This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
Probab=42.71  E-value=50  Score=21.99  Aligned_cols=36  Identities=25%  Similarity=0.242  Sum_probs=24.1

Q ss_pred             HHHHhCCCCCCCCCCCCCCC----CCCHHHHHHHHHHHhhcc
Q psy8407          54 FEYLENPKKYIPGTKMIFAG----IKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        54 ~~~i~~P~~~~p~~~Mp~~~----~~~~~d~~~liayL~sl~   91 (92)
                      ..++.+|...++=  -||.+    -.+|.++.+|+.||..+.
T Consensus       140 ~~~~~~P~N~i~I--~~f~~~~~~~~~D~eL~~L~~yL~~la  179 (195)
T TIGR02245       140 RNFLMNPQNGLKI--RPFKKAHANRGTDQELLKLTQYLKTIA  179 (195)
T ss_pred             HHHhcCCCCcccc--CCccccCCCCcccHHHHHHHHHHHHHh
Confidence            4567788765431  24432    235889999999999875


No 87 
>cd02642 R3H_encore_like R3H domain of encore-like and DIP1-like proteins. Drosophila encore is involved in the germline exit after four mitotic divisions, by facilitating SCF-ubiquitin-proteasome-dependent proteolysis. Maize DBF1-interactor protein 1 (DIP1) containing an R3H domain is a potential regulator of DBF1 activity in stress responses. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=42.71  E-value=16  Score=19.63  Aligned_cols=13  Identities=8%  Similarity=0.424  Sum_probs=10.7

Q ss_pred             cHHHHHHHHhCCC
Q psy8407          49 NKDTLFEYLENPK   61 (92)
Q Consensus        49 ~~~~l~~~i~~P~   61 (92)
                      -++.|..||.++.
T Consensus         8 ~E~~i~~Fi~~~~   20 (63)
T cd02642           8 LEKDLLAFIKDST   20 (63)
T ss_pred             HHHHHHHHHhCCC
Confidence            3788999999983


No 88 
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein. Members of this family represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR) as described in model TIGR02491. Members of this family are found paired with members of a similarly divergent set of anaerobic ribonucleoside-triphosphate reductases. Identification of this protein as an RNR activitating protein is partly from pairing with a candidate RNR. It is further supported by our finding that upstream of these operons are examples of a conserved regulatory element (described Rodionov and Gelfand) that is found in nearly all bacteria and that occurs specifically upstream of operons for all three classes of RNR genes.
Probab=42.60  E-value=61  Score=20.42  Aligned_cols=10  Identities=40%  Similarity=1.002  Sum_probs=8.0

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      +|..||+...
T Consensus        28 rC~~C~n~~~   37 (147)
T TIGR02826        28 GCKGCHSPES   37 (147)
T ss_pred             CCCCCCChHH
Confidence            6999999753


No 89 
>PF07746 LigA:  Aromatic-ring-opening dioxygenase LigAB, LigA subunit;  InterPro: IPR011986  Dioxygenases catalyse the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms. Cleavage of aromatic rings is one of the most important functions of dioxygenases, which play key roles in the degradation of aromatic compounds. The substrates of ring-cleavage dioxygenases can be classified into two groups according to the mode of scission of the aromatic ring. Intradiol enzymes (IPR000627 from INTERPRO) use a non-haem Fe(III) to cleave the aromatic ring between two hydroxyl groups (ortho-cleavage), whereas extradiol enzymes use a non-haem Fe(II) to cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon (meta-cleavage) [, ]. These two subfamilies differ in sequence, structural fold, iron ligands, and the orientation of second sphere active site amino acid residues. Extradiol dioxygenases are usually homo-multimeric, bind one atom of ferrous ion per subunit and have a subunit size of about 33 kDa. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes (IPR000486 from INTERPRO) show sequence similarity, with the two-domain class II enzymes having evolved from a class I enzyme through gene duplication. Class III enzymes are different in sequence and structure, but they do share several common active-site characteristics with the class II enzymes, in particular the coordination sphere and the disposition of the putative catalytic base are very similar. Class III enzymes usually have two subunits, designated A (IPR004183 from INTERPRO) and B (IPR004183 from INTERPRO). LigAB is a protocatechuate 4,5-dioxygenase (1.13.11.8 from EC) that belongs to the extradiol class III enzyme family. The LigA subunit of this enzyme is multi-helical, containing a compact array of 6 short helices [].; PDB: 1BOU_A 1B4U_A.
Probab=41.83  E-value=6.7  Score=22.88  Aligned_cols=31  Identities=19%  Similarity=0.412  Sum_probs=20.0

Q ss_pred             ccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHH
Q psy8407          48 WNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLI   84 (92)
Q Consensus        48 ~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~li   84 (92)
                      .+++...+|+.||.++.     --.+++ ++|+++|.
T Consensus         9 ~~~~~r~~F~~D~~a~~-----~~~~Lt-~eer~av~   39 (88)
T PF07746_consen    9 NDPENRERFLADPEAYL-----DEYGLT-EEERQAVL   39 (88)
T ss_dssp             GSHHHHHHHHH-HHHHH-----HCCT---HHHHHHHH
T ss_pred             cCHHHHHHHHHCHHHHH-----HHcCCC-HHHHHHHH
Confidence            46788889999997543     334565 88888764


No 90 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=41.21  E-value=40  Score=18.12  Aligned_cols=18  Identities=28%  Similarity=0.257  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHhhc
Q psy8407          73 GIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        73 ~~~~~~d~~~liayL~sl   90 (92)
                      |--++||+++|++=|..+
T Consensus         9 GnPt~eElAAL~aVlaa~   26 (62)
T PF13822_consen    9 GNPTDEELAALTAVLAAR   26 (62)
T ss_pred             CCCCHHHHHHHHHHHHHH
Confidence            334699999999988765


No 91 
>TIGR03153 cytochr_NrfH cytochrome c nitrate reductase, small subunit. Members of this protein family are NrfH, a tetraheme cytochrome c. NrfH is the cytochrome c nitrate reductase small subunit, and forms a heterodimer with NrfA, the catalytic subunit. While NrfA can act as a monomer, NrfH can bind to and anchor NrfA in the membrane and enables electron transfer to NrfA from quinones.
Probab=39.88  E-value=6.9  Score=24.38  Aligned_cols=10  Identities=30%  Similarity=0.757  Sum_probs=7.9

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      .+|.+||+-.
T Consensus       103 ~nC~~CH~~~  112 (135)
T TIGR03153       103 ENCVRCHAGL  112 (135)
T ss_pred             cchHHHHhHH
Confidence            3799999864


No 92 
>PF14537 Cytochrom_c3_2:  Cytochrome c3; PDB: 1D4C_A 1D4E_A 1D4D_A 2K3V_A 1QO8_D 2P0B_A 2OZY_A 1M64_A 1JRX_A 1QJD_A ....
Probab=39.16  E-value=14  Score=19.94  Aligned_cols=9  Identities=33%  Similarity=1.018  Sum_probs=7.1

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      +|..||...
T Consensus         8 ~C~~CH~~~   16 (80)
T PF14537_consen    8 NCVDCHGPH   16 (80)
T ss_dssp             TGGGTSSSS
T ss_pred             ChhHhCCCC
Confidence            699999754


No 93 
>COG5204 SPT4 Transcription elongation factor SPT4 [Transcription]
Probab=39.02  E-value=45  Score=20.00  Aligned_cols=34  Identities=15%  Similarity=0.215  Sum_probs=19.5

Q ss_pred             cHHHHHHHHhCCCCCCCC-CCCCCCCCCCHHHHHHH
Q psy8407          49 NKDTLFEYLENPKKYIPG-TKMIFAGIKKPQERGDL   83 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~-~~Mp~~~~~~~~d~~~l   83 (92)
                      +..|+.+|.+-- .+.+| ..|--.+.++++-+++|
T Consensus        62 t~SWVakWqrid-~f~~GlYA~~V~G~L~edvve~L   96 (112)
T COG5204          62 TNSWVAKWQRID-EFRKGLYAMVVEGALSEDVVEDL   96 (112)
T ss_pred             cHHHHHHHhhhc-ccccceeEEEEcccCCHHHHHHH
Confidence            566788887642 23444 23445677755555554


No 94 
>CHL00037 petA cytochrome f
Probab=38.91  E-value=10  Score=27.12  Aligned_cols=9  Identities=44%  Similarity=1.128  Sum_probs=7.1

Q ss_pred             CccCccccC
Q psy8407           3 CAQCHTIEA   11 (92)
Q Consensus         3 C~~CH~~~~   11 (92)
                      |+.||-...
T Consensus        56 CANCHLA~K   64 (320)
T CHL00037         56 CANCHLANK   64 (320)
T ss_pred             eeccccccC
Confidence            999997654


No 95 
>PF03264 Cytochrom_NNT:  NapC/NirT cytochrome c family, N-terminal region;  InterPro: IPR005126 Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC P33932 from SWISSPROT and NirT P24038 from SWISSPROT, bind four haem groups, while others, such as TorC P33226 from SWISSPROT, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs.; PDB: 2VR0_F 2J7A_C.
Probab=38.87  E-value=9  Score=24.65  Aligned_cols=10  Identities=50%  Similarity=1.152  Sum_probs=7.8

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      -|++||....
T Consensus        37 fC~sCH~m~~   46 (173)
T PF03264_consen   37 FCASCHEMEP   46 (173)
T ss_dssp             HHTTSGGGHH
T ss_pred             HHHhhcCCcH
Confidence            3899998774


No 96 
>PF15161 Neuropep_like:  Neuropeptide-like
Probab=38.37  E-value=7.3  Score=21.04  Aligned_cols=10  Identities=40%  Similarity=1.095  Sum_probs=8.0

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      +-|.-||..+
T Consensus        14 RPCVDCHAFe   23 (65)
T PF15161_consen   14 RPCVDCHAFE   23 (65)
T ss_pred             CCchhhHHHH
Confidence            3599999887


No 97 
>COG3445 Acid-induced glycyl radical enzyme [General function prediction only]
Probab=38.16  E-value=33  Score=20.72  Aligned_cols=38  Identities=29%  Similarity=0.590  Sum_probs=26.5

Q ss_pred             cccHHHHHHHHhCCCCCCC------CCCCCCCCCCCHHHHHHHHH
Q psy8407          47 TWNKDTLFEYLENPKKYIP------GTKMIFAGIKKPQERGDLIA   85 (92)
Q Consensus        47 ~~~~~~l~~~i~~P~~~~p------~~~Mp~~~~~~~~d~~~lia   85 (92)
                      +..++.|...+++|.++..      |....|..+. +++-+|+|+
T Consensus        77 vl~retledav~~pekypqltirvsgyavrfnslt-peqqrdvi~  120 (127)
T COG3445          77 VLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLT-PEQQRDVIA  120 (127)
T ss_pred             eeehhhHHHHhhCcccCCceEEEEeeEEEEeccCC-HHHhhhHHH
Confidence            3468899999999988643      3333466666 777777775


No 98 
>PRK02693 apocytochrome f; Reviewed
Probab=37.56  E-value=11  Score=26.75  Aligned_cols=9  Identities=44%  Similarity=1.158  Sum_probs=7.2

Q ss_pred             CccCccccC
Q psy8407           3 CAQCHTIEA   11 (92)
Q Consensus         3 C~~CH~~~~   11 (92)
                      |+.||-...
T Consensus        49 CANCHLA~K   57 (312)
T PRK02693         49 CANCHLAQK   57 (312)
T ss_pred             eeccccccC
Confidence            999997654


No 99 
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]
Probab=36.74  E-value=36  Score=24.19  Aligned_cols=31  Identities=23%  Similarity=0.419  Sum_probs=22.8

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHH
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLI   84 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~li   84 (92)
                      +.+-|..+|+.-     |..|||..-++++||++..
T Consensus       226 daq~Il~yL~~~-----gG~mpf~DKSsPEdIk~~F  256 (287)
T COG2996         226 DAQMILTYLESN-----GGFMPFNDKSSPEDIKATF  256 (287)
T ss_pred             hHHHHHHHHHHc-----CCccccCCCCCHHHHHHHh
Confidence            445566666642     4679999999999998764


No 100
>PF14769 CLAMP:  Flagellar C1a complex subunit C1a-32
Probab=36.64  E-value=44  Score=19.55  Aligned_cols=18  Identities=22%  Similarity=0.398  Sum_probs=15.0

Q ss_pred             CCCCCHHHHHHHHHHHhh
Q psy8407          72 AGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        72 ~~~~~~~d~~~liayL~s   89 (92)
                      .++.+.+|+++|++|+.+
T Consensus        61 ~~iFs~~~~~~i~~y~~~   78 (101)
T PF14769_consen   61 IGIFSVDQVKAIIDYFHN   78 (101)
T ss_pred             cCcCCHHHHHHHHHHHHH
Confidence            356789999999999975


No 101
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=36.54  E-value=14  Score=25.53  Aligned_cols=11  Identities=27%  Similarity=0.603  Sum_probs=8.6

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      +.|++||..-+
T Consensus       198 ~~C~GC~m~l~  208 (239)
T COG1579         198 RVCGGCHMKLP  208 (239)
T ss_pred             CcccCCeeeec
Confidence            35999998764


No 102
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=36.40  E-value=19  Score=19.81  Aligned_cols=11  Identities=18%  Similarity=0.770  Sum_probs=8.5

Q ss_pred             CCCccCccccC
Q psy8407           1 MKCAQCHTIEA   11 (92)
Q Consensus         1 ~~C~~CH~~~~   11 (92)
                      +.|..||.+..
T Consensus         6 ~AC~~C~~i~~   16 (64)
T PRK06393          6 RACKKCKRLTP   16 (64)
T ss_pred             hhHhhCCcccC
Confidence            35899998874


No 103
>PF12797 Fer4_2:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=36.13  E-value=16  Score=15.82  Aligned_cols=7  Identities=29%  Similarity=1.099  Sum_probs=5.1

Q ss_pred             CCccCcc
Q psy8407           2 KCAQCHT    8 (92)
Q Consensus         2 ~C~~CH~    8 (92)
                      .|.+|++
T Consensus         9 rCiGC~~   15 (22)
T PF12797_consen    9 RCIGCGA   15 (22)
T ss_pred             cccCchh
Confidence            5888875


No 104
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=36.08  E-value=54  Score=15.58  Aligned_cols=13  Identities=31%  Similarity=0.762  Sum_probs=11.8

Q ss_pred             cccHHHHHHHHhC
Q psy8407          47 TWNKDTLFEYLEN   59 (92)
Q Consensus        47 ~~~~~~l~~~i~~   59 (92)
                      .|+.+.|..||..
T Consensus         3 tWs~~~L~~wL~~   15 (38)
T PF10281_consen    3 TWSDSDLKSWLKS   15 (38)
T ss_pred             CCCHHHHHHHHHH
Confidence            5999999999987


No 105
>PF02375 JmjN:  jmjN domain;  InterPro: IPR003349 Jumonji protein is required for neural tube formation in mice [].There is evidence of domain swapping within the jumonji family of transcription factors []. This domain is often associated with JmjC (see IPR003347 from INTERPRO).; PDB: 2XML_A 2W2I_C 3DXT_A 3DXU_A 2OX0_B 2OQ6_B 2WWJ_A 2Q8D_A 3PDQ_A 2YBK_A ....
Probab=35.58  E-value=17  Score=17.40  Aligned_cols=16  Identities=25%  Similarity=0.316  Sum_probs=11.6

Q ss_pred             CHHHHHHHHHHHhhcc
Q psy8407          76 KPQERGDLIAYLEQAS   91 (92)
Q Consensus        76 ~~~d~~~liayL~sl~   91 (92)
                      +.+|.+|-+.||.++.
T Consensus         6 t~eEF~dp~~yi~~i~   21 (34)
T PF02375_consen    6 TMEEFKDPIKYISSIE   21 (34)
T ss_dssp             -HHHHS-HHHHHHHHH
T ss_pred             CHHHHhCHHHHHHHHH
Confidence            4789999999998753


No 106
>cd07923 Gallate_dioxygenase_C The C-terminal domain of Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of the PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. This model represents the C-terminal domain, which is similar to the A subunit of PCA 4,5-dioxygenase (or LigAB). The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. Since enzymes in this subfamily have fused A and B subunits, the dimer interface may resemble the tetramer interface of classical LigAB enzymes. This enzyme belongs to the class III extradiol dioxygenase family, composed of enzymes whi
Probab=35.35  E-value=18  Score=21.47  Aligned_cols=30  Identities=23%  Similarity=0.311  Sum_probs=21.6

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHH
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLI   84 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~li   84 (92)
                      .+++-.+|+.||.++     |--.+++ +||+++|.
T Consensus        17 ~a~~RerF~~D~ea~-----~~e~gLt-~Ee~~av~   46 (94)
T cd07923          17 EPAHRERFLEDPEAL-----FDEAGLT-EEERTLIR   46 (94)
T ss_pred             CHHHHHHHHhCHHHH-----HHHcCCC-HHHHHHHH
Confidence            567778899998754     4445665 88888775


No 107
>PF08263 LRRNT_2:  Leucine rich repeat N-terminal domain;  InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats [].  This domain is often found at the N terminus of tandem leucine rich repeats.; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1OGQ_A.
Probab=33.32  E-value=44  Score=16.12  Aligned_cols=15  Identities=27%  Similarity=0.472  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHhhcc
Q psy8407          77 PQERGDLIAYLEQAS   91 (92)
Q Consensus        77 ~~d~~~liayL~sl~   91 (92)
                      ++|+++|++|-+++.
T Consensus         2 ~~d~~aLl~~k~~l~   16 (43)
T PF08263_consen    2 NQDRQALLAFKKSLN   16 (43)
T ss_dssp             HHHHHHHHHHHHCTT
T ss_pred             cHHHHHHHHHHHhcc
Confidence            689999999887664


No 108
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]
Probab=32.88  E-value=88  Score=21.65  Aligned_cols=20  Identities=25%  Similarity=0.371  Sum_probs=15.6

Q ss_pred             CCCCCC--CHHHHHHHHHHHhh
Q psy8407          70 IFAGIK--KPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~--~~~d~~~liayL~s   89 (92)
                      ||.++.  +-.||+.||.+|+.
T Consensus       166 PFAGVDPiaV~dIq~iI~~L~~  187 (243)
T COG1137         166 PFAGVDPIAVIDIQRIIKHLKD  187 (243)
T ss_pred             CccCCCchhHHHHHHHHHHHHh
Confidence            677643  47899999999985


No 109
>KOG3831|consensus
Probab=31.21  E-value=40  Score=21.95  Aligned_cols=44  Identities=20%  Similarity=0.388  Sum_probs=27.6

Q ss_pred             ccccHHH-HHHHHhCCCCCCC------CCCCC---CCCCCCHHHHHHHHHHHhh
Q psy8407          46 ITWNKDT-LFEYLENPKKYIP------GTKMI---FAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        46 ~~~~~~~-l~~~i~~P~~~~p------~~~Mp---~~~~~~~~d~~~liayL~s   89 (92)
                      +.|+--. =++.+++|.+++.      .+.||   |.-+-+++++..+-+|.+.
T Consensus        94 ~~wsiikakrq~l~~pdgfia~fynise~v~paia~gflg~~~ql~elc~ffk~  147 (196)
T KOG3831|consen   94 ACWSIIKAKRQLLKNPDGFIAHFYNISEHVMPAIAFGFLGPDEQLAELCAFFKE  147 (196)
T ss_pred             HHHHHHHHHHHHhcCCchHHHHHhhhhhhhhHHHHhhccCCcHHHHHHHHHHHH
Confidence            3565432 2356778988652      46788   3224468888888888764


No 110
>COG3488 Predicted thiol oxidoreductase [Energy production and conversion]
Probab=31.10  E-value=36  Score=25.12  Aligned_cols=19  Identities=37%  Similarity=0.651  Sum_probs=15.0

Q ss_pred             CCCCCCHHHHHHHHHHHhhc
Q psy8407          71 FAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        71 ~~~~~~~~d~~~liayL~sl   90 (92)
                      |..+ +..|+++|++||.||
T Consensus       463 faa~-~k~~R~ALvaFLeSL  481 (481)
T COG3488         463 FAAF-DKAQREALVAFLESL  481 (481)
T ss_pred             Hhcc-CHHHHHHHHHHHhcC
Confidence            3344 489999999999986


No 111
>PF11256 DUF3055:  Protein of unknown function (DUF3055);  InterPro: IPR021415  This family of proteins with unknown function appear to be restricted to Firmicutes. 
Probab=31.07  E-value=56  Score=18.85  Aligned_cols=18  Identities=22%  Similarity=0.405  Sum_probs=14.8

Q ss_pred             CCCCCHHHHHHHHHHHhhc
Q psy8407          72 AGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        72 ~~~~~~~d~~~liayL~sl   90 (92)
                      .++ +++|.++|-+||..+
T Consensus        64 f~l-~~eea~eL~~fl~~~   81 (81)
T PF11256_consen   64 FGL-SEEEAEELREFLYEL   81 (81)
T ss_pred             hCC-CHHHHHHHHHHHhhC
Confidence            456 599999999999764


No 112
>PRK13767 ATP-dependent helicase; Provisional
Probab=30.80  E-value=92  Score=25.40  Aligned_cols=35  Identities=9%  Similarity=0.387  Sum_probs=26.9

Q ss_pred             ccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhh
Q psy8407          46 ITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        46 ~~~~~~~l~~~i~~P~~~~p~~~Mp~~~~~~~~d~~~liayL~s   89 (92)
                      ..|+.+.+.++++.        ..||..+. .++.+.++.||..
T Consensus       440 ~~~~~~~~~~~~~~--------~~~~~~l~-~~~~~~~l~~l~~  474 (876)
T PRK13767        440 RPWDIEEAYNIVRR--------AYPYRDLS-DEDFESVLRYLAG  474 (876)
T ss_pred             CCCCHHHHHHHHhc--------cCCcccCC-HHHHHHHHHHHhc
Confidence            36777777777763        36788776 8999999999964


No 113
>smart00545 JmjN Small domain found in the jumonji family of transcription factors. To date, this domain always co-occurs with the JmjC domain (although the reverse is not true).
Probab=30.75  E-value=33  Score=17.13  Aligned_cols=16  Identities=25%  Similarity=0.368  Sum_probs=13.0

Q ss_pred             CHHHHHHHHHHHhhcc
Q psy8407          76 KPQERGDLIAYLEQAS   91 (92)
Q Consensus        76 ~~~d~~~liayL~sl~   91 (92)
                      +.+|.+|-++||.++.
T Consensus         8 t~eEF~Dp~~yi~~i~   23 (42)
T smart00545        8 TMEEFKDPLAYISKIR   23 (42)
T ss_pred             CHHHHHCHHHHHHHHH
Confidence            4789999999998763


No 114
>COG3183 Predicted restriction endonuclease [Defense mechanisms]
Probab=30.36  E-value=13  Score=26.13  Aligned_cols=8  Identities=38%  Similarity=1.277  Sum_probs=7.2

Q ss_pred             CccCcccc
Q psy8407           3 CAQCHTIE   10 (92)
Q Consensus         3 C~~CH~~~   10 (92)
                      |.+||.+-
T Consensus       244 CpNCH~mv  251 (272)
T COG3183         244 CPNCHKMV  251 (272)
T ss_pred             CccHHHHH
Confidence            99999986


No 115
>PF10180 DUF2373:  Uncharacterised conserved protein (DUF2373);  InterPro: IPR019327  This is a conserved family of proteins found from fungi to humans. The function is not known. 
Probab=30.00  E-value=68  Score=17.51  Aligned_cols=17  Identities=18%  Similarity=0.116  Sum_probs=14.0

Q ss_pred             CCHHHHHHHHHHHhhcc
Q psy8407          75 KKPQERGDLIAYLEQAS   91 (92)
Q Consensus        75 ~~~~d~~~liayL~sl~   91 (92)
                      ++++....+++||..++
T Consensus        34 IP~~~~~~ll~Yl~glk   50 (65)
T PF10180_consen   34 IPSEYFPILLEYLKGLK   50 (65)
T ss_pred             CCHHHHHHHHHHHHhCc
Confidence            34788999999998875


No 116
>PF00432 Prenyltrans:  Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family.;  InterPro: IPR001330 The beta subunit of the farnesyltransferases is responsible for peptide binding. Squalene-hopene cyclase is a bacterial enzyme that catalyzes the cyclization of squalene into hopene, a key step in hopanoid (triterpenoid) metabolism []. Lanosterol synthase (5.4.99.7 from EC) (oxidosqualene-lanosterol cyclase) catalyzes the cyclization of (S)-2,3-epoxysqualene to lanosterol, the initial precursor of cholesterol, steroid hormones and vitamin D in vertebrates and of ergosterol in fungi []. Cycloartenol synthase () (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ....
Probab=29.49  E-value=58  Score=15.81  Aligned_cols=12  Identities=25%  Similarity=0.412  Sum_probs=8.8

Q ss_pred             HHHHHHHHHhhc
Q psy8407          79 ERGDLIAYLEQA   90 (92)
Q Consensus        79 d~~~liayL~sl   90 (92)
                      |++.++.||.+.
T Consensus         2 d~~~~~~~l~~~   13 (44)
T PF00432_consen    2 DVEKLIRFLLSC   13 (44)
T ss_dssp             HHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHH
Confidence            567788888764


No 117
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=28.92  E-value=61  Score=17.31  Aligned_cols=17  Identities=18%  Similarity=0.245  Sum_probs=13.2

Q ss_pred             CCHHHHHHHHHHHhhcc
Q psy8407          75 KKPQERGDLIAYLEQAS   91 (92)
Q Consensus        75 ~~~~d~~~liayL~sl~   91 (92)
                      .++++...+++.|+.+|
T Consensus         4 ~~~~~a~~~~~~LR~~K   20 (58)
T PF06883_consen    4 VSPEEAEQIADQLRYLK   20 (58)
T ss_pred             ecHHHHHHHHHHHHHHH
Confidence            34788888888888765


No 118
>TIGR03146 cyt_nit_nrfB cytochrome c nitrite reductase, pentaheme subunit. Members of this protein family contain five copies of the CXXCH heme-binding motif, and are the NrfB component of the multisubunit enzyme, cytochrome c nitrite reductase.
Probab=28.45  E-value=20  Score=22.52  Aligned_cols=10  Identities=50%  Similarity=1.255  Sum_probs=8.4

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||++-+
T Consensus       111 ~C~~CH~~H~  120 (145)
T TIGR03146       111 TCASCHTLHP  120 (145)
T ss_pred             Chhhhccccc
Confidence            5999999874


No 119
>PF04320 DUF469:  Protein with unknown function (DUF469);  InterPro: IPR007416 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases.
Probab=28.40  E-value=62  Score=19.41  Aligned_cols=19  Identities=21%  Similarity=0.375  Sum_probs=15.2

Q ss_pred             CCCCHHHHHHHHHHHhhcc
Q psy8407          73 GIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        73 ~~~~~~d~~~liayL~sl~   91 (92)
                      +-.+++++.+|.+||+..+
T Consensus        68 gs~tee~R~~v~~WL~~~~   86 (101)
T PF04320_consen   68 GSCTEEDRAAVEAWLKARP   86 (101)
T ss_pred             CCCCHHHHHHHHHHHHhCC
Confidence            3456999999999998643


No 120
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=28.03  E-value=67  Score=21.28  Aligned_cols=20  Identities=30%  Similarity=0.353  Sum_probs=15.8

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy8407          70 IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~s   89 (92)
                      |...+.+++|+.+++.||.+
T Consensus       217 p~~r~~~p~dva~~~~fL~s  236 (259)
T PRK08340        217 PLKRTGRWEELGSLIAFLLS  236 (259)
T ss_pred             CccCCCCHHHHHHHHHHHcC
Confidence            43445569999999999986


No 121
>PF02085 Cytochrom_CIII:  Class III cytochrome C family;  InterPro: IPR020942 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes []. Ambler [] recognised four classes of cytC. Class III comprises the low redox potential multiple haem cytochromes: cyt C7 (trihaem), C3 (tetrahaem), and high-molecular-weight cytC, HMC (hexadecahaem), with only 30-40 residues per haem group. The haem c groups, all bis-histidinyl coordinated, are structurally and functionally nonequivalent and present different redox potentials in the range 0 to -400 mV []. The 3D structures of a number of cyt C3 proteins have been determined. The proteins consist of 4-5 alpha-helices and 2 beta-strands wrapped around a compact core of four non-parallel haems, which present a relatively high degree of exposure to the solvent. The overall protein architecture, haem plane orientations and iron-iron distances are highly conserved [].; GO: 0009055 electron carrier activity, 0020037 heme binding; PDB: 1AQE_A 1CZJ_A 1H29_B 1GWS_A 2CVC_A 2KMY_A 1DUW_A 1UPD_A 1I77_A 1GMB_A ....
Probab=27.78  E-value=35  Score=19.74  Aligned_cols=10  Identities=30%  Similarity=0.909  Sum_probs=7.9

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||....
T Consensus        49 ~C~~CH~~~~   58 (102)
T PF02085_consen   49 SCMSCHDENG   58 (102)
T ss_dssp             SCTCSSSSSS
T ss_pred             hHHHhcCccc
Confidence            5889998773


No 122
>KOG1605|consensus
Probab=27.74  E-value=1.1e+02  Score=21.43  Aligned_cols=35  Identities=23%  Similarity=0.255  Sum_probs=22.2

Q ss_pred             HHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHhhcc
Q psy8407          55 EYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        55 ~~i~~P~~~~p~~~Mp~~~~~~~~d~~~liayL~sl~   91 (92)
                      .|+.+|+..+|=  -+|..-.+|.|+-+|+-||..|.
T Consensus       213 sy~~~p~NgIpI--~sw~~d~~D~eLL~LlpfLe~L~  247 (262)
T KOG1605|consen  213 SYRLQPENGIPI--KSWFDDPTDTELLKLLPFLEALA  247 (262)
T ss_pred             HhccCccCCCcc--cccccCCChHHHHHHHHHHHHhc
Confidence            345566554431  23333334999999999999875


No 123
>PF15573 Imm27:  Immunity protein 27
Probab=27.74  E-value=58  Score=22.60  Aligned_cols=26  Identities=27%  Similarity=0.517  Sum_probs=20.2

Q ss_pred             CCCCC--CCCCCCHHHHHHHHHHHhhcc
Q psy8407          66 GTKMI--FAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        66 ~~~Mp--~~~~~~~~d~~~liayL~sl~   91 (92)
                      |-..|  +..+++.++.++++.|+.+|.
T Consensus       216 GekvP~dy~tiIs~~~~~~~i~YId~Ls  243 (259)
T PF15573_consen  216 GEKVPVDYNTIISRENYKDMISYIDSLS  243 (259)
T ss_pred             CccccccccceechhHHHHHHHHHHHHh
Confidence            33445  556778999999999998875


No 124
>PF08538 DUF1749:  Protein of unknown function (DUF1749);  InterPro: IPR013744 This is a plant and fungal family of unknown function. This family contains many hypothetical proteins. ; PDB: 2Q0X_B.
Probab=27.74  E-value=41  Score=24.12  Aligned_cols=15  Identities=27%  Similarity=0.501  Sum_probs=12.5

Q ss_pred             CHHHHHHHHHHHhhc
Q psy8407          76 KPQERGDLIAYLEQA   90 (92)
Q Consensus        76 ~~~d~~~liayL~sl   90 (92)
                      +.+||+++|.||++.
T Consensus        86 D~~eI~~~v~ylr~~  100 (303)
T PF08538_consen   86 DVEEIAQLVEYLRSE  100 (303)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHh
Confidence            367888999999987


No 125
>PF14410 GH-E:  HNH/ENDO VII superfamily nuclease with conserved GHE residues
Probab=27.73  E-value=58  Score=18.02  Aligned_cols=21  Identities=10%  Similarity=0.339  Sum_probs=17.7

Q ss_pred             CccccHHHHHHHHhCCCCCCC
Q psy8407          45 GITWNKDTLFEYLENPKKYIP   65 (92)
Q Consensus        45 ~~~~~~~~l~~~i~~P~~~~p   65 (92)
                      ...|+..++..|+.+|..+.+
T Consensus        38 ~~~~t~ke~~d~~n~p~nyrl   58 (70)
T PF14410_consen   38 EGGITRKEFLDWYNDPDNYRL   58 (70)
T ss_pred             hcCCCHHHHHHHHhCccceee
Confidence            466899999999999987754


No 126
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]
Probab=27.68  E-value=1.6e+02  Score=21.08  Aligned_cols=44  Identities=16%  Similarity=0.279  Sum_probs=32.0

Q ss_pred             cHHHHHHHHhCCCCC------CCCCCCCCC-----CCCCHHHHHHHHHHHhhccC
Q psy8407          49 NKDTLFEYLENPKKY------IPGTKMIFA-----GIKKPQERGDLIAYLEQASK   92 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~------~p~~~Mp~~-----~~~~~~d~~~liayL~sl~~   92 (92)
                      +-..|.+....|+.+      .|...||..     ..++++-++.+++|++++.|
T Consensus       122 ~it~ia~~~~rper~iG~HFfNP~~~m~LVEvI~g~~T~~e~~~~~~~~~~~igK  176 (307)
T COG1250         122 SITELAEALKRPERFIGLHFFNPVPLMPLVEVIRGEKTSDETVERVVEFAKKIGK  176 (307)
T ss_pred             CHHHHHHHhCCchhEEEEeccCCCCcceeEEEecCCCCCHHHHHHHHHHHHHcCC
Confidence            455677777888774      366678842     35679999999999998653


No 127
>PF09383 NIL:  NIL domain;  InterPro: IPR018449 This domain is found at the C terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins. This domain is likely to act as a substrate binding domain. The domain has been named after a conserved sequence in some members of the family. ; PDB: 2QRR_A 3CED_A 2QSW_A 3TUZ_D 3TUJ_D 3DHX_B 3TUI_H 3DHW_D.
Probab=26.95  E-value=68  Score=17.39  Aligned_cols=15  Identities=33%  Similarity=0.474  Sum_probs=12.1

Q ss_pred             CHHHHHHHHHHHhhc
Q psy8407          76 KPQERGDLIAYLEQA   90 (92)
Q Consensus        76 ~~~d~~~liayL~sl   90 (92)
                      ++++++..++||++.
T Consensus        55 ~~~~~~~a~~~L~~~   69 (76)
T PF09383_consen   55 DDEEIEKAIAYLREQ   69 (76)
T ss_dssp             -HHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHC
Confidence            478899999999864


No 128
>PRK11659 cytochrome c nitrite reductase pentaheme subunit; Provisional
Probab=26.51  E-value=21  Score=23.50  Aligned_cols=10  Identities=40%  Similarity=1.222  Sum_probs=8.7

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||.+-+
T Consensus       134 ~C~~CH~~H~  143 (183)
T PRK11659        134 TCASCHSLHP  143 (183)
T ss_pred             chhhhhhccc
Confidence            5999999885


No 129
>PF14566 PTPlike_phytase:  Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B ....
Probab=26.29  E-value=63  Score=20.24  Aligned_cols=16  Identities=13%  Similarity=0.482  Sum_probs=13.3

Q ss_pred             CHHHHHHHHHHHhhcc
Q psy8407          76 KPQERGDLIAYLEQAS   91 (92)
Q Consensus        76 ~~~d~~~liayL~sl~   91 (92)
                      +++++++++++++++.
T Consensus       107 ~~~~iD~fi~~v~~~p  122 (149)
T PF14566_consen  107 DPEDIDAFINFVKSLP  122 (149)
T ss_dssp             -HHHHHHHHHHHHTS-
T ss_pred             CHHHHHHHHHHHHhCC
Confidence            5999999999999874


No 130
>PF13561 adh_short_C2:  Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B ....
Probab=26.11  E-value=40  Score=22.18  Aligned_cols=20  Identities=15%  Similarity=0.406  Sum_probs=15.6

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy8407          70 IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~s   89 (92)
                      |...+.+++|+.+.+.||.|
T Consensus       204 pl~r~~~~~evA~~v~fL~s  223 (241)
T PF13561_consen  204 PLGRLGTPEEVANAVLFLAS  223 (241)
T ss_dssp             TTSSHBEHHHHHHHHHHHHS
T ss_pred             ccCCCcCHHHHHHHHHHHhC
Confidence            44444569999999999986


No 131
>PF13099 DUF3944:  Domain of unknown function (DUF3944)
Probab=25.95  E-value=78  Score=15.27  Aligned_cols=14  Identities=21%  Similarity=0.292  Sum_probs=11.6

Q ss_pred             CCHHHHHHHHHHHh
Q psy8407          75 KKPQERGDLIAYLE   88 (92)
Q Consensus        75 ~~~~d~~~liayL~   88 (92)
                      .+.+|+++|+..|.
T Consensus        13 cs~edL~~L~~~Lt   26 (35)
T PF13099_consen   13 CSNEDLKDLVDILT   26 (35)
T ss_pred             CCHHHHHHHHHHHh
Confidence            46899999999885


No 132
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional
Probab=25.76  E-value=82  Score=21.08  Aligned_cols=20  Identities=15%  Similarity=0.177  Sum_probs=15.6

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy8407          70 IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~s   89 (92)
                      |...+.+++|+.+.+.||.+
T Consensus       216 p~~r~~~pedva~~~~~L~s  235 (260)
T PRK06603        216 PLKRNTTQEDVGGAAVYLFS  235 (260)
T ss_pred             CcCCCCCHHHHHHHHHHHhC
Confidence            44444569999999999986


No 133
>cd08168 Cytochrom_C3 Heme-binding domain of the class III cytochrome C family and related proteins. This alignment models heme binding core motifs as encountered in the cytochrome C3 family and related proteins. Cytochrome C3 is a tetraheme protein found in sulfate-reducing bacteria which use either thiosulfate or sulfate as the ultimate electron acceptors. C3 is an integral part of a complex electron transfer chain. The model also contains triheme cytochromes C7 which function in electron transfer during Fe(III) respiration by Geobacter sulfurreducens (PpcA, PpcB, PpcC, PpcD, and PpcE) and four repeated core motifs as found in the 16-heme cytochrome C HmcA of Desulfovibrio vulgaris Hildenborough which plays a role in electron transfer through the membrane following periplasmic oxidation of hydrogen (resulting in sulfate reduction in the cytoplasm).
Probab=25.52  E-value=32  Score=19.24  Aligned_cols=9  Identities=56%  Similarity=1.416  Sum_probs=6.2

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|..||...
T Consensus        35 ~C~~CH~~~   43 (85)
T cd08168          35 KCAECHSHD   43 (85)
T ss_pred             chhhcCCCC
Confidence            577777665


No 134
>COG5469 Predicted metal-binding protein [Function unknown]
Probab=25.23  E-value=48  Score=21.11  Aligned_cols=20  Identities=20%  Similarity=0.564  Sum_probs=13.8

Q ss_pred             CCccCccccCCCCCCCCCCcc
Q psy8407           2 KCAQCHTIEAGGAHKVGPNLH   22 (92)
Q Consensus         2 ~C~~CH~~~~~~~~~~GP~L~   22 (92)
                      -|.+||.+... ....||..-
T Consensus        22 VCksC~~~~~~-~~~~~p~~G   41 (143)
T COG5469          22 VCKSCRDVSQE-GKENGPSDG   41 (143)
T ss_pred             EeccccccccC-CccCCCCcH
Confidence            39999998853 345777644


No 135
>PF11427 HTH_Tnp_Tc3_1:  Tc3 transposase; PDB: 1U78_A 1TC3_C.
Probab=25.13  E-value=74  Score=16.50  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=12.9

Q ss_pred             ccccHHHHHHHHhCCCCC
Q psy8407          46 ITWNKDTLFEYLENPKKY   63 (92)
Q Consensus        46 ~~~~~~~l~~~i~~P~~~   63 (92)
                      +..+..-+..||+||..+
T Consensus        30 i~RSr~~Ir~yl~dP~~y   47 (50)
T PF11427_consen   30 IGRSRTCIRRYLKDPVNY   47 (50)
T ss_dssp             HT--HHHHHHHHHSCCCT
T ss_pred             hCccHHHHHHHhcChhhc
Confidence            456788899999999754


No 136
>PF11165 DUF2949:  Protein of unknown function (DUF2949);  InterPro: IPR021336  This family of proteins with unknown function appear to be restricted to Cyanobacteria. 
Probab=24.26  E-value=1.3e+02  Score=16.16  Aligned_cols=40  Identities=15%  Similarity=0.190  Sum_probs=25.8

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCC--CCCCCCHHHHHHHHHHHh
Q psy8407          49 NKDTLFEYLENPKKYIPGTKMI--FAGIKKPQERGDLIAYLE   88 (92)
Q Consensus        49 ~~~~l~~~i~~P~~~~p~~~Mp--~~~~~~~~d~~~liayL~   88 (92)
                      +++.|.-.++..+.....-+|=  ..|+++=++++.|.+||.
T Consensus        16 s~~~i~lalr~~~~~~~pLPmiLWqyGLItL~QL~~i~DWl~   57 (58)
T PF11165_consen   16 SEASIALALRQQEQDQGPLPMILWQYGLITLEQLDQIFDWLE   57 (58)
T ss_pred             CHHHHHHHHHhHhccCCCcchHHHHhccccHHHHHHHHHHHh
Confidence            5666776676544321111232  457888999999999985


No 137
>PRK02955 small acid-soluble spore protein SspI; Provisional
Probab=23.92  E-value=1.3e+02  Score=16.69  Aligned_cols=42  Identities=21%  Similarity=0.325  Sum_probs=26.0

Q ss_pred             ccHHHHHHHHhCCC-----CCCCCCCCC---CCCCCCHHHHHHHHHHHhh
Q psy8407          48 WNKDTLFEYLENPK-----KYIPGTKMI---FAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        48 ~~~~~l~~~i~~P~-----~~~p~~~Mp---~~~~~~~~d~~~liayL~s   89 (92)
                      .++++|..+|.|.-     ...||---=   ++.-.+++|...++..|..
T Consensus        16 ~s~eel~~~I~daIqsgEEk~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   65 (68)
T PRK02955         16 NSKEELEGTIVDAIQSGEEKMLPGLGVLFEVIWKNADENEKDEMLETLEQ   65 (68)
T ss_pred             CCHHHHHHHHHHHHhccchhcCCcchhHHHHHHHhcCHHHHHHHHHHHHH
Confidence            47788888777532     334541111   2333468999999998865


No 138
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=23.78  E-value=47  Score=16.87  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=9.2

Q ss_pred             CCCHHHHHHHHHH
Q psy8407          74 IKKPQERGDLIAY   86 (92)
Q Consensus        74 ~~~~~d~~~liay   86 (92)
                      +++++|+.+|..|
T Consensus         2 fLT~~El~elTG~   14 (47)
T PF13986_consen    2 FLTDEELQELTGY   14 (47)
T ss_pred             CCCHHHHHHHHCC
Confidence            3568888887655


No 139
>CHL00136 rpl31 ribosomal protein L31; Validated
Probab=23.78  E-value=35  Score=18.92  Aligned_cols=10  Identities=10%  Similarity=0.009  Sum_probs=7.7

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      -|..||-.-.
T Consensus        37 v~s~~HPfyT   46 (68)
T CHL00136         37 IWSGNHPFYT   46 (68)
T ss_pred             eCCCCCccCc
Confidence            3899998764


No 140
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=23.70  E-value=82  Score=18.31  Aligned_cols=16  Identities=13%  Similarity=0.399  Sum_probs=12.9

Q ss_pred             CCCHHHHHHHHHHHhh
Q psy8407          74 IKKPQERGDLIAYLEQ   89 (92)
Q Consensus        74 ~~~~~d~~~liayL~s   89 (92)
                      +-||+|+++++.|--+
T Consensus        56 VRSDeEm~AMlsyy~~   71 (91)
T cd06395          56 VRSDEEMKAMLSYYCS   71 (91)
T ss_pred             ecchHHHHHHHHHHHH
Confidence            4579999999998654


No 141
>PF09256 BaffR-Tall_bind:  BAFF-R, TALL-1 binding;  InterPro: IPR015336 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  The domain represented by this entry is predominantly found in the tumour necrosis factor receptor superfamily member 13c, BAFF-R and is required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 1P0T_c 2HFG_R 1OSX_A 1OQE_N.
Probab=23.40  E-value=17  Score=17.04  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=7.4

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      ++|.+|+-+.
T Consensus        15 R~CV~C~Ll~   24 (31)
T PF09256_consen   15 RHCVACELLR   24 (31)
T ss_dssp             TEEEEGGGSS
T ss_pred             hcceeeeeec
Confidence            5788897665


No 142
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=23.30  E-value=25  Score=20.00  Aligned_cols=16  Identities=44%  Similarity=0.847  Sum_probs=11.8

Q ss_pred             CCCCCCHHHHHHHHHHH
Q psy8407          71 FAGIKKPQERGDLIAYL   87 (92)
Q Consensus        71 ~~~~~~~~d~~~liayL   87 (92)
                      |..| +++|+.+||.|=
T Consensus        29 f~~L-t~eEr~dmI~~~   44 (76)
T PF10955_consen   29 FHHL-TPEERQDMISYD   44 (76)
T ss_pred             cccC-CHHHHhhheEEc
Confidence            4444 599999998873


No 143
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=23.21  E-value=88  Score=21.86  Aligned_cols=21  Identities=24%  Similarity=0.461  Sum_probs=17.2

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcc
Q psy8407          70 IFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~sl~   91 (92)
                      |..|+. ++|.++|++.|+.++
T Consensus       176 PaAGln-~~e~~~l~~~i~~i~  196 (250)
T COG0411         176 PAAGLN-PEETEELAELIRELR  196 (250)
T ss_pred             ccCCCC-HHHHHHHHHHHHHHH
Confidence            456776 899999999998875


No 144
>PF14098 SSPI:  Small, acid-soluble spore protein I
Probab=23.10  E-value=98  Score=17.08  Aligned_cols=41  Identities=24%  Similarity=0.441  Sum_probs=25.1

Q ss_pred             cHHHHHHHHhCC-----CCCCCCCCCC---CCCCCCHHHHHHHHHHHhh
Q psy8407          49 NKDTLFEYLENP-----KKYIPGTKMI---FAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        49 ~~~~l~~~i~~P-----~~~~p~~~Mp---~~~~~~~~d~~~liayL~s   89 (92)
                      +.++|..+|.+.     ....||---=   ++.-+++++...++.+|..
T Consensus        15 s~~el~~~I~daI~sgEE~~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   63 (65)
T PF14098_consen   15 SKEELKDTIEDAIQSGEEKALPGLGVLFEVIWKNSDESEKQEMVNTLEQ   63 (65)
T ss_pred             CHHHHHHHHHHHHhccchhcCCchHHHHHHHHHhCCHHHHHHHHHHHHh
Confidence            677787777753     2334541100   2233469999999998864


No 145
>TIGR03092 SASP_sspI small, acid-soluble spore protein I. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. It is a minor SASP (small, acid-soluble spore protein) designated SspI. The gene in Bacillus subtilis previously was designated ysfA.
Probab=23.05  E-value=88  Score=17.27  Aligned_cols=42  Identities=24%  Similarity=0.323  Sum_probs=25.8

Q ss_pred             ccHHHHHHHHhCCC-----CCCCCCC--C-CCCCCCCHHHHHHHHHHHhh
Q psy8407          48 WNKDTLFEYLENPK-----KYIPGTK--M-IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        48 ~~~~~l~~~i~~P~-----~~~p~~~--M-p~~~~~~~~d~~~liayL~s   89 (92)
                      .+.++|..+|.|.-     ...||--  + -++.-++++|-+.++..|..
T Consensus        13 ~s~~elk~~I~daI~sgEEk~LPGLGVlFE~~W~~~~~~ek~~m~~~l~~   62 (65)
T TIGR03092        13 NTKEQLEATIVDAIQSGEEKMLPGLGVLFEAIWKHANEQEKDEMLETLEQ   62 (65)
T ss_pred             CCHHHHHHHHHHHHhccchhcCCccHHHHHHHHHhcCHHHHHHHHHHHHH
Confidence            46788888887632     2344411  1 02333468999999998865


No 146
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=22.96  E-value=35  Score=17.97  Aligned_cols=10  Identities=20%  Similarity=0.727  Sum_probs=8.4

Q ss_pred             CccCccccCC
Q psy8407           3 CAQCHTIEAG   12 (92)
Q Consensus         3 C~~CH~~~~~   12 (92)
                      |..||+.+|.
T Consensus        25 C~~C~~hNGl   34 (54)
T PF10058_consen   25 CSKCFSHNGL   34 (54)
T ss_pred             Ccccchhhcc
Confidence            8999999863


No 147
>PRK05867 short chain dehydrogenase; Provisional
Probab=22.85  E-value=96  Score=20.40  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=14.9

Q ss_pred             CCCCCHHHHHHHHHHHhh
Q psy8407          72 AGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        72 ~~~~~~~d~~~liayL~s   89 (92)
                      ..+.+++|+.+.+.||.+
T Consensus       216 ~r~~~p~~va~~~~~L~s  233 (253)
T PRK05867        216 GRLGRPEELAGLYLYLAS  233 (253)
T ss_pred             CCCcCHHHHHHHHHHHcC
Confidence            345679999999999976


No 148
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=22.85  E-value=1e+02  Score=15.80  Aligned_cols=13  Identities=31%  Similarity=0.583  Sum_probs=10.9

Q ss_pred             CCHHHHHHHHHHH
Q psy8407          75 KKPQERGDLIAYL   87 (92)
Q Consensus        75 ~~~~d~~~liayL   87 (92)
                      .+++|+++|+..|
T Consensus         5 ~~~e~ld~L~~aL   17 (46)
T PF15614_consen    5 DDPEELDELLKAL   17 (46)
T ss_pred             cCHHHHHHHHHHH
Confidence            4589999999888


No 149
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=22.84  E-value=36  Score=16.47  Aligned_cols=7  Identities=43%  Similarity=1.189  Sum_probs=3.8

Q ss_pred             CccCccc
Q psy8407           3 CAQCHTI    9 (92)
Q Consensus         3 C~~CH~~    9 (92)
                      |.+||++
T Consensus        22 C~~C~G~   28 (41)
T PF13453_consen   22 CPSCGGI   28 (41)
T ss_pred             CCCCCeE
Confidence            5555554


No 150
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed
Probab=22.47  E-value=38  Score=18.98  Aligned_cols=9  Identities=33%  Similarity=1.132  Sum_probs=7.3

Q ss_pred             CccCccccC
Q psy8407           3 CAQCHTIEA   11 (92)
Q Consensus         3 C~~CH~~~~   11 (92)
                      |..||-.-.
T Consensus        38 ~s~~HPFyT   46 (72)
T PRK00019         38 CSKCHPFYT   46 (72)
T ss_pred             CCCCCCcCc
Confidence            899998764


No 151
>PF09626 DHC:  Dihaem cytochrome c;  InterPro: IPR018588  Dihaem cytochrome c (DHC) is a soluble c-type cytochrome that folds into two distinct domains, each binding a single haem group and connected by a small linker region. Despite little sequence similarity, the N-terminal domain (residues 12-75) is a class I type cytochrome c, that binds one of the haems, but the domain surrounding the other haem is structurally unique. DHC binds electrostatically to an oxygen-binding protein, sphaeroides haem protein (SHP), as a component of a conserved electron transfer pathway. DHC acts as the physiological electron donor for SHP during phototrophic growth []. In certain species DHC is found upstream of IPR011577 from INTERPRO. ; PDB: 2FWT_A 2FW5_A.
Probab=22.25  E-value=99  Score=19.03  Aligned_cols=16  Identities=25%  Similarity=0.559  Sum_probs=12.6

Q ss_pred             CCHHHHHHHHHHHhhc
Q psy8407          75 KKPQERGDLIAYLEQA   90 (92)
Q Consensus        75 ~~~~d~~~liayL~sl   90 (92)
                      +++++...|.+||.+-
T Consensus        39 Ld~~~~~~I~~YL~~n   54 (120)
T PF09626_consen   39 LDPATQAEIWAYLQAN   54 (120)
T ss_dssp             --HHHHHHHHHHHHHT
T ss_pred             CCHHHHHHHHHHHHHc
Confidence            4599999999999864


No 152
>KOG2112|consensus
Probab=21.98  E-value=90  Score=21.17  Aligned_cols=26  Identities=27%  Similarity=0.372  Sum_probs=19.8

Q ss_pred             CCCCCCCC---CCCHHHHHHHHHHHhhcc
Q psy8407          66 GTKMIFAG---IKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        66 ~~~Mp~~~---~~~~~d~~~liayL~sl~   91 (92)
                      .+.|||.+   -+..+|+++|..||.++.
T Consensus       177 ~~f~~y~g~~h~~~~~e~~~~~~~~~~l~  205 (206)
T KOG2112|consen  177 VTFKPYPGLGHSTSPQELDDLKSWIKTLE  205 (206)
T ss_pred             eeeeecCCccccccHHHHHHHHHHHHHhc
Confidence            45677765   346999999999998853


No 153
>PF14982 UPF0731:  UPF0731 family
Probab=21.59  E-value=41  Score=18.88  Aligned_cols=10  Identities=20%  Similarity=0.670  Sum_probs=7.7

Q ss_pred             CCCccCcccc
Q psy8407           1 MKCAQCHTIE   10 (92)
Q Consensus         1 ~~C~~CH~~~   10 (92)
                      +.|-+||-+.
T Consensus        44 rRCpgsHCLT   53 (79)
T PF14982_consen   44 RRCPGSHCLT   53 (79)
T ss_pred             ccCCCcceeE
Confidence            4699999765


No 154
>PF02335 Cytochrom_C552:  Cytochrome c552;  InterPro: IPR003321 The enzyme cytochrome c nitrite reductase (c552) catalyses the six-electron reduction of nitrite to ammonia as one of the key steps in the biological nitrogen cycle, where it participates in the anaerobic energy metabolism of dissimilatory nitrate ammonification. Cytochrome c nitrite reductase from Sulfurospirillum deleyianum is a functional dimer, with 10 close-packed haem groups of type c and an unusual lysine-coordinated high-spin haem at the active site [].; GO: 0006807 nitrogen compound metabolic process, 0055114 oxidation-reduction process; PDB: 1QDB_B 3TTB_B 3BNJ_A 3BNG_A 1FS8_A 2E80_A 3BNH_A 1FS7_A 2E81_A 3BNF_A ....
Probab=21.50  E-value=33  Score=25.80  Aligned_cols=7  Identities=43%  Similarity=1.445  Sum_probs=6.3

Q ss_pred             CCccCcc
Q psy8407           2 KCAQCHT    8 (92)
Q Consensus         2 ~C~~CH~    8 (92)
                      .|..||+
T Consensus       274 sC~~CH~  280 (434)
T PF02335_consen  274 SCQTCHS  280 (434)
T ss_dssp             CTTTTST
T ss_pred             HHhhhcC
Confidence            5999998


No 155
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family. In a subset of endospore-forming members of the Firmcutes, members of this protein family are found, several to a genome. Two very strongly conserved sequences regions are separated by a highly variable linker region. Much of the linker region was excised from the seed alignment for this model. A characterized member is the prespore-specific transcription RsfA from Bacillus subtilis, previously called YwfN, which is controlled by sigma factor F and seems to fine-tune expression of some genes in the sigma-F regulon. A paralog in Bacillus subtilis is designated YlbO.
Probab=21.37  E-value=62  Score=21.10  Aligned_cols=12  Identities=25%  Similarity=0.523  Sum_probs=10.7

Q ss_pred             HHHHHHHHhhcc
Q psy8407          80 RGDLIAYLEQAS   91 (92)
Q Consensus        80 ~~~liayL~sl~   91 (92)
                      +++||+||.+++
T Consensus        82 l~~vI~fLq~l~   93 (161)
T TIGR02894        82 LQDVISFLQNLK   93 (161)
T ss_pred             HHHHHHHHHHHH
Confidence            999999999875


No 156
>PF07102 DUF1364:  Protein of unknown function (DUF1364);  InterPro: IPR010774 This entry is represented by Bacteriophage 82, YbcO. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.; PDB: 3G27_A.
Probab=21.36  E-value=15  Score=21.72  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=6.7

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|.+||..-.
T Consensus        53 aCs~CHd~iD   62 (94)
T PF07102_consen   53 ACSACHDEID   62 (94)
T ss_dssp             E-HHHHHHHT
T ss_pred             hHHHHHHHHh
Confidence            4999997654


No 157
>TIGR03152 cyto_c552_HCOOH formate-dependent cytochrome c nitrite reductase, c552 subunit. Members of this protein family are cytochrome c552, a component of cytochrome c nitrite reductase, which is known more formally as nitrite reductase (cytochrome; ammonia-forming) (EC 1.7.2.2). Nitrate can be reduced by several enzymes. EC 1.7.2.2 reduces nitrite all the way to ammonia, rather than to ammonium hydroxide (nitrite reductase (NAD(P)H), EC 1.7.1.4) or nitric oxide (nitrite reductase (NO-forming), EC 1.7.2.1). Some examples of EC 1.7.2.2 occur in a seven gene system that enables formate-dependent nitrite reduction, but is also found in simpler contexts. Members of this protein family, however, belong to the formate-dependent system.
Probab=20.99  E-value=48  Score=25.01  Aligned_cols=10  Identities=40%  Similarity=1.052  Sum_probs=8.2

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|+.||....
T Consensus       122 gCadCHd~es  131 (439)
T TIGR03152       122 GCADCHDTTS  131 (439)
T ss_pred             ChhhcCCCcc
Confidence            6999998774


No 158
>PRK02289 4-oxalocrotonate tautomerase; Provisional
Probab=20.80  E-value=1.3e+02  Score=15.61  Aligned_cols=14  Identities=14%  Similarity=0.287  Sum_probs=10.1

Q ss_pred             CCCCHHHHHHHHHHH
Q psy8407          73 GIKKPQERGDLIAYL   87 (92)
Q Consensus        73 ~~~~~~d~~~liayL   87 (92)
                      +. ++++.++|++=|
T Consensus        11 Gr-s~EqK~~L~~~i   24 (60)
T PRK02289         11 GR-SQEQKNALAREV   24 (60)
T ss_pred             CC-CHHHHHHHHHHH
Confidence            44 589988887654


No 159
>PF05927 Penaeidin:  Penaeidin;  InterPro: IPR009226 This family consists of several isoforms of the penaeidin protein, which is specific to shrimps. Penaeidins, a unique family of antimicrobial peptides (AMPs) with both proline and cysteine-rich domains, were initially identified in the hemolymph of the Pacific white shrimp, Penaeus vannamei [].; GO: 0008061 chitin binding, 0005737 cytoplasm; PDB: 1UEO_A 1XV3_A.
Probab=20.64  E-value=49  Score=18.49  Aligned_cols=9  Identities=33%  Similarity=0.851  Sum_probs=6.6

Q ss_pred             CCccCcccc
Q psy8407           2 KCAQCHTIE   10 (92)
Q Consensus         2 ~C~~CH~~~   10 (92)
                      .|.+||.+.
T Consensus        45 ~C~sC~~i~   53 (73)
T PF05927_consen   45 VCNSCYRIS   53 (73)
T ss_dssp             STTTTTTS-
T ss_pred             ccccccccC
Confidence            588999876


No 160
>KOG3309|consensus
Probab=20.63  E-value=32  Score=22.34  Aligned_cols=10  Identities=40%  Similarity=1.049  Sum_probs=7.8

Q ss_pred             CCccCccccC
Q psy8407           2 KCAQCHTIEA   11 (92)
Q Consensus         2 ~C~~CH~~~~   11 (92)
                      .|..||.+=.
T Consensus        86 ACSTCHViv~   95 (159)
T KOG3309|consen   86 ACSTCHVIVD   95 (159)
T ss_pred             cccceEEEEc
Confidence            4999998753


No 161
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=20.51  E-value=1.1e+02  Score=20.47  Aligned_cols=21  Identities=19%  Similarity=0.200  Sum_probs=15.9

Q ss_pred             CCCCCCCHHHHHHHHHHHhhc
Q psy8407          70 IFAGIKKPQERGDLIAYLEQA   90 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~sl   90 (92)
                      |...+.+++|+.+.+.||.+-
T Consensus       215 p~~r~~~pedva~~~~~l~s~  235 (260)
T PRK06997        215 PLRRNVTIEEVGNVAAFLLSD  235 (260)
T ss_pred             cccccCCHHHHHHHHHHHhCc
Confidence            444455699999999999763


No 162
>PRK11702 hypothetical protein; Provisional
Probab=20.45  E-value=1.3e+02  Score=18.34  Aligned_cols=17  Identities=24%  Similarity=0.288  Sum_probs=14.3

Q ss_pred             CCCCHHHHHHHHHHHhh
Q psy8407          73 GIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        73 ~~~~~~d~~~liayL~s   89 (92)
                      +-.+++++..|.+||+.
T Consensus        75 gs~tEe~R~~V~~WL~~   91 (108)
T PRK11702         75 GKCTEEHRALVKKWLEG   91 (108)
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            44569999999999985


No 163
>PF01645 Glu_synthase:  Conserved region in glutamate synthase;  InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots []. This region is expressed as a seperate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. The aligned region of these proteins contains a putative FMN binding site and Fe-S cluster.; GO: 0015930 glutamate synthase activity, 0016638 oxidoreductase activity, acting on the CH-NH2 group of donors, 0006537 glutamate biosynthetic process, 0055114 oxidation-reduction process; PDB: 1EA0_A 2VDC_E 1OFE_A 1LLW_A 1OFD_A 1LLZ_A 1LM1_A.
Probab=20.27  E-value=1.7e+02  Score=21.61  Aligned_cols=22  Identities=18%  Similarity=0.164  Sum_probs=16.8

Q ss_pred             CCCCCCCHHHHHHHHHHHhhcc
Q psy8407          70 IFAGIKKPQERGDLIAYLEQAS   91 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~sl~   91 (92)
                      |+.++.+.+|+.++|..|+++.
T Consensus       180 ~h~di~s~edl~~~I~~Lr~~~  201 (368)
T PF01645_consen  180 PHHDIYSIEDLAQLIEELRELN  201 (368)
T ss_dssp             S-TT-SSHHHHHHHHHHHHHH-
T ss_pred             CCCCcCCHHHHHHHHHHHHhhC
Confidence            4667888999999999999875


No 164
>PF07845 DUF1636:  Protein of unknown function (DUF1636);  InterPro: IPR012863 The sequences featured in this family are derived from a number of hypothetical prokaryotic proteins. The region in question is approximately 130 amino acids long. 
Probab=20.16  E-value=52  Score=20.11  Aligned_cols=19  Identities=16%  Similarity=0.485  Sum_probs=14.4

Q ss_pred             CCCCCCHHHHHHHHHHHhh
Q psy8407          71 FAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        71 ~~~~~~~~d~~~liayL~s   89 (92)
                      |..+..++++++|++|.+.
T Consensus        70 fGdl~p~~~a~~il~~a~~   88 (116)
T PF07845_consen   70 FGDLDPDEDAEDILAFAAL   88 (116)
T ss_pred             EecCCcccCHHHHHHHHHH
Confidence            4456655999999999864


No 165
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=20.12  E-value=1.3e+02  Score=19.96  Aligned_cols=20  Identities=10%  Similarity=0.129  Sum_probs=15.4

Q ss_pred             CCCCCCCHHHHHHHHHHHhh
Q psy8407          70 IFAGIKKPQERGDLIAYLEQ   89 (92)
Q Consensus        70 p~~~~~~~~d~~~liayL~s   89 (92)
                      |...+.+++|+.+.+.||.+
T Consensus       212 p~~~~~~peeva~~~~~L~s  231 (251)
T PRK12481        212 PASRWGTPDDLAGPAIFLSS  231 (251)
T ss_pred             CCCCCcCHHHHHHHHHHHhC
Confidence            33345569999999999976


No 166
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=20.07  E-value=96  Score=17.12  Aligned_cols=38  Identities=11%  Similarity=0.124  Sum_probs=23.2

Q ss_pred             HHHHHHHhCCCCCC----CCCCCCCCCCCCHHHHHHHHHHHh
Q psy8407          51 DTLFEYLENPKKYI----PGTKMIFAGIKKPQERGDLIAYLE   88 (92)
Q Consensus        51 ~~l~~~i~~P~~~~----p~~~Mp~~~~~~~~d~~~liayL~   88 (92)
                      ..|.+||+.-....    ...--+.....++.|++-|+.||-
T Consensus        26 r~L~rwI~~~~~L~~~L~~~Gy~~~~r~~TP~QV~lIv~~LG   67 (69)
T PF14053_consen   26 RKLRRWIRRNPELLEELEATGYHPRQRSFTPRQVRLIVRYLG   67 (69)
T ss_pred             HHHHHHHHHCHHHHHHHHHcCCCCCCEecCHHHHHHHHHHcC
Confidence            46788887422211    111224445567999999999984


Done!