Diaphorina citri psyllid: psy8410


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-
GIRVFECFRELFTLFPVNLRHIHEVLLVFKVLKMILNQNTLSAPSLKNLTDKNFGKPPDKQNEFLLTLGAPHIASFDFMLDEGLDLAVEDIAPIEFEIYGKTLKLNIVKAAISEPKVPAGPVGIHFNKYYPTEARQTRSVYSGPFNVTVAWSWDGKAGGTFTKEVGRVPIMLKSKRCHLRNLTPAQLIERGEHPDEWGGYFIVGGHEKLVRLLINNRRNHPIAIKRNAWKNRGLLFSDLGVYIRSVKRDESATNNVLHFVTNGSARFMFSHRKSMCLLGMMQSLHEEGIHTQHDSKVFFGQIFKEKLQYDLRHLNEVEICDYMLTNCILPHLDDYWDKFLCLSHMTCKLFHVVQGMVQLDSEDSIMLQEIMTGGSLYLQLLKKEKSGTSAVLKESDIYAAFRASSIESAMTNFLATGNVSAGKNSTLQLMQASGFVIMAENINRMRYMSHFRAVHRGSYFQEMRSSEPRQLRTDAWGFICPVHTPDGTPCGLLNHLTTNCQISEYIPSKVLAQIPSVLVSLGMLPLTPVIQSIPEQALMVMLDGRIVGYILDQIATSLVPKLRMLKIVGEKIPKSLEIVYLKRPEKGMGLYPGLYLFTGPGRMLRPVMNLAAGNIEWIGTFEQVFMDICITMKEAYPGITTHRELSKTDFLSNLANLIPMPDCNQSPRNMYQCQMGKQTMGTPCLNWRYQGVGKLYRLQTPASPFFRPVHYDTLDMDNFPMGTNAIVAVISYTGYDMEDAMILNKSSYERGFAHGCIFKSMFIELESGYNYYGTETMYSGVDGSMMQAQIFFGVVHYQRLRHMVSDKWQTKDYFGRDPANKALEDKLGPDGLVYVGAKLNERDPMYSYWKESENRYVTCRYSGKEEMCVEVVRMSSGFTEGGSVTPNCAYIGYRIQRNPTVGDKFASRAGQKGICSVKWPAEDLPFTDSGLVPDIVFNPHGFPSRMTIGFL
cccEEHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEEEEEEcccccccccccccccccccHHHHccccccccCEEEEEEEEEcccccEEEEEEECcccEEEcccccccccccHHHHHHccccccccccEEEEccccEEEHHHHcccccccEEEEEcccccccEEEEEEEEEEEEEEccccccEEEEEEEEEccEEEEEEEcHHHHHHHcHHHHHHcccccHHHHHHHHccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHccEEEEEccccHHHHHHHHHccccccccccccccccccccccccccEECccccccccccHHHHHHccEEECccccccccccHHHHHHHcccccccccccccccccEEEEEccEEEEEEccccHHHHHHHHHHcHHcccccccEEEEEECcccccccccccEEEECcccccccccEEEcccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEcccccccccccEEEEEEEEEEEEEccccccccCEECccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccCEcccccEEEEcccccccCEEEECcccccEEEEEEEEcccccccccccccEEEEEEcccccccccccccccccccccEEccccccccccccccccccEEEcccccccccccccc
GIRVFECFRELFTLFPVNLRHIHEVLLVFKVLKMILNQNTL*************GKPPDKQNEFLLTLGAPHIASFDFMLDEGLDLAVEDIAPIEFEIYGKTLKLNIVKAAISEPKVPAGPVGIHFNKYYPTEARQTRSVYSGPFNVTVAWSWDGKAGGTFTKEVGRVPIMLKSKRCHLRNLTPAQLIERGEHPDEWGGYFIVGGHEKLVRLLINNRRNHPIAIKRNAWKNRGLLFSDLGVYIRSVKRDESATNNVLHFVTNGSARFMFSHRKSMCLLGMMQSLHEEGIHTQHDSKVFFGQIFKEKLQYDLRHLNEVEICDYMLTNCILPHLDDYWDKFLCLSHMTCKLFHVVQGMVQLDSEDSIMLQEIMTGGSLYLQLLKKEKSGTSAVLKESDIYAAFRASSIESAMTNFLATGNVSAGKNSTLQLMQASGFVIMAENINRMRYMSHFRAVHRGSYFQ********QLRTDAWGFICPVHTPDGTPCGLLNHLTTNCQISEYIPSKVLAQIPSVLVSLGMLPLTPVIQSIPEQALMVMLDGRIVGYILDQIATSLVPKLRMLKIVGEKIPKSLEIVYLKRPEKGMGLYPGLYLFTGPGRMLRPVMNLAAGNIEWIGTFEQVFMDICITMKEAYPGITTHRELSKTDFLSNLANLIPMPDCNQSPRNMYQCQMGKQTMGTPCLNWRYQGVGKLYRLQTPASPFFRPVHYDTLDMDNFPMGTNAIVAVISYTGYDMEDAMILNKSSYERGFAHGCIFKSMFIELESGYNYYGTETMYSGVDGSMMQAQIFFGVVHYQRLRHMVSDKWQTKDYFGRDPANKALEDKLGPDGLVYVGAKLNERDPMYSYWKESENRYVTCRYSGKEEMCVEVVRMSSGFTEGGSVTPNCAYIGYRIQRNPTVGDKFASRAGQKGICSVKWPAEDLPFTDSGLVPDIVFNPHGFPSRMTIGFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GIRVFECFRELFTLFPVNLRHIHEVLLVFKVLKMILNQNTLSAPSLKNLTDKNFGKPPDKQNEFLLTLGAPHIASFDFMLDEGLDLAVEDIAPIEFEIYGKTLKLNIVKAAISEPKVPAGPVGIHFNKYYPTEARQTRSVYSGPFNVTVAWSWDGKAGGTFTKEVGRVPIMLKSKRCHLRNLTPAQLIERGEHPDEWGGYFIVGGHEKLVRLLINNRRNHPIAIKRNAWKNRGLLFSDLGVYIRSVKRDESATNNVLHFVTNGSARFMFSHRKSMCLLGMMQSLHEEGIHTQHDSKVFFGQIFKEKLQYDLRHLNEVEICDYMLTNCILPHLDDYWDKFLCLSHMTCKLFHVVQGMVQLDSEDSIMLQEIMTGGSLYLQLLKKEKSGTSAVLKESDIYAAFRASSIESAMTNFLATGNVSAGKNSTLQLMQASGFVIMAENINRMRYMSHFRAVHRGSYFQEMRSSEPRQLRTDAWGFICPVHTPDGTPCGLLNHLTTNCQISEYIPSKVLAQIPSVLVSLGMLPLTPVIQSIPEQALMVMLDGRIVGYILDQIATSLVPKLRMLKIVGEKIPKSLEIVYLKRPEKGMGLYPGLYLFTGPGRMLRPVMNLAAGNIEWIGTFEQVFMDICITMKEAYPGITTHRELSKTDFLSNLANLIPMPDCNQSPRNMYQCQMGKQTMGTPCLNWRYQGVGKLYRLQTPASPFFRPVHYDTLDMDNFPMGTNAIVAVISYTGYDMEDAMILNKSSYERGFAHGCIFKSMFIELESGYNYYGTETMYSGVDGSMMQAQIFFGVVHYQRLRHMVSDKWQTKDYFGRDPANKALEDKLGPDGLVYVGAKLNERDPMYSYWKESENRYVTCRYSGKEEMCVEVVRMSSGFTEGGSVTPNCAYIGYRIQRNPTVGDKFASRAGQKGICSVKWPAEDLPFTDSGLVPDIVFNPHGFPSRMTIGFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase I subunit RPA2 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentQ5REE8
DNA-directed RNA polymerase I subunit rpa2 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentQ54BM1
DNA-directed RNA polymerase I subunit RPA135 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Second largest core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol I is composed of mobile elements and RPA2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentP22138

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.6DNA-directed RNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain B
Confidence level:very confident
Coverage over the Query: 63-775,804-951
View the alignment between query and template
View the model in PyMOL
Template: 2A6H, chain C
Confidence level:very confident
Coverage over the Query: 50-117,130-173,198-418,435-505,522-526,537-617,628-775,812-951
View the alignment between query and template
View the model in PyMOL
Template: 2WAQ, chain B
Confidence level:confident
Coverage over the Query: 72-830,847-949
View the alignment between query and template
View the model in PyMOL