Query         psy842
Match_columns 111
No_of_seqs    70 out of 72
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:25:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy842.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/842hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10210 MRP-S32:  Mitochondria 100.0 2.5E-54 5.4E-59  305.2   8.5   96   10-108     1-96  (96)
  2 KOG4106|consensus              100.0 4.8E-47   1E-51  277.4   8.6   97   11-111    28-125 (125)
  3 PF13540 RCC1_2:  Regulator of   79.4       2 4.3E-05   23.8   2.2   14   13-27     10-23  (30)
  4 PF01436 NHL:  NHL repeat;  Int  69.4     4.7  0.0001   21.9   2.0   17   11-27      3-19  (28)
  5 PF07676 PD40:  WD40-like Beta   60.4     5.9 0.00013   22.0   1.3   12   14-25     13-24  (39)
  6 PF06009 Laminin_II:  Laminin D  55.2     6.1 0.00013   28.6   1.0   20   14-33    110-129 (138)
  7 cd08556 GDPD Glycerophosphodie  53.9     8.6 0.00019   27.1   1.6   15   14-29     33-47  (189)
  8 PF13186 SPASM:  Iron-sulfur cl  52.1     9.6 0.00021   22.5   1.4   18   12-29      5-22  (64)
  9 COG4118 Phd Antitoxin of toxin  49.0      20 0.00043   24.7   2.7   29    2-31     15-43  (84)
 10 cd01747 GATase1_Glutamyl_Hydro  48.2      74  0.0016   25.6   6.2   13   27-40    210-222 (273)
 11 COG1724 Predicted RNA binding   47.1      13 0.00028   25.2   1.5   18   17-34     34-52  (66)
 12 PF03009 GDPD:  Glycerophosphor  45.4      14  0.0003   26.8   1.5   15   14-29     30-44  (256)
 13 cd08582 GDPD_like_2 Glyceropho  41.1      18 0.00039   27.3   1.6   17   14-31     33-49  (233)
 14 cd08562 GDPD_EcUgpQ_like Glyce  39.6      19 0.00041   26.7   1.5   17   14-31     33-49  (229)
 15 PF02604 PhdYeFM_antitox:  Anti  39.2      33 0.00072   21.4   2.4   24    2-25     14-37  (75)
 16 cd08567 GDPD_SpGDE_like Glycer  38.1      21 0.00046   27.0   1.6   17   14-31     35-51  (263)
 17 cd08563 GDPD_TtGDE_like Glycer  37.7      21 0.00045   26.9   1.5   17   14-31     35-51  (230)
 18 PF09561 RE_HpaII:  HpaII restr  37.2      22 0.00047   30.7   1.7   15   14-29    295-309 (355)
 19 KOG1784|consensus               37.2      32  0.0007   24.9   2.3   13   16-28     15-27  (96)
 20 PF06004 DUF903:  Bacterial pro  36.5      28 0.00061   22.1   1.8   12   15-26      3-14  (50)
 21 TIGR01552 phd_fam prevent-host  36.4      34 0.00073   20.2   2.0   24    2-26     12-35  (52)
 22 TIGR02608 delta_60_rpt delta-6  33.7      36 0.00078   21.7   1.9   15   13-27      4-18  (55)
 23 PF09875 DUF2102:  Uncharacteri  33.5      31 0.00067   25.2   1.8   19   84-102    61-79  (104)
 24 cd08560 GDPD_EcGlpQ_like_1 Gly  31.8      29 0.00064   29.2   1.6   16   14-30     51-66  (356)
 25 PHA03141 helicase-primase prim  31.5      39 0.00084   24.6   2.0   19   14-34     39-57  (101)
 26 PF14132 DUF4299:  Domain of un  30.4      36 0.00078   28.6   1.9   27   15-43    214-240 (304)
 27 cd08579 GDPD_memb_like Glycero  30.0      33 0.00072   25.6   1.5   16   14-30     33-48  (220)
 28 cd08561 GDPD_cytoplasmic_ScUgp  29.5      34 0.00074   26.1   1.5   15   14-29     33-47  (249)
 29 cd08601 GDPD_SaGlpQ_like Glyce  29.4      37 0.00081   26.0   1.8   16   14-30     35-50  (256)
 30 cd08572 GDPD_GDE5_like Glycero  28.3      42 0.00091   26.9   1.9   16   14-30     42-57  (293)
 31 cd08559 GDPD_periplasmic_GlpQ_  27.4      38 0.00082   27.0   1.5   15   14-29     35-49  (296)
 32 KOG1559|consensus               27.3 1.2E+02  0.0025   26.1   4.4   13   74-86    311-323 (340)
 33 cd08602 GDPD_ScGlpQ1_like Glyc  27.3      40 0.00087   27.4   1.7   15   14-29     35-49  (309)
 34 cd08600 GDPD_EcGlpQ_like Glyce  27.1      39 0.00085   27.5   1.6   16   14-30     35-50  (318)
 35 cd08604 GDPD_SHV3_repeat_2 Gly  26.8      39 0.00085   27.3   1.5   14   14-28     35-48  (300)
 36 cd08571 GDPD_SHV3_plant Glycer  26.4      40 0.00088   27.3   1.5   16   14-30     35-50  (302)
 37 PF15641 Tox-MPTase5:  Metallop  26.0      14  0.0003   27.0  -1.1   17   30-46     22-38  (109)
 38 PRK11143 glpQ glycerophosphodi  25.3      45 0.00097   27.9   1.6   16   14-30     61-76  (355)
 39 PRK09454 ugpQ cytoplasmic glyc  24.9      46   0.001   25.7   1.5   15   14-29     42-56  (249)
 40 smart00199 SCY Intercrine alph  24.8      58  0.0013   20.2   1.7   17   14-31     33-49  (59)
 41 cd08566 GDPD_AtGDE_like Glycer  24.7      46   0.001   25.6   1.5   16   14-30     35-50  (240)
 42 KOG4131|consensus               24.3      28  0.0006   29.2   0.2   15   16-30     62-76  (272)
 43 cd08578 GDPD_NUC-2_fungi Putat  24.2      57  0.0012   26.9   2.0   15   14-29     35-49  (300)
 44 cd08583 PI-PLCc_GDPD_SF_unchar  24.0      48   0.001   25.2   1.5   15   14-29     35-49  (237)
 45 cd08574 GDPD_GDE_2_3_6 Glycero  23.9      53  0.0011   25.6   1.7   15   14-29     36-50  (252)
 46 cd08603 GDPD_SHV3_repeat_1 Gly  23.3      52  0.0011   27.3   1.7   15   14-29     37-51  (299)
 47 cd08568 GDPD_TmGDE_like Glycer  23.0      56  0.0012   24.6   1.6   15   14-29     34-48  (226)
 48 cd08606 GDPD_YPL110cp_fungi Gl  23.0      64  0.0014   25.2   2.0   16   14-30     44-59  (286)
 49 KOG1407|consensus               22.9      66  0.0014   27.5   2.2   19   14-32    256-285 (313)
 50 PF06739 SBBP:  Beta-propeller   22.7 1.2E+02  0.0026   17.5   2.7   23   12-34     15-38  (38)
 51 PF08432 Vfa1:  AAA-ATPase Vps4  22.7      50  0.0011   25.1   1.3   23   14-36      7-29  (182)
 52 PF12967 DUF3855:  Domain of Un  22.6      49  0.0011   25.4   1.2   26   65-91    120-145 (158)
 53 cd08570 GDPD_YPL206cp_fungi Gl  22.6      58  0.0012   24.7   1.7   15   14-29     33-47  (234)
 54 cd08607 GDPD_GDE5 Glycerophosp  22.3      66  0.0014   25.1   2.0   15   14-29     41-55  (290)
 55 PRK04057 30S ribosomal protein  22.2      52  0.0011   26.1   1.4   24    1-24     85-110 (203)
 56 COG4703 Uncharacterized protei  22.1      42 0.00092   23.2   0.8   25    1-26      1-35  (74)
 57 PF09631 Sen15:  Sen15 protein;  22.0      76  0.0016   21.8   2.0   25    3-27     60-89  (101)
 58 PF14569 zf-UDP:  Zinc-binding   20.9      35 0.00076   23.9   0.2   23   11-34     15-37  (80)
 59 PF04939 RRS1:  Ribosome biogen  20.7 1.6E+02  0.0035   22.7   3.8   79    3-98     40-119 (164)
 60 cd08581 GDPD_like_1 Glyceropho  20.6      66  0.0014   24.6   1.6   16   14-30     33-48  (229)

No 1  
>PF10210 MRP-S32:  Mitochondrial 28S ribosomal protein S32;  InterPro: IPR019346  This entry represents a family of short proteins; each approximately 100 amino acid residues in length. They are identified as the mitochondrial 28S ribosomal proteins S32. 
Probab=100.00  E-value=2.5e-54  Score=305.21  Aligned_cols=96  Identities=41%  Similarity=0.739  Sum_probs=92.1

Q ss_pred             cccceeEEeeCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCchhhhHHHHhhhhcccccccc
Q psy842           10 PLTHKIAITADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKEEFVRQDLMNITFTNKHRWF   89 (111)
Q Consensus        10 s~~~~iavTsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~~~~~eELskmf~TTKHrWy   89 (111)
                      +++++||||+||+|||||||+++||||||||||++++..+++++++|+|++.+++|+.+++|++||||||||||||||||
T Consensus         1 ~c~~~iavT~dG~tIVcwHP~~~fPYEhTKPip~~~~~~~~~~~~d~~lk~~l~~~~~~~~~p~~eeLskmfyTTKHrWy   80 (96)
T PF10210_consen    1 NCKVEIAVTSDGRTIVCWHPEKDFPYEHTKPIPRPDPVSSNEETHDQILKARLSKFKKKKPEPVIEELSKMFYTTKHRWY   80 (96)
T ss_pred             CceeeEEEecCCCEEEEeCCCCCCCcccccCCCCCCCCcchhhhhhHHHHHHHHhhhccCccchHHHHHHhhCCCCcccc
Confidence            47889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhhhhcCCCCCCCC
Q psy842           90 PVRKMRQKKRYFKPLIPDR  108 (111)
Q Consensus        90 Pr~q~~~rr~k~~p~p~DR  108 (111)
                      |||  ++||+|+|| |+||
T Consensus        81 Pr~--r~~r~k~~p-p~~r   96 (96)
T PF10210_consen   81 PRG--RDRRAKKTP-PKDR   96 (96)
T ss_pred             ccc--ccccccCCC-CCCC
Confidence            999  699999999 6665


No 2  
>KOG4106|consensus
Probab=100.00  E-value=4.8e-47  Score=277.42  Aligned_cols=97  Identities=33%  Similarity=0.601  Sum_probs=89.8

Q ss_pred             ccceeEEeeCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCch-hhhHHHHhhhhcccccccc
Q psy842           11 LTHKIAITADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKE-EFVRQDLMNITFTNKHRWF   89 (111)
Q Consensus        11 ~~~~iavTsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~-~~~~eELskmf~TTKHrWy   89 (111)
                      |+++||||+||||||||||+++||||||||||++++.++|+++|||++++.+++++...+ +++++|||+||||||||||
T Consensus        28 lve~vavt~nGRTIvawHP~~~~PYEhTkPip~~s~~~~savvkdq~lkt~~~ak~s~~pe~p~~~eL~~~f~TtKHrWy  107 (125)
T KOG4106|consen   28 LVEKVAVTANGRTIVAWHPPQHFPYEHTKPIPLGSLTKKSAVVKDQSLKTSAAAKASSIPEEPVNAELKDIFYTTKHRWY  107 (125)
T ss_pred             eeeeEEEecCCcEEEEecCCCCCCcccCCCCCCCccccchhhHHHHHHHHHHHHHHhhCCcchHHHHHHHHHhhhccccc
Confidence            677999999999999999999999999999999999999999999999999999877775 7788999999999999999


Q ss_pred             cchhhhhhhhcCCCCCCCCCCC
Q psy842           90 PVRKMRQKKRYFKPLIPDREYL  111 (111)
Q Consensus        90 Pr~q~~~rr~k~~p~p~DR~yl  111 (111)
                      ||+  |+.|+++++  +|+||+
T Consensus       108 pr~--R~~r~r~~~--~p~p~r  125 (125)
T KOG4106|consen  108 PRT--REERLRNVA--APIPRR  125 (125)
T ss_pred             cch--HHHHHhcCC--CCCCCC
Confidence            999  777777887  888774


No 3  
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=79.36  E-value=2  Score=23.77  Aligned_cols=14  Identities=57%  Similarity=1.260  Sum_probs=10.9

Q ss_pred             ceeEEeeCCcEEEEe
Q psy842           13 HKIAITADGTTVVCW   27 (111)
Q Consensus        13 ~~iavTsDG~tIVcw   27 (111)
                      ..+||++|| .+.||
T Consensus        10 ht~al~~~g-~v~~w   23 (30)
T PF13540_consen   10 HTCALTSDG-EVYCW   23 (30)
T ss_dssp             EEEEEE-TT-EEEEE
T ss_pred             EEEEEEcCC-CEEEE
Confidence            378999999 78888


No 4  
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=69.44  E-value=4.7  Score=21.86  Aligned_cols=17  Identities=29%  Similarity=0.462  Sum_probs=14.0

Q ss_pred             ccceeEEeeCCcEEEEe
Q psy842           11 LTHKIAITADGTTVVCW   27 (111)
Q Consensus        11 ~~~~iavTsDG~tIVcw   27 (111)
                      ....||+.+||..+||=
T Consensus         3 ~P~gvav~~~g~i~VaD   19 (28)
T PF01436_consen    3 YPHGVAVDSDGNIYVAD   19 (28)
T ss_dssp             SEEEEEEETTSEEEEEE
T ss_pred             CCcEEEEeCCCCEEEEE
Confidence            35679999999999983


No 5  
>PF07676 PD40:  WD40-like Beta Propeller Repeat;  InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This region appears to be related to the IPR001680 from INTERPRO repeat. This model is likely to miss copies within a sequence.; PDB: 2HQS_D 1C5K_A 2IVZ_A 2W8B_D 3IAX_A 1CRZ_A 1N6F_D 1N6D_C 1N6E_C 1K32_A ....
Probab=60.37  E-value=5.9  Score=21.99  Aligned_cols=12  Identities=25%  Similarity=0.318  Sum_probs=9.6

Q ss_pred             eeEEeeCCcEEE
Q psy842           14 KIAITADGTTVV   25 (111)
Q Consensus        14 ~iavTsDG~tIV   25 (111)
                      ..++++||+.||
T Consensus        13 ~p~~SpDGk~i~   24 (39)
T PF07676_consen   13 SPAWSPDGKYIY   24 (39)
T ss_dssp             EEEE-TTSSEEE
T ss_pred             CEEEecCCCEEE
Confidence            778999999987


No 6  
>PF06009 Laminin_II:  Laminin Domain II;  InterPro: IPR010307  It has been suggested that the domains I and II from laminin A, B1 and B2 may come together to form a triple helical coiled-coil structure [].; GO: 0007155 cell adhesion, 0005604 basement membrane; PDB: 2WJS_A.
Probab=55.24  E-value=6.1  Score=28.63  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=5.5

Q ss_pred             eeEEeeCCcEEEEecCCCCC
Q psy842           14 KIAITADGTTVVCWHPEQPF   33 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~~f   33 (111)
                      .|+|+.||.++|-|+|..+.
T Consensus       110 kV~m~F~g~s~velrpp~~l  129 (138)
T PF06009_consen  110 KVSMKFNGNSGVELRPPINL  129 (138)
T ss_dssp             --B-------EEEE----S-
T ss_pred             eeeeEECCCceeeeCCCCCH
Confidence            78999999999999997654


No 7  
>cd08556 GDPD Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins. The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcoho
Probab=53.92  E-value=8.6  Score=27.12  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=13.4

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|.+|.|| ++||+|-
T Consensus        33 Dv~~tkDg-~~vv~Hd   47 (189)
T cd08556          33 DVQLTKDG-VLVVIHD   47 (189)
T ss_pred             EeeEcCCC-CEEEEcC
Confidence            78899999 6888998


No 8  
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=52.07  E-value=9.6  Score=22.49  Aligned_cols=18  Identities=28%  Similarity=0.499  Sum_probs=14.5

Q ss_pred             cceeEEeeCCcEEEEecC
Q psy842           12 THKIAITADGTTVVCWHP   29 (111)
Q Consensus        12 ~~~iavTsDG~tIVcwHP   29 (111)
                      ...++|++||.+..|-+.
T Consensus         5 ~~~~~I~~dG~v~pC~~~   22 (64)
T PF13186_consen    5 WNSLYIDPDGDVYPCCHD   22 (64)
T ss_pred             CeEEEEeeCccEEeCCCC
Confidence            457899999999999433


No 9  
>COG4118 Phd Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning]
Probab=49.02  E-value=20  Score=24.67  Aligned_cols=29  Identities=34%  Similarity=0.440  Sum_probs=21.2

Q ss_pred             hhhhhhhccccceeEEeeCCcEEEEecCCC
Q psy842            2 SSLLRRLVPLTHKIAITADGTTVVCWHPEQ   31 (111)
Q Consensus         2 ~~l~rr~~s~~~~iavTsDG~tIVcwHP~~   31 (111)
                      |.||+|... .++|.||..|+.|+=-=|-.
T Consensus        15 S~lL~rV~a-GEev~IT~~G~PVArivp~~   43 (84)
T COG4118          15 SELLRRVRA-GEEVIITKRGRPVARLVPLA   43 (84)
T ss_pred             HHHHHHHhC-CCEEEEeeCCeEEEEEeecC
Confidence            667777654 66899999999887554433


No 10 
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=48.18  E-value=74  Score=25.56  Aligned_cols=13  Identities=38%  Similarity=0.989  Sum_probs=10.6

Q ss_pred             ecCCCCCCcccccC
Q psy842           27 WHPEQPFPYEHSLP   40 (111)
Q Consensus        27 wHP~~~fPYEhTKP   40 (111)
                      ||||.. +||...-
T Consensus       210 FHPEks-~few~~~  222 (273)
T cd01747         210 WHPEKN-AFEWKKS  222 (273)
T ss_pred             cCCCcc-ccccccc
Confidence            799988 8997763


No 11 
>COG1724 Predicted RNA binding protein (dsRBD-like fold), HicA family    [General function prediction only]
Probab=47.06  E-value=13  Score=25.19  Aligned_cols=18  Identities=33%  Similarity=0.672  Sum_probs=14.1

Q ss_pred             EeeC-CcEEEEecCCCCCC
Q psy842           17 ITAD-GTTVVCWHPEQPFP   34 (111)
Q Consensus        17 vTsD-G~tIVcwHP~~~fP   34 (111)
                      .-+| |+++|-.||..|.|
T Consensus        34 kHp~~~~vtVP~Hp~~dl~   52 (66)
T COG1724          34 KHPDGGRVTVPFHPGEDLP   52 (66)
T ss_pred             EcCCCCEEEecCCCccccC
Confidence            3455 78888889999876


No 12 
>PF03009 GDPD:  Glycerophosphoryl diester phosphodiesterase family;  InterPro: IPR004129 Glycerophosphoryl diester phosphodiesterases display broad specificity for glycerophosphodiesters; glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol) all of which are are hydrolysed by this enzyme.; GO: 0008889 glycerophosphodiester phosphodiesterase activity, 0006071 glycerol metabolic process; PDB: 3I10_A 2P76_H 2OOG_F 3KS6_D 3KS5_A 2PZ0_B 1YDY_B 1T8Q_A 1O1Z_A 3L12_B ....
Probab=45.42  E-value=14  Score=26.76  Aligned_cols=15  Identities=33%  Similarity=0.669  Sum_probs=10.5

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      -|-+|+|| .+||+|-
T Consensus        30 Dv~lTkDg-~~Vv~HD   44 (256)
T PF03009_consen   30 DVQLTKDG-VPVVFHD   44 (256)
T ss_dssp             EEEE-TTS--EEE-SS
T ss_pred             cccccCCc-eeEeccC
Confidence            78899999 8888886


No 13 
>cd08582 GDPD_like_2 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=41.14  E-value=18  Score=27.29  Aligned_cols=17  Identities=35%  Similarity=0.745  Sum_probs=14.0

Q ss_pred             eeEEeeCCcEEEEecCCC
Q psy842           14 KIAITADGTTVVCWHPEQ   31 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~   31 (111)
                      .|.+|.|| ++||+|-..
T Consensus        33 Dv~lTkDg-~~Vv~HD~~   49 (233)
T cd08582          33 DVRLTKDG-ELVCVHDPT   49 (233)
T ss_pred             EEEEccCC-CEEEecCCc
Confidence            78899999 888899544


No 14 
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46), UgpQ, and similar proteins. GP-GDE plays an essential role in the metabolic pathway of E. coli. It catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. E. coli possesses two major G3P uptake systems: Glp and Ugp, which contain genes coding for two distinct GP-GDEs. UgpQ gene from the E. coli ugp operon codes for a cytosolic phosphodiesterase GlpQ, which is the prototype of this family. Various glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GPG)
Probab=39.62  E-value=19  Score=26.74  Aligned_cols=17  Identities=29%  Similarity=0.622  Sum_probs=14.1

Q ss_pred             eeEEeeCCcEEEEecCCC
Q psy842           14 KIAITADGTTVVCWHPEQ   31 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~   31 (111)
                      .|.+|+|| .+|++|-..
T Consensus        33 Dv~~TkDg-~lvv~HD~~   49 (229)
T cd08562          33 DVKLSGDG-TLVLIHDDT   49 (229)
T ss_pred             EEeECCCC-CEEEEcCCC
Confidence            78899999 888888653


No 15 
>PF02604 PhdYeFM_antitox:  Antitoxin Phd_YefM, type II toxin-antitoxin system;  InterPro: IPR006442 This entry is represented by Bacteriophage P1, prevent-host-death protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family of proteins is characterised by a region of about 55 amino acids toward the N-terminal end of bacterial proteins which are themselves only 85 amino acids, or thereabouts, in length. The best-characterised member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (IPR006440 from INTERPRO) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family. ; PDB: 3DBO_A 2ODK_B 3G5O_D 2A6Q_B 3D55_C 3OEI_E 3CTO_C 3K33_D 3KH2_F 3HS2_C ....
Probab=39.16  E-value=33  Score=21.37  Aligned_cols=24  Identities=29%  Similarity=0.364  Sum_probs=16.2

Q ss_pred             hhhhhhhccccceeEEeeCCcEEE
Q psy842            2 SSLLRRLVPLTHKIAITADGTTVV   25 (111)
Q Consensus         2 ~~l~rr~~s~~~~iavTsDG~tIV   25 (111)
                      +.++.+...-.+.|+||.+|+-.+
T Consensus        14 ~~~l~~v~~~~~pv~It~~g~~~~   37 (75)
T PF02604_consen   14 SELLDEVEEGEEPVIITKNGKPVA   37 (75)
T ss_dssp             HHHHHHHHHCT-EEEEEETTEEEE
T ss_pred             HHHHHHHHcCCCeEEEEECCCCCe
Confidence            345555555555699999998754


No 16 
>cd08567 GDPD_SpGDE_like Glycerophosphodiester phosphodiesterase domain of putative Silicibacter pomeroyi glycerophosphodiester phosphodiesterase and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) and similar proteins. The prototype of this CD is a putative GP-GDE from Silicibacter pomeroyi (SpGDE). It shows high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=38.11  E-value=21  Score=27.03  Aligned_cols=17  Identities=29%  Similarity=0.571  Sum_probs=13.8

Q ss_pred             eeEEeeCCcEEEEecCCC
Q psy842           14 KIAITADGTTVVCWHPEQ   31 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~   31 (111)
                      .|.+|.|| ++||+|-..
T Consensus        35 DV~~TkDg-~~Vv~HD~~   51 (263)
T cd08567          35 DLVLTKDG-VIVVSHDPK   51 (263)
T ss_pred             EEEEcCCC-CEEEeCCCc
Confidence            78999999 788888653


No 17 
>cd08563 GDPD_TtGDE_like Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.
Probab=37.73  E-value=21  Score=26.90  Aligned_cols=17  Identities=35%  Similarity=0.614  Sum_probs=14.1

Q ss_pred             eeEEeeCCcEEEEecCCC
Q psy842           14 KIAITADGTTVVCWHPEQ   31 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~   31 (111)
                      .|-+|.|| ++||+|-..
T Consensus        35 DV~~TkDg-~~Vv~HD~~   51 (230)
T cd08563          35 DVHLTKDG-QLVVIHDET   51 (230)
T ss_pred             EeeEcCCC-CEEEECCCC
Confidence            78899999 888888654


No 18 
>PF09561 RE_HpaII:  HpaII restriction endonuclease;  InterPro: IPR019062 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This family includes HpaII, which recognises the double-stranded sequence CCGG and cleaves after C-1. 
Probab=37.19  E-value=22  Score=30.69  Aligned_cols=15  Identities=40%  Similarity=0.902  Sum_probs=11.9

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      =|.|..|| -|||||=
T Consensus       295 yivV~~dG-evlcYHi  309 (355)
T PF09561_consen  295 YIVVKEDG-EVLCYHI  309 (355)
T ss_pred             EEEEeCCC-CEEEEEe
Confidence            47788888 5699994


No 19 
>KOG1784|consensus
Probab=37.18  E-value=32  Score=24.85  Aligned_cols=13  Identities=38%  Similarity=0.429  Sum_probs=10.9

Q ss_pred             EEeeCCcEEEEec
Q psy842           16 AITADGTTVVCWH   28 (111)
Q Consensus        16 avTsDG~tIVcwH   28 (111)
                      .+|.|||+||.--
T Consensus        15 vIt~DGr~ivgsL   27 (96)
T KOG1784|consen   15 VITNDGRVIVGSL   27 (96)
T ss_pred             EEecCCeEEEEEe
Confidence            5899999999753


No 20 
>PF06004 DUF903:  Bacterial protein of unknown function (DUF903);  InterPro: IPR010305 This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.; PDB: 2RB6_B 3BDU_F 2RA2_F 2RD1_C 3FIF_H 2JN0_A 2K57_A.
Probab=36.53  E-value=28  Score=22.05  Aligned_cols=12  Identities=42%  Similarity=0.653  Sum_probs=10.0

Q ss_pred             eEEeeCCcEEEE
Q psy842           15 IAITADGTTVVC   26 (111)
Q Consensus        15 iavTsDG~tIVc   26 (111)
                      +.-|.||++||+
T Consensus         3 vi~t~dG~~i~t   14 (50)
T PF06004_consen    3 VITTNDGRTIVT   14 (50)
T ss_dssp             EEEETTSEEEEE
T ss_pred             EEEeCCCcEEEe
Confidence            557899999995


No 21 
>TIGR01552 phd_fam prevent-host-death family protein. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family.
Probab=36.39  E-value=34  Score=20.21  Aligned_cols=24  Identities=29%  Similarity=0.411  Sum_probs=16.0

Q ss_pred             hhhhhhhccccceeEEeeCCcEEEE
Q psy842            2 SSLLRRLVPLTHKIAITADGTTVVC   26 (111)
Q Consensus         2 ~~l~rr~~s~~~~iavTsDG~tIVc   26 (111)
                      +.++.+...-. .|.||.+|+.++-
T Consensus        12 ~~~l~~v~~~~-pv~It~~g~~~av   35 (52)
T TIGR01552        12 GELLKRVRDGE-PVTITKRGRPVAV   35 (52)
T ss_pred             HHHHHHHHCCC-CEEEEECCcceEE
Confidence            34555554434 8999999985553


No 22 
>TIGR02608 delta_60_rpt delta-60 repeat domain. This domain occurs in tandem repeats, as many as 13, in proteins from Bdellovibrio bacteriovorus, Azotobacter vinelandii, Geobacter sulfurreducens, Pirellula sp. 1, Myxococcus xanthus, and others, many of which are Deltaproteobacteria. The periodicity of the repeat ranges from about 57 to 61 amino acids, and a core region of about 54 is represented by this model and seed alignment.
Probab=33.68  E-value=36  Score=21.72  Aligned_cols=15  Identities=27%  Similarity=0.437  Sum_probs=12.5

Q ss_pred             ceeEEeeCCcEEEEe
Q psy842           13 HKIAITADGTTVVCW   27 (111)
Q Consensus        13 ~~iavTsDG~tIVcw   27 (111)
                      ..+++-+|||.||+=
T Consensus         4 ~~~~~q~DGkIlv~G   18 (55)
T TIGR02608         4 YAVAVQSDGKILVAG   18 (55)
T ss_pred             EEEEECCCCcEEEEE
Confidence            468999999999863


No 23 
>PF09875 DUF2102:  Uncharacterized protein conserved in archaea (DUF2102);  InterPro: IPR012025 The exact functionof this protein unknown, but likely is linked to methanogenesis or a process closely connected to it.
Probab=33.49  E-value=31  Score=25.23  Aligned_cols=19  Identities=26%  Similarity=0.200  Sum_probs=16.0

Q ss_pred             cccccccchhhhhhhhcCC
Q psy842           84 NKHRWFPVRKMRQKKRYFK  102 (111)
Q Consensus        84 TKHrWyPr~q~~~rr~k~~  102 (111)
                      +|-||||.|.-|++|+..-
T Consensus        61 ~KdRGFppgD~RRCRa~rg   79 (104)
T PF09875_consen   61 VKDRGFPPGDPRRCRATRG   79 (104)
T ss_pred             eecCCCCCCccHHhhhccC
Confidence            4999999998888888754


No 24 
>cd08560 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodiesterase domain similar to Escherichia coli periplasmic phosphodiesterase (GlpQ) include uncharacterized proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) and their hypothetical homologs. Members in this subfamily show high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=31.75  E-value=29  Score=29.21  Aligned_cols=16  Identities=31%  Similarity=0.711  Sum_probs=13.9

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|.+|.|| .+||+|=.
T Consensus        51 DV~lTkDg-~lVV~HD~   66 (356)
T cd08560          51 DVTFTKDR-ELVCRHSQ   66 (356)
T ss_pred             EeeEccCC-cEEEECCC
Confidence            78999999 88889974


No 25 
>PHA03141 helicase-primase primase subunit; Provisional
Probab=31.55  E-value=39  Score=24.62  Aligned_cols=19  Identities=42%  Similarity=1.101  Sum_probs=14.2

Q ss_pred             eeEEeeCCcEEEEecCCCCCC
Q psy842           14 KIAITADGTTVVCWHPEQPFP   34 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~~fP   34 (111)
                      -..+|.+|  =+|||++-+.|
T Consensus        39 ~fi~T~~G--p~cW~~~~~lP   57 (101)
T PHA03141         39 LFLLTTEG--PVCWHQKLPLP   57 (101)
T ss_pred             eEEEeCCc--ceEecCCCCCC
Confidence            45688888  57999976554


No 26 
>PF14132 DUF4299:  Domain of unknown function (DUF4299)
Probab=30.37  E-value=36  Score=28.56  Aligned_cols=27  Identities=15%  Similarity=0.240  Sum_probs=20.4

Q ss_pred             eEEeeCCcEEEEecCCCCCCcccccCCCC
Q psy842           15 IAITADGTTVVCWHPEQPFPYEHSLPLPV   43 (111)
Q Consensus        15 iavTsDG~tIVcwHP~~~fPYEhTKPIp~   43 (111)
                      =++|.|.+||.-+.|+++  |+....+..
T Consensus       214 YtLte~v~TILP~kP~v~--~~~~e~~~~  240 (304)
T PF14132_consen  214 YTLTEGVDTILPYKPSVE--FENVEIVKN  240 (304)
T ss_pred             EEEcCCCCEEecCCCCCC--cccccccCC
Confidence            478999999999999554  455555555


No 27 
>cd08579 GDPD_memb_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor.
Probab=30.01  E-value=33  Score=25.61  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=13.2

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|.|| .+||+|-.
T Consensus        33 DV~~T~Dg-~~vv~HD~   48 (220)
T cd08579          33 DVQETKDG-QFVVMHDA   48 (220)
T ss_pred             EeeEcCCC-CEEEEcCC
Confidence            78899999 77888864


No 28 
>cd08561 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized cytoplasmic phosphodiesterases which predominantly exist in bacteria. The prototype of this family is a putative cytoplasmic phosphodiesterase encoded by gene ulpQ2 (SCO1419) in the Streptomyces coelicolor genome. It is distantly related to the Escherichia coli cytoplasmic phosphodiesterases UgpQ that catalyzes the hydrolysis of glycerophosphodiesters at the inner side of the cytoplasmic membrane to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=29.53  E-value=34  Score=26.11  Aligned_cols=15  Identities=33%  Similarity=0.536  Sum_probs=12.8

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|.+|.|| .+||+|-
T Consensus        33 Dv~~TkDg-~~Vv~HD   47 (249)
T cd08561          33 DVHATKDG-VLVVIHD   47 (249)
T ss_pred             EeeECCCC-CEEEECC
Confidence            78899999 8888884


No 29 
>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=29.40  E-value=37  Score=25.99  Aligned_cols=16  Identities=38%  Similarity=0.679  Sum_probs=12.1

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|+|| .+|++|-.
T Consensus        35 DV~lTkDg-~~Vv~HD~   50 (256)
T cd08601          35 DLQMTKDG-VLVAMHDE   50 (256)
T ss_pred             EeeECCCC-eEEEeCCC
Confidence            68899999 66666753


No 30 
>cd08572 GDPD_GDE5_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. GDE5 is widely expressed in mammalian tissues, with highest expression in spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant  glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=28.28  E-value=42  Score=26.88  Aligned_cols=16  Identities=31%  Similarity=0.534  Sum_probs=13.4

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|.|| ++||+|=.
T Consensus        42 DV~lTkDG-~lVv~HD~   57 (293)
T cd08572          42 DVQLTKDG-VPVIYHDF   57 (293)
T ss_pred             EEEEccCC-eEEEEcCC
Confidence            68899999 88888853


No 31 
>cd08559 GDPD_periplasmic_GlpQ_like Periplasmic glycerophosphodiester phosphodiesterase domain (GlpQ) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in bacterial and eukaryotic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) similar to Escherichia coli periplasmic phosphodiesterase GlpQ. GP-GDEs are involved in glycerol metabolism and catalyze the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. In E. coli, there are two major G3P uptake systems: Glp and Ugp, which contain genes coding for two different GP-GDEs. GlpQ gene from the glp operon codes for a periplasmic phosphodiesterase GlpQ. GlpQ is a dimeric enzyme that hydrolyzes periplasmic glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GPG), glycerophosphoinositol (GPI), 
Probab=27.39  E-value=38  Score=26.99  Aligned_cols=15  Identities=33%  Similarity=0.638  Sum_probs=12.6

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| ++||.|=
T Consensus        35 DV~lTkDg-~lVv~HD   49 (296)
T cd08559          35 DLVMTKDG-VLVARHD   49 (296)
T ss_pred             eeEEccCC-CEEEecc
Confidence            78899999 7788884


No 32 
>KOG1559|consensus
Probab=27.30  E-value=1.2e+02  Score=26.09  Aligned_cols=13  Identities=23%  Similarity=0.358  Sum_probs=9.9

Q ss_pred             HHHHhhhhccccc
Q psy842           74 RQDLMNITFTNKH   86 (111)
Q Consensus        74 ~eELskmf~TTKH   86 (111)
                      .++||.+.|.=|-
T Consensus       311 ekvlsnLIYnykP  323 (340)
T KOG1559|consen  311 EKVLSNLIYNYKP  323 (340)
T ss_pred             HHHHHHHHhccCc
Confidence            4889999986553


No 33 
>cd08602 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodiesterase domain of Streptomycin coelicolor (GlpQ1) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present  in a group of putative bacterial and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) similar to Escherichia coli periplasmic phosphodiesterase GlpQ, as well as plant glycerophosphodiester phosphodiesterases (GP-PDEs), all of which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. The prototypes of this family include putative secreted phosphodiesterase encoded by gene glpQ1 (SCO1565) from the pho regulon in Streptomyces coelicolor genome, and in plants, two distinct Arabidopsis thaliana genes, AT5G08030 and AT1G74210, coding putative GP-PDEs from the cell walls and vacuoles, respectively.
Probab=27.28  E-value=40  Score=27.40  Aligned_cols=15  Identities=33%  Similarity=0.784  Sum_probs=12.8

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+||+|=
T Consensus        35 DVqlTkDg-~lVv~HD   49 (309)
T cd08602          35 DLVSTKDG-VLICRHE   49 (309)
T ss_pred             eeeECCCC-cEEEeCC
Confidence            68899999 7888885


No 34 
>cd08600 GDPD_EcGlpQ_like Glycerophosphodiester phosphodiesterase domain of Escherichia coli (GlpQ) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Escherichia coli periplasmic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46), GlpQ, and similar proteins. GP-GDE plays an essential role in the metabolic pathway of E. coli. It catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. E. coli possesses two major G3P uptake systems: Glp and Ugp, which contain genes coding for two different GP-GDEs. GlpQ gene from the E. coli glp operon codes for a periplasmic phosphodiesterase GlpQ, which is the prototype of this family. GlpQ is a dimeric enzyme that hydrolyzes periplasmic glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GP
Probab=27.14  E-value=39  Score=27.55  Aligned_cols=16  Identities=25%  Similarity=0.472  Sum_probs=13.7

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|.+|.|| .+||+|-.
T Consensus        35 DV~lTkDg-~lVv~HD~   50 (318)
T cd08600          35 DVVLTKDD-KLVVIHDH   50 (318)
T ss_pred             eeeECcCC-cEEEeCCc
Confidence            68899999 88889964


No 35 
>cd08604 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodiesterase domain repeat 2 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) repeat 2 present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play important an role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP
Probab=26.78  E-value=39  Score=27.26  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=12.1

Q ss_pred             eeEEeeCCcEEEEec
Q psy842           14 KIAITADGTTVVCWH   28 (111)
Q Consensus        14 ~iavTsDG~tIVcwH   28 (111)
                      .|.+|.|| .+||.|
T Consensus        35 DV~lTkDG-~lVv~H   48 (300)
T cd08604          35 SVQMSKDG-VPFCLD   48 (300)
T ss_pred             eeeEcCCC-CEEEec
Confidence            78899999 777888


No 36 
>cd08571 GDPD_SHV3_plant Glycerophosphodiester phosphodiesterase domain of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase (GDPD) domain present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play an important role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP-GDEs are not conserv
Probab=26.40  E-value=40  Score=27.28  Aligned_cols=16  Identities=25%  Similarity=0.590  Sum_probs=13.2

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|.+|.|| .+||.|-.
T Consensus        35 DV~lTkDg-~lVv~HD~   50 (302)
T cd08571          35 DVQLTKDG-VPICLPSI   50 (302)
T ss_pred             eeeEcCCC-cEEEeCCc
Confidence            68899999 78888854


No 37 
>PF15641 Tox-MPTase5:  Metallopeptidase toxin 5
Probab=26.02  E-value=14  Score=26.96  Aligned_cols=17  Identities=24%  Similarity=0.466  Sum_probs=11.3

Q ss_pred             CCCCCcccccCCCCCCC
Q psy842           30 EQPFPYEHSLPLPVTEQ   46 (111)
Q Consensus        30 ~~~fPYEhTKPIp~~d~   46 (111)
                      +.||||=.--=||+-.+
T Consensus        22 ~edf~~l~lt~~p~y~~   38 (109)
T PF15641_consen   22 SEDFPYLNLTHIPQYNY   38 (109)
T ss_pred             HhhcccccceeccccCh
Confidence            57888876666666333


No 38 
>PRK11143 glpQ glycerophosphodiester phosphodiesterase; Provisional
Probab=25.25  E-value=45  Score=27.92  Aligned_cols=16  Identities=25%  Similarity=0.480  Sum_probs=13.7

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|.|| ++||+|-.
T Consensus        61 DV~lTkDg-~lVv~HD~   76 (355)
T PRK11143         61 DLVMTKDD-QLVVLHDH   76 (355)
T ss_pred             eeeEccCC-cEEEeCCc
Confidence            68899999 88899963


No 39 
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional
Probab=24.87  E-value=46  Score=25.65  Aligned_cols=15  Identities=27%  Similarity=0.523  Sum_probs=11.8

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+|++|=
T Consensus        42 DV~lT~Dg-~lVV~HD   56 (249)
T PRK09454         42 DAKLSADG-EIFLLHD   56 (249)
T ss_pred             EeeECCCC-CEEEECC
Confidence            78899999 5667773


No 40 
>smart00199 SCY Intercrine alpha family (small cytokine C-X-C) (chemokine CXC). Family of cytokines involved in cell-specific chemotaxis,  mediation of cell growth, and the inflammatory response.
Probab=24.80  E-value=58  Score=20.21  Aligned_cols=17  Identities=35%  Similarity=0.565  Sum_probs=11.8

Q ss_pred             eeEEeeCCcEEEEecCCC
Q psy842           14 KIAITADGTTVVCWHPEQ   31 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~   31 (111)
                      =|..|.+|+. ||.+|+.
T Consensus        33 vIf~tk~g~~-~C~dP~~   49 (59)
T smart00199       33 VIFTTKKGRK-VCADPKA   49 (59)
T ss_pred             EEEEEeCCCE-EecCCCh
Confidence            3455667765 8999974


No 41 
>cd08566 GDPD_AtGDE_like Glycerophosphodiester phosphodiesterase domain of Agrobacterium tumefaciens and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase (AtGDE, EC 3.1.4.46) and its uncharacterized eukaryotic homolgoues. Members in this family shows high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. AtGDE exists as a hexamer that is a trimer of dimers, which is unique among current known GDPD family members. However, it remains unclear if the hexamer plays a physiological role in AtGDE enzymatic function.
Probab=24.67  E-value=46  Score=25.64  Aligned_cols=16  Identities=31%  Similarity=0.515  Sum_probs=12.1

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|.+|+|| .+|++|-.
T Consensus        35 DV~~T~Dg-~~vv~HD~   50 (240)
T cd08566          35 DVRRTKDG-VLVLMHDD   50 (240)
T ss_pred             EeeEcCCC-CEEEECCC
Confidence            78899999 66666743


No 42 
>KOG4131|consensus
Probab=24.32  E-value=28  Score=29.22  Aligned_cols=15  Identities=27%  Similarity=0.733  Sum_probs=12.4

Q ss_pred             EEeeCCcEEEEecCC
Q psy842           16 AITADGTTVVCWHPE   30 (111)
Q Consensus        16 avTsDG~tIVcwHP~   30 (111)
                      ++-+++.-||+|||-
T Consensus        62 a~ek~~e~IvAYHP~   76 (272)
T KOG4131|consen   62 ALEKNAESIVAYHPP   76 (272)
T ss_pred             HHHhCCceeEeecCc
Confidence            355889999999994


No 43 
>cd08578 GDPD_NUC-2_fungi Putative glycerophosphodiester phosphodiesterase domain of ankyrin repeat protein NUC-2 and similar proteins. This subfamily corresponds to a putative glycerophosphodiester phosphodiesterase domain (GDPD) present in Neurospora crassa ankyrin repeat protein NUC-2 and its Saccharomyces cerevisiae counterpart, Phosphate system positive regulatory protein PHO81. Some uncharecaterized NUC-2 sequence homologs are also included in this family. NUC-2 plays an important role in the phosphate-regulated signal transduction pathway in Neurospora crassa. It shows high similarity to a cyclin-dependent kinase inhibitory protein PHO81, which is part of the phosphate regulatory cascade in S. cerevisiae. Both NUC-2 and PHO81 have multi-domain architecture, including an SPX N-terminal domain following by several ankyrin repeats and a putative C-terminal GDPD domain with unknown function. Although the putative GDPD domain displays sequence homology to that of bacterial glycerophos
Probab=24.17  E-value=57  Score=26.92  Aligned_cols=15  Identities=33%  Similarity=0.410  Sum_probs=12.2

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| +.|+||=
T Consensus        35 DVqLTkDg-vpVV~HD   49 (300)
T cd08578          35 KVCVLKDG-TPVVAPE   49 (300)
T ss_pred             EEEECcCC-EEEEECC
Confidence            67899999 7777773


No 44 
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=24.01  E-value=48  Score=25.16  Aligned_cols=15  Identities=33%  Similarity=0.725  Sum_probs=12.7

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+|++|=
T Consensus        35 DV~lTkDg-~lVv~HD   49 (237)
T cd08583          35 DLSLTSDG-VLVARHS   49 (237)
T ss_pred             EeeEccCC-CEEEEEC
Confidence            67899999 8888885


No 45 
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase domain-containing protein subtype 5 (GDE2), subtype 2 (GDE3), subtype 1 (GDE6), and their eukaryotic homologs. Mammalian GDE2, GDE3, and GDE6 show very high sequence similarity to each other and have been classified into the same family. Although they are all transmembrane proteins, based on different pattern of tissue distribution, these enzymes might display diverse cellular functions. Mammalian GDE2 is primarily expressed in mature neurons. It selectively hydrolyzes glycerophosphocholine (GPC) and mainly functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differentiation in the spinal cord.  Mammalian GDE3 is specifically expressed in bo
Probab=23.87  E-value=53  Score=25.56  Aligned_cols=15  Identities=27%  Similarity=0.443  Sum_probs=11.8

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+||.|=
T Consensus        36 DV~lTkDg-~lVV~HD   50 (252)
T cd08574          36 DVTISYDG-VPFLMHD   50 (252)
T ss_pred             EEeEccCC-cEEEeCC
Confidence            68899999 6667774


No 46 
>cd08603 GDPD_SHV3_repeat_1 Glycerophosphodiester phosphodiesterase domain repeat 1 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) repeat 1 present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play an important role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP
Probab=23.32  E-value=52  Score=27.35  Aligned_cols=15  Identities=27%  Similarity=0.625  Sum_probs=12.9

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|.+|.|| +.||.|=
T Consensus        37 DV~lTkDg-vlVv~HD   51 (299)
T cd08603          37 DLQLTKDG-VGICLPD   51 (299)
T ss_pred             EeeECcCC-cEEEeCC
Confidence            78899999 8888884


No 47 
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized  homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form.
Probab=22.97  E-value=56  Score=24.62  Aligned_cols=15  Identities=33%  Similarity=0.581  Sum_probs=11.6

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+|+.|-
T Consensus        34 DV~lT~Dg-~~Vv~HD   48 (226)
T cd08568          34 DVWLTKDG-KLVVLHD   48 (226)
T ss_pred             EEEEcCCC-CEEEECC
Confidence            68899999 5666773


No 48 
>cd08606 GDPD_YPL110cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL110cp and other uncharacterized fungal homologs. The product of S. cerevisiae ORF YPL110c (GDE1), YPL110cp (Gde1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL110cp has been characterized as a cytoplasmic glycerophosphocholine (GPC)-specific phosphodiesterase that selectively hydrolyzes GPC, not glycerophosphoinositol (GPI), to generate choline and glycerolphosphate. YPL110cp has multi-domain architecture, including not only C-terminal GDPD, but also an SPX N-terminal domain along with several ankyrin repeats, which imp
Probab=22.96  E-value=64  Score=25.21  Aligned_cols=16  Identities=25%  Similarity=0.306  Sum_probs=12.3

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|.|| ++|++|-.
T Consensus        44 DV~lTkDg-~~VV~HD~   59 (286)
T cd08606          44 DVQLTKDL-VPVIYHDF   59 (286)
T ss_pred             EEEEccCC-EEEEeCCC
Confidence            78899999 66667754


No 49 
>KOG1407|consensus
Probab=22.86  E-value=66  Score=27.49  Aligned_cols=19  Identities=47%  Similarity=0.982  Sum_probs=15.2

Q ss_pred             eeEEeeCCcEE-----------EEecCCCC
Q psy842           14 KIAITADGTTV-----------VCWHPEQP   32 (111)
Q Consensus        14 ~iavTsDG~tI-----------VcwHP~~~   32 (111)
                      .||-+.+|..+           |+|||...
T Consensus       256 DIA~vetGd~~~eI~~~~~t~tVAWHPk~~  285 (313)
T KOG1407|consen  256 DIAEVETGDRVWEIPCEGPTFTVAWHPKRP  285 (313)
T ss_pred             EeEecccCCeEEEeeccCCceeEEecCCCc
Confidence            68888888876           99999754


No 50 
>PF06739 SBBP:  Beta-propeller repeat;  InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller. SBBP stands for Seven Bladed Beta Propeller.
Probab=22.68  E-value=1.2e+02  Score=17.51  Aligned_cols=23  Identities=26%  Similarity=0.404  Sum_probs=17.2

Q ss_pred             cceeEEeeCCcEEEEecCCC-CCC
Q psy842           12 THKIAITADGTTVVCWHPEQ-PFP   34 (111)
Q Consensus        12 ~~~iavTsDG~tIVcwHP~~-~fP   34 (111)
                      ...|||.++|...|+=.=.. +||
T Consensus        15 ~~~IavD~~GNiYv~G~T~~~~fp   38 (38)
T PF06739_consen   15 GNGIAVDSNGNIYVTGYTNGNDFP   38 (38)
T ss_pred             EEEEEECCCCCEEEEEeecCCCCC
Confidence            45899999999998855444 554


No 51 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=22.66  E-value=50  Score=25.12  Aligned_cols=23  Identities=22%  Similarity=0.453  Sum_probs=18.2

Q ss_pred             eeEEeeCCcEEEEecCCCCCCcc
Q psy842           14 KIAITADGTTVVCWHPEQPFPYE   36 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~~~fPYE   36 (111)
                      .||.++-..++|||=|+..+=|-
T Consensus         7 kVa~~~~k~C~IC~KpsttVL~t   29 (182)
T PF08432_consen    7 KVAETDAKACFICYKPSTTVLIT   29 (182)
T ss_pred             eeccCCCCceeEecCCCceEEec
Confidence            57888888899999998655443


No 52 
>PF12967 DUF3855:  Domain of Unknown Function with PDB structure (DUF3855);  InterPro: IPR024482 This domain forms an unusual alpha/beta fold where a six-stranded antiparallel beta-sheet is wrapped around a central alpha-helix, flanked by an additional alpha-helix and a small sub-domain consisting of a single beta-strand and a two-stranded antiparallel beta-sheet []. It shows weak structural similarities to phosphoribosylformylglycinamidine synthases and some thioesterase superfamily members, but its function is unknown.; PDB: 1O22_A.
Probab=22.60  E-value=49  Score=25.44  Aligned_cols=26  Identities=31%  Similarity=0.520  Sum_probs=16.4

Q ss_pred             hcCCchhhhHHHHhhhhcccccccccc
Q psy842           65 FKPKKEEFVRQDLMNITFTNKHRWFPV   91 (111)
Q Consensus        65 ~k~k~~~~~~eELskmf~TTKHrWyPr   91 (111)
                      .|+|...-+.+|.||-||-|| .|=|-
T Consensus       120 vk~knr~e~v~~fmkyffesk-gw~pg  145 (158)
T PF12967_consen  120 VKSKNRNEVVEEFMKYFFESK-GWNPG  145 (158)
T ss_dssp             STT--HHHHHHHHHHHHHHHT-T--GG
T ss_pred             hhhccHHHHHHHHHHHHHhcc-CCCCC
Confidence            355555556799999999998 46553


No 53 
>cd08570 GDPD_YPL206cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL206cp and uncharacterized hypothetical homologs existing in fungi. The product of S. cerevisiae ORF YPL206c (PGC1), YPL206cp (Pgc1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL206cp is an integral membrane protein with a single GDPD domain following by a short hydrophobic C-terminal tail that may function as a membrane anchor. This protein plays an essential role in the regulation of the cardiolipin (CL) biosynthetic pathway in yeast by removing the excess phosphatidylglycerol (PG) content of membranes via a phospholip
Probab=22.59  E-value=58  Score=24.68  Aligned_cols=15  Identities=40%  Similarity=0.594  Sum_probs=12.4

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| .+|++|-
T Consensus        33 Dv~lTkDg-~~vv~HD   47 (234)
T cd08570          33 DVHLTKDG-VVVISHD   47 (234)
T ss_pred             EeeEccCC-cEEEeCC
Confidence            67889999 7778884


No 54 
>cd08607 GDPD_GDE5 Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative mammalian GDE5 and similar proteins. Mammalian GDE5 is widely expressed in mammalian tissues, with highest expression in the spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant  glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. In addition to C-terminal GDPD domain, all members in this subfamily have a starch binding domain (CBM20) in the N-terminus, which suggests these proteins may play a distinct role in glycerol metabolism.
Probab=22.32  E-value=66  Score=25.10  Aligned_cols=15  Identities=27%  Similarity=0.437  Sum_probs=11.7

Q ss_pred             eeEEeeCCcEEEEecC
Q psy842           14 KIAITADGTTVVCWHP   29 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP   29 (111)
                      .|-+|.|| ++|++|-
T Consensus        41 DV~lTkDg-~~VV~HD   55 (290)
T cd08607          41 DVQLTKDL-VPVVYHD   55 (290)
T ss_pred             EEEEccCC-eEEEEcC
Confidence            68899999 6666774


No 55 
>PRK04057 30S ribosomal protein S3Ae; Validated
Probab=22.24  E-value=52  Score=26.08  Aligned_cols=24  Identities=38%  Similarity=0.473  Sum_probs=19.0

Q ss_pred             ChhhhhhhccccceeE--EeeCCcEE
Q psy842            1 MSSLLRRLVPLTHKIA--ITADGTTV   24 (111)
Q Consensus         1 ~~~l~rr~~s~~~~ia--vTsDG~tI   24 (111)
                      +.||.||-+|+.+.+.  .|.||-.+
T Consensus        85 lrSlVrk~~S~Ie~~vdvkTkDGy~l  110 (203)
T PRK04057         85 LRSLVRRRTSKIDAIVDVTTKDGYKV  110 (203)
T ss_pred             HHhHhccCceeEEEEEEEEcCCCCEE
Confidence            3589999999999554  69999653


No 56 
>COG4703 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.14  E-value=42  Score=23.21  Aligned_cols=25  Identities=40%  Similarity=0.663  Sum_probs=14.7

Q ss_pred             Chhhhh---hhccccc-------eeEEeeCCcEEEE
Q psy842            1 MSSLLR---RLVPLTH-------KIAITADGTTVVC   26 (111)
Q Consensus         1 ~~~l~r---r~~s~~~-------~iavTsDG~tIVc   26 (111)
                      ||+|++   ||.++++       .-.+-.|| ++||
T Consensus         1 ~ShLl~IinRL~~m~edggn~k~~rnFEr~G-~vv~   35 (74)
T COG4703           1 MSHLLGIINRLEAMQEDGGNEKRQRNFERNG-EVVC   35 (74)
T ss_pred             CcHHHHHHHHHHHHHhccCCchhhhhhhcCC-EEEE
Confidence            677765   7776666       12344566 5555


No 57 
>PF09631 Sen15:  Sen15 protein;  InterPro: IPR018593  The Sen15 subunit of the tRNA intron-splicing endonuclease is one of the two structural subunits of this heterotetrameric enzyme. Residues 36-157 of this subunit possess a novel homodimeric fold. Each monomer consists of three alpha-helices and a mixed antiparallel/parallel beta-sheet. Two monomers of Sen15 fold with two monomers of Sen34, one of the two catalytic subunits, to form an alpha2-beta2 tetramer as part of the functional endonuclease assembly []. ; PDB: 2GW6_B.
Probab=21.95  E-value=76  Score=21.76  Aligned_cols=25  Identities=24%  Similarity=0.405  Sum_probs=14.6

Q ss_pred             hhhhhhcccc---c--eeEEeeCCcEEEEe
Q psy842            3 SLLRRLVPLT---H--KIAITADGTTVVCW   27 (111)
Q Consensus         3 ~l~rr~~s~~---~--~iavTsDG~tIVcw   27 (111)
                      .+|-+|.+..   .  -||+.+|.+|||=|
T Consensus        60 ~~f~~l~~~~~~~~ri~LAiv~~DsTiVYY   89 (101)
T PF09631_consen   60 EVFDSLPNPSGDPKRILLAIVDDDSTIVYY   89 (101)
T ss_dssp             HHHHHHHHHCT---EEEEEEE-TTS-EEEE
T ss_pred             HHHHHhcccCCCCcEEEEEEEcCCCCEEEE
Confidence            4555555432   2  57888888899966


No 58 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=20.95  E-value=35  Score=23.94  Aligned_cols=23  Identities=30%  Similarity=0.595  Sum_probs=10.0

Q ss_pred             ccceeEEeeCCcEEEEecCCCCCC
Q psy842           11 LTHKIAITADGTTVVCWHPEQPFP   34 (111)
Q Consensus        11 ~~~~iavTsDG~tIVcwHP~~~fP   34 (111)
                      ..+.|++|.||..+|+-| +--||
T Consensus        15 CGD~VGl~~~Ge~FVAC~-eC~fP   37 (80)
T PF14569_consen   15 CGDDVGLTENGEVFVACH-ECAFP   37 (80)
T ss_dssp             S--B--B-SSSSB--S-S-SS---
T ss_pred             ccCccccCCCCCEEEEEc-ccCCc
Confidence            445899999999999988 35555


No 59 
>PF04939 RRS1:  Ribosome biogenesis regulatory protein (RRS1);  InterPro: IPR007023 This is a family of eukaryotic ribosomal biogenesis regulatory proteins.; GO: 0042254 ribosome biogenesis, 0005634 nucleus
Probab=20.69  E-value=1.6e+02  Score=22.70  Aligned_cols=79  Identities=19%  Similarity=0.325  Sum_probs=46.4

Q ss_pred             hhhhhhccccceeEEeeCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCchhhhHHHHhhhhc
Q psy842            3 SLLRRLVPLTHKIAITADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKEEFVRQDLMNITF   82 (111)
Q Consensus         3 ~l~rr~~s~~~~iavTsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~~~~~eELskmf~   82 (111)
                      .|+-+|-+|  .+.-++||  +|+-=|...+.-=--||||.+-+     .++=+.-....+        +....=++|.|
T Consensus        40 ~Lin~l~~L--p~~~~~~g--~~~~LP~p~t~LPReKplPk~K~-----~TkWE~FA~~KG--------I~K~Kk~~lv~  102 (164)
T PF04939_consen   40 LLINQLFEL--PTERTEDG--VLAKLPEPTTRLPREKPLPKPKP-----PTKWEKFAKKKG--------IKKRKKSKLVY  102 (164)
T ss_pred             HHHHHHHhC--CceecCCC--eEEECCCCCccCcccCCCCCCCC-----CChHHHHHHHcC--------CccccCcCccc
Confidence            466666667  44455777  77777777777777789998665     344332221111        12222344444


Q ss_pred             -ccccccccchhhhhhh
Q psy842           83 -TNKHRWFPVRKMRQKK   98 (111)
Q Consensus        83 -TTKHrWyPr~q~~~rr   98 (111)
                       -....|-||-.|....
T Consensus       103 DE~~~eW~prwGyk~~n  119 (164)
T PF04939_consen  103 DEETGEWVPRWGYKRAN  119 (164)
T ss_pred             cccccchhhcccccccc
Confidence             3457899998775544


No 60 
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=20.59  E-value=66  Score=24.65  Aligned_cols=16  Identities=31%  Similarity=0.721  Sum_probs=13.1

Q ss_pred             eeEEeeCCcEEEEecCC
Q psy842           14 KIAITADGTTVVCWHPE   30 (111)
Q Consensus        14 ~iavTsDG~tIVcwHP~   30 (111)
                      .|-+|.|| .+|+.|-.
T Consensus        33 DV~lTkDg-~~Vv~HD~   48 (229)
T cd08581          33 DVQLSADG-VPVVFHDD   48 (229)
T ss_pred             eeeECCCC-cEEEECCC
Confidence            78899999 77788864


Done!