Diaphorina citri psyllid: psy8425

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------

MSKGLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYYK

cccccccccccccccccccEEEcccccEEEEEEEEECcccEEEEEEccEEEcccccEEEEEcccEEEEEEccccccccCEEEEEEEEcccccEEEEEEEEECccccccccccccccEEEEccCEEEEEccccccccccccECccCEEEEcCEEEccccccCEEEEEccEEEEEccc

***GLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYY*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSKGLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0018108 [BP]	peptidyl-tyrosine phosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0007169 [BP]	transmembrane receptor protein tyrosine kinase signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0070887 [BP]	cellular response to chemical stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0030017 [CC]	sarcomere	probable	GO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0071944 [CC]	cell periphery	probable	GO:0005575, GO:0044464, GO:0005623
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0048522 [BP]	positive regulation of cellular process	probable	GO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007275 [BP]	multicellular organismal development	probable	GO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0004714 [MF]	transmembrane receptor protein tyrosine kinase activity	probable	GO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016740, GO:0060089, GO:0004888, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 8-145
View the alignment between query and template
View the model in PyMOL