Diaphorina citri psyllid: psy8425


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MSKGLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYYK
cccccccccccccccccccEEEcccccEEEEEEEEECcccEEEEEEccEEEcccccEEEEEcccEEEEEEccccccccCEEEEEEEEcccccEEEEEEEEECccccccccccccccEEEEccCEEEEEccccccccccccECccCEEEEcCEEEccccccCEEEEEccEEEEEccc
***GLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKGLRATIHPIEVSGLRNVSVKLRQSLRLVCRCKGNPLPAVSWFKDNVEITTNKRLKIQFKKKRSTLIITRIRSEDAGRYECRGTGVHKDVVSAFAEVSINLRPDNMGGPCPLDSYCLNGGSCTYYDTVGELVCQCAEGYKGQRCESKDVYNRSSMYKPYFSWIKGTVQIFNYYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0007169 [BP]transmembrane receptor protein tyrosine kinase signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007154, GO:0050789, GO:0044699
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0030017 [CC]sarcomereprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0004714 [MF]transmembrane receptor protein tyrosine kinase activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016740, GO:0060089, GO:0004888, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 8-145
View the alignment between query and template
View the model in PyMOL