Query         psy843
Match_columns 109
No_of_seqs    70 out of 72
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 18:38:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy843.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/843hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10210 MRP-S32:  Mitochondria 100.0 2.2E-54 4.7E-59  304.8   8.5   96    8-106     1-96  (96)
  2 KOG4106|consensus              100.0 4.2E-47   9E-52  277.2   8.6   98    8-109    27-125 (125)
  3 PF13540 RCC1_2:  Regulator of   78.7     2.1 4.5E-05   23.7   2.1   14   11-25     10-23  (30)
  4 PF01436 NHL:  NHL repeat;  Int  75.9     2.8 6.1E-05   22.7   2.1   17    9-25      3-19  (28)
  5 PF06009 Laminin_II:  Laminin D  58.5     5.3 0.00011   28.9   1.1   20   12-31    110-129 (138)
  6 PF13186 SPASM:  Iron-sulfur cl  57.3     6.5 0.00014   23.2   1.2   19    9-27      4-22  (64)
  7 cd08556 GDPD Glycerophosphodie  54.8     8.1 0.00017   27.1   1.5   15   12-27     33-47  (189)
  8 COG1724 Predicted RNA binding   48.2      12 0.00027   25.2   1.5   17   16-32     35-52  (66)
  9 PF03009 GDPD:  Glycerophosphor  47.4      13 0.00028   26.8   1.6   15   12-27     30-44  (256)
 10 TIGR02608 delta_60_rpt delta-6  44.9      19 0.00041   23.0   2.0   16   10-25      3-18  (55)
 11 cd01747 GATase1_Glutamyl_Hydro  43.9      94   0.002   24.9   6.2   13   25-38    210-222 (273)
 12 cd08582 GDPD_like_2 Glyceropho  42.6      16 0.00035   27.4   1.6   17   12-29     33-49  (233)
 13 cd08562 GDPD_EcUgpQ_like Glyce  41.5      17 0.00036   26.9   1.5   17   12-29     33-49  (229)
 14 cd08567 GDPD_SpGDE_like Glycer  39.4      19 0.00042   27.1   1.6   17   12-29     35-51  (263)
 15 cd08563 GDPD_TtGDE_like Glycer  38.8      19 0.00042   27.0   1.5   17   12-29     35-51  (230)
 16 PF07676 PD40:  WD40-like Beta   38.6      27 0.00059   19.2   1.8   12   12-23     13-24  (39)
 17 PF08432 Vfa1:  AAA-ATPase Vps4  38.3      19 0.00041   27.3   1.4   25   10-34      5-29  (182)
 18 PF09561 RE_HpaII:  HpaII restr  36.8      22 0.00047   30.6   1.7   14   13-27    296-309 (355)
 19 PF06004 DUF903:  Bacterial pro  36.7      31 0.00067   21.8   2.0   13   12-24      2-14  (50)
 20 cd08560 GDPD_EcGlpQ_like_1 Gly  33.1      27 0.00058   29.4   1.6   16   12-28     51-66  (356)
 21 KOG1784|consensus               32.3      34 0.00074   24.7   1.8   13   14-26     15-27  (96)
 22 cd08579 GDPD_memb_like Glycero  31.3      30 0.00066   25.7   1.5   16   12-28     33-48  (220)
 23 PF14132 DUF4299:  Domain of un  31.1      35 0.00075   28.6   1.9   28   12-41    213-240 (304)
 24 cd08601 GDPD_SaGlpQ_like Glyce  30.8      34 0.00074   26.1   1.7   16   12-28     35-50  (256)
 25 PHA03141 helicase-primase prim  30.8      37 0.00081   24.7   1.8   18   13-32     40-57  (101)
 26 cd08561 GDPD_cytoplasmic_ScUgp  30.7      31 0.00068   26.2   1.5   15   12-27     33-47  (249)
 27 PF06739 SBBP:  Beta-propeller   29.4      80  0.0017   18.2   2.8   25    8-32     13-38  (38)
 28 cd08572 GDPD_GDE5_like Glycero  28.5      41 0.00088   26.9   1.9   16   12-28     42-57  (293)
 29 cd08559 GDPD_periplasmic_GlpQ_  28.2      36 0.00077   27.1   1.5   15   12-27     35-49  (296)
 30 cd08604 GDPD_SHV3_repeat_2 Gly  28.1      36 0.00077   27.4   1.5   14   12-26     35-48  (300)
 31 cd08600 GDPD_EcGlpQ_like Glyce  28.0      37  0.0008   27.6   1.6   16   12-28     35-50  (318)
 32 cd08571 GDPD_SHV3_plant Glycer  27.8      37 0.00079   27.4   1.5   16   12-28     35-50  (302)
 33 PF09875 DUF2102:  Uncharacteri  27.6      45 0.00098   24.3   1.8   29   72-100    48-79  (104)
 34 cd08602 GDPD_ScGlpQ1_like Glyc  27.5      39 0.00084   27.4   1.6   15   12-27     35-49  (309)
 35 KOG4131|consensus               27.0      26 0.00055   29.4   0.5   15   14-28     62-76  (272)
 36 cd08566 GDPD_AtGDE_like Glycer  26.0      42 0.00091   25.8   1.5   15   12-27     35-49  (240)
 37 PRK11143 glpQ glycerophosphodi  25.9      42 0.00091   28.0   1.6   16   12-28     61-76  (355)
 38 PRK09454 ugpQ cytoplasmic glyc  25.8      43 0.00093   25.7   1.5   14   12-26     42-55  (249)
 39 cd08574 GDPD_GDE_2_3_6 Glycero  24.9      48   0.001   25.7   1.7   15   12-27     36-50  (252)
 40 cd08583 PI-PLCc_GDPD_SF_unchar  24.8      45 0.00097   25.2   1.4   15   12-27     35-49  (237)
 41 cd08603 GDPD_SHV3_repeat_1 Gly  24.6      47   0.001   27.5   1.6   15   12-27     37-51  (299)
 42 smart00199 SCY Intercrine alph  24.4      56  0.0012   20.2   1.6   18   11-29     32-49  (59)
 43 PF15641 Tox-MPTase5:  Metallop  24.0      14 0.00031   26.9  -1.3   17   28-44     22-38  (109)
 44 cd08578 GDPD_NUC-2_fungi Putat  24.0      56  0.0012   26.9   2.0   15   12-27     35-49  (300)
 45 cd08568 GDPD_TmGDE_like Glycer  24.0      51  0.0011   24.7   1.6   15   12-27     34-48  (226)
 46 cd08570 GDPD_YPL206cp_fungi Gl  23.7      52  0.0011   24.8   1.6   15   12-27     33-47  (234)
 47 PF09631 Sen15:  Sen15 protein;  23.5      66  0.0014   22.0   1.9   13   13-25     77-89  (101)
 48 cd08606 GDPD_YPL110cp_fungi Gl  23.3      61  0.0013   25.2   2.0   16   12-28     44-59  (286)
 49 KOG1765|consensus               23.1      70  0.0015   25.4   2.2   69   16-98     65-133 (181)
 50 PF12967 DUF3855:  Domain of Un  23.1      48   0.001   25.5   1.3   25   64-89    121-145 (158)
 51 KOG1407|consensus               22.9      65  0.0014   27.5   2.2   21   10-30    254-285 (313)
 52 cd08607 GDPD_GDE5 Glycerophosp  22.4      64  0.0014   25.1   1.9   15   12-27     41-55  (290)
 53 KOG2747|consensus               21.9      58  0.0013   28.5   1.7   14   70-83    330-343 (396)
 54 PF00400 WD40:  WD domain, G-be  21.6 1.1E+02  0.0024   15.9   2.3   16    9-24     13-28  (39)
 55 cd08581 GDPD_like_1 Glyceropho  21.6      61  0.0013   24.8   1.6   16   12-28     33-48  (229)
 56 KOG2284|consensus               21.5      87  0.0019   28.8   2.8   51   32-85    483-534 (728)
 57 cd08575 GDPD_GDE4_like Glycero  20.9      63  0.0014   25.2   1.6   16   12-28     35-50  (264)
 58 cd08573 GDPD_GDE1 Glycerophosp  20.3      65  0.0014   25.1   1.6   16   12-28     33-48  (258)
 59 cd08605 GDPD_GDE5_like_1_plant  20.3      75  0.0016   24.7   1.9   15   12-27     45-59  (282)
 60 cd08585 GDPD_like_3 Glyceropho  20.0      64  0.0014   24.9   1.5   16   12-28     40-55  (237)

No 1  
>PF10210 MRP-S32:  Mitochondrial 28S ribosomal protein S32;  InterPro: IPR019346  This entry represents a family of short proteins; each approximately 100 amino acid residues in length. They are identified as the mitochondrial 28S ribosomal proteins S32. 
Probab=100.00  E-value=2.2e-54  Score=304.80  Aligned_cols=96  Identities=41%  Similarity=0.739  Sum_probs=92.0

Q ss_pred             cccceeeeecCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCChhhhHHHHhhhhccccCccc
Q psy843            8 PLTHKIAITADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKEEFVRQDLMNITFTNKHRWF   87 (109)
Q Consensus         8 ~l~~~iavTsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~e~~~eELsKmfyTTKHRWy   87 (109)
                      +++.+|||||||+|||||||+++||||||||||++++..+++++++|+|++.+++|+.+++|++||||||||||||||||
T Consensus         1 ~c~~~iavT~dG~tIVcwHP~~~fPYEhTKPip~~~~~~~~~~~~d~~lk~~l~~~~~~~~~p~~eeLskmfyTTKHrWy   80 (96)
T PF10210_consen    1 NCKVEIAVTSDGRTIVCWHPEKDFPYEHTKPIPRPDPVSSNEETHDQILKARLSKFKKKKPEPVIEELSKMFYTTKHRWY   80 (96)
T ss_pred             CceeeEEEecCCCEEEEeCCCCCCCcccccCCCCCCCCcchhhhhhHHHHHHHHhhhccCccchHHHHHHhhCCCCcccc
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cchhhhhhhhcCCCCCCCC
Q psy843           88 PVRKMRQKKRYFKPLIPDR  106 (109)
Q Consensus        88 Pr~q~~~rr~k~~p~p~DR  106 (109)
                      |+|  ++||+|+|| |+||
T Consensus        81 Pr~--r~~r~k~~p-p~~r   96 (96)
T PF10210_consen   81 PRG--RDRRAKKTP-PKDR   96 (96)
T ss_pred             ccc--ccccccCCC-CCCC
Confidence            999  699999999 6665


No 2  
>KOG4106|consensus
Probab=100.00  E-value=4.2e-47  Score=277.23  Aligned_cols=98  Identities=33%  Similarity=0.592  Sum_probs=91.1

Q ss_pred             cccceeeeecCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCCh-hhhHHHHhhhhccccCcc
Q psy843            8 PLTHKIAITADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKE-EFVRQDLMNITFTNKHRW   86 (109)
Q Consensus         8 ~l~~~iavTsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~-e~~~eELsKmfyTTKHRW   86 (109)
                      +||++||||+||||||||||+++||||||||||++++.++|+++|||++++.+++++...+ +++++|||+|||||||||
T Consensus        27 ~lve~vavt~nGRTIvawHP~~~~PYEhTkPip~~s~~~~savvkdq~lkt~~~ak~s~~pe~p~~~eL~~~f~TtKHrW  106 (125)
T KOG4106|consen   27 RLVEKVAVTANGRTIVAWHPPQHFPYEHTKPIPLGSLTKKSAVVKDQSLKTSAAAKASSIPEEPVNAELKDIFYTTKHRW  106 (125)
T ss_pred             ceeeeEEEecCCcEEEEecCCCCCCcccCCCCCCCccccchhhHHHHHHHHHHHHHHhhCCcchHHHHHHHHHhhhcccc
Confidence            4899999999999999999999999999999999999999999999999999999877775 778899999999999999


Q ss_pred             ccchhhhhhhhcCCCCCCCCCCC
Q psy843           87 FPVRKMRQKKRYFKPLIPDREYL  109 (109)
Q Consensus        87 yPr~q~~~rr~k~~p~p~DR~yl  109 (109)
                      |||+  |++|+++++  +|+||+
T Consensus       107 ypr~--R~~r~r~~~--~p~p~r  125 (125)
T KOG4106|consen  107 YPRT--REERLRNVA--APIPRR  125 (125)
T ss_pred             ccch--HHHHHhcCC--CCCCCC
Confidence            9999  777778888  888875


No 3  
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=78.68  E-value=2.1  Score=23.65  Aligned_cols=14  Identities=57%  Similarity=1.260  Sum_probs=10.9

Q ss_pred             ceeeeecCCcEEEEe
Q psy843           11 HKIAITADGTTVVCW   25 (109)
Q Consensus        11 ~~iavTsDG~tIVcw   25 (109)
                      ..+||++|| .+.||
T Consensus        10 ht~al~~~g-~v~~w   23 (30)
T PF13540_consen   10 HTCALTSDG-EVYCW   23 (30)
T ss_dssp             EEEEEE-TT-EEEEE
T ss_pred             EEEEEEcCC-CEEEE
Confidence            468999999 68888


No 4  
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=75.87  E-value=2.8  Score=22.68  Aligned_cols=17  Identities=29%  Similarity=0.462  Sum_probs=14.5

Q ss_pred             ccceeeeecCCcEEEEe
Q psy843            9 LTHKIAITADGTTVVCW   25 (109)
Q Consensus         9 l~~~iavTsDG~tIVcw   25 (109)
                      .+..||+.+||..+||=
T Consensus         3 ~P~gvav~~~g~i~VaD   19 (28)
T PF01436_consen    3 YPHGVAVDSDGNIYVAD   19 (28)
T ss_dssp             SEEEEEEETTSEEEEEE
T ss_pred             CCcEEEEeCCCCEEEEE
Confidence            46789999999999984


No 5  
>PF06009 Laminin_II:  Laminin Domain II;  InterPro: IPR010307  It has been suggested that the domains I and II from laminin A, B1 and B2 may come together to form a triple helical coiled-coil structure [].; GO: 0007155 cell adhesion, 0005604 basement membrane; PDB: 2WJS_A.
Probab=58.51  E-value=5.3  Score=28.87  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=5.4

Q ss_pred             eeeeecCCcEEEEecCCCCC
Q psy843           12 KIAITADGTTVVCWHPEQPF   31 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~~f   31 (109)
                      .|+|+.||.++|.|+|..+.
T Consensus       110 kV~m~F~g~s~velrpp~~l  129 (138)
T PF06009_consen  110 KVSMKFNGNSGVELRPPINL  129 (138)
T ss_dssp             --B-------EEEE----S-
T ss_pred             eeeeEECCCceeeeCCCCCH
Confidence            57899999999999997654


No 6  
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=57.31  E-value=6.5  Score=23.15  Aligned_cols=19  Identities=26%  Similarity=0.396  Sum_probs=15.0

Q ss_pred             ccceeeeecCCcEEEEecC
Q psy843            9 LTHKIAITADGTTVVCWHP   27 (109)
Q Consensus         9 l~~~iavTsDG~tIVcwHP   27 (109)
                      .-..++|++||.+..|-+.
T Consensus         4 ~~~~~~I~~dG~v~pC~~~   22 (64)
T PF13186_consen    4 GWNSLYIDPDGDVYPCCHD   22 (64)
T ss_pred             cCeEEEEeeCccEEeCCCC
Confidence            3467899999999999433


No 7  
>cd08556 GDPD Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins. The typical glycerophosphodiester phosphodiesterase domain (GDPD) consists of a TIM barrel and a small insertion domain named the GDPD-insertion (GDPD-I) domain, which is specific for GDPD proteins. This family corresponds to both typical GDPD domain and GDPD-like domain which lacks the GDPD-I region. Members in this family mainly consist of a large family of prokaryotic and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), and a number of uncharacterized homologs. Sphingomyelinases D (SMases D) (sphingomyelin phosphodiesterase D, EC 3.1.4.41) from spider venom, SMases D-like proteins, and phospholipase D (PLD) from several pathogenic bacteria are also included in this family. GDPD plays an essential role in glycerol metabolism and catalyzes the hydrolysis of glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcoho
Probab=54.81  E-value=8.1  Score=27.15  Aligned_cols=15  Identities=33%  Similarity=0.629  Sum_probs=12.8

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|.+|.|| ++||+|-
T Consensus        33 Dv~~tkDg-~~vv~Hd   47 (189)
T cd08556          33 DVQLTKDG-VLVVIHD   47 (189)
T ss_pred             EeeEcCCC-CEEEEcC
Confidence            57789999 6888998


No 8  
>COG1724 Predicted RNA binding protein (dsRBD-like fold), HicA family    [General function prediction only]
Probab=48.22  E-value=12  Score=25.23  Aligned_cols=17  Identities=35%  Similarity=0.753  Sum_probs=13.6

Q ss_pred             ecC-CcEEEEecCCCCCC
Q psy843           16 TAD-GTTVVCWHPEQPFP   32 (109)
Q Consensus        16 TsD-G~tIVcwHP~~~fP   32 (109)
                      -+| |+++|-.||..|+|
T Consensus        35 Hp~~~~vtVP~Hp~~dl~   52 (66)
T COG1724          35 HPDGGRVTVPFHPGEDLP   52 (66)
T ss_pred             cCCCCEEEecCCCccccC
Confidence            345 78888899999876


No 9  
>PF03009 GDPD:  Glycerophosphoryl diester phosphodiesterase family;  InterPro: IPR004129 Glycerophosphoryl diester phosphodiesterases display broad specificity for glycerophosphodiesters; glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol) all of which are are hydrolysed by this enzyme.; GO: 0008889 glycerophosphodiester phosphodiesterase activity, 0006071 glycerol metabolic process; PDB: 3I10_A 2P76_H 2OOG_F 3KS6_D 3KS5_A 2PZ0_B 1YDY_B 1T8Q_A 1O1Z_A 3L12_B ....
Probab=47.39  E-value=13  Score=26.83  Aligned_cols=15  Identities=33%  Similarity=0.669  Sum_probs=9.8

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|+|| .+||+|-
T Consensus        30 Dv~lTkDg-~~Vv~HD   44 (256)
T PF03009_consen   30 DVQLTKDG-VPVVFHD   44 (256)
T ss_dssp             EEEE-TTS--EEE-SS
T ss_pred             cccccCCc-eeEeccC
Confidence            46799999 8888886


No 10 
>TIGR02608 delta_60_rpt delta-60 repeat domain. This domain occurs in tandem repeats, as many as 13, in proteins from Bdellovibrio bacteriovorus, Azotobacter vinelandii, Geobacter sulfurreducens, Pirellula sp. 1, Myxococcus xanthus, and others, many of which are Deltaproteobacteria. The periodicity of the repeat ranges from about 57 to 61 amino acids, and a core region of about 54 is represented by this model and seed alignment.
Probab=44.93  E-value=19  Score=22.96  Aligned_cols=16  Identities=25%  Similarity=0.422  Sum_probs=13.4

Q ss_pred             cceeeeecCCcEEEEe
Q psy843           10 THKIAITADGTTVVCW   25 (109)
Q Consensus        10 ~~~iavTsDG~tIVcw   25 (109)
                      +..|++-+||+.||+=
T Consensus         3 ~~~~~~q~DGkIlv~G   18 (55)
T TIGR02608         3 AYAVAVQSDGKILVAG   18 (55)
T ss_pred             eEEEEECCCCcEEEEE
Confidence            4678999999999863


No 11 
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate.  gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site.
Probab=43.88  E-value=94  Score=24.88  Aligned_cols=13  Identities=38%  Similarity=0.989  Sum_probs=10.6

Q ss_pred             ecCCCCCCcccccC
Q psy843           25 WHPEQPFPYEHSLP   38 (109)
Q Consensus        25 wHP~~~fPYEhTKP   38 (109)
                      ||||.. +||...-
T Consensus       210 FHPEks-~few~~~  222 (273)
T cd01747         210 WHPEKN-AFEWKKS  222 (273)
T ss_pred             cCCCcc-ccccccc
Confidence            699988 8998763


No 12 
>cd08582 GDPD_like_2 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=42.64  E-value=16  Score=27.44  Aligned_cols=17  Identities=35%  Similarity=0.745  Sum_probs=13.4

Q ss_pred             eeeeecCCcEEEEecCCC
Q psy843           12 KIAITADGTTVVCWHPEQ   29 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~   29 (109)
                      .|.+|.|| ++||+|-..
T Consensus        33 Dv~lTkDg-~~Vv~HD~~   49 (233)
T cd08582          33 DVRLTKDG-ELVCVHDPT   49 (233)
T ss_pred             EEEEccCC-CEEEecCCc
Confidence            47789999 888889543


No 13 
>cd08562 GDPD_EcUgpQ_like Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46), UgpQ, and similar proteins. GP-GDE plays an essential role in the metabolic pathway of E. coli. It catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. E. coli possesses two major G3P uptake systems: Glp and Ugp, which contain genes coding for two distinct GP-GDEs. UgpQ gene from the E. coli ugp operon codes for a cytosolic phosphodiesterase GlpQ, which is the prototype of this family. Various glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GPG)
Probab=41.49  E-value=17  Score=26.90  Aligned_cols=17  Identities=29%  Similarity=0.622  Sum_probs=13.5

Q ss_pred             eeeeecCCcEEEEecCCC
Q psy843           12 KIAITADGTTVVCWHPEQ   29 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~   29 (109)
                      .|.+|+|| .+|++|-..
T Consensus        33 Dv~~TkDg-~lvv~HD~~   49 (229)
T cd08562          33 DVKLSGDG-TLVLIHDDT   49 (229)
T ss_pred             EEeECCCC-CEEEEcCCC
Confidence            47789999 888888653


No 14 
>cd08567 GDPD_SpGDE_like Glycerophosphodiester phosphodiesterase domain of putative Silicibacter pomeroyi glycerophosphodiester phosphodiesterase and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) and similar proteins. The prototype of this CD is a putative GP-GDE from Silicibacter pomeroyi (SpGDE). It shows high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=39.44  E-value=19  Score=27.13  Aligned_cols=17  Identities=29%  Similarity=0.571  Sum_probs=13.2

Q ss_pred             eeeeecCCcEEEEecCCC
Q psy843           12 KIAITADGTTVVCWHPEQ   29 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~   29 (109)
                      .|.+|.|| ++||+|-..
T Consensus        35 DV~~TkDg-~~Vv~HD~~   51 (263)
T cd08567          35 DLVLTKDG-VIVVSHDPK   51 (263)
T ss_pred             EEEEcCCC-CEEEeCCCc
Confidence            47899999 778888653


No 15 
>cd08563 GDPD_TtGDE_like Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.
Probab=38.83  E-value=19  Score=26.96  Aligned_cols=17  Identities=35%  Similarity=0.614  Sum_probs=13.6

Q ss_pred             eeeeecCCcEEEEecCCC
Q psy843           12 KIAITADGTTVVCWHPEQ   29 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~   29 (109)
                      .|.+|.|| ++||+|-..
T Consensus        35 DV~~TkDg-~~Vv~HD~~   51 (230)
T cd08563          35 DVHLTKDG-QLVVIHDET   51 (230)
T ss_pred             EeeEcCCC-CEEEECCCC
Confidence            57899999 888888654


No 16 
>PF07676 PD40:  WD40-like Beta Propeller Repeat;  InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This region appears to be related to the IPR001680 from INTERPRO repeat. This model is likely to miss copies within a sequence.; PDB: 2HQS_D 1C5K_A 2IVZ_A 2W8B_D 3IAX_A 1CRZ_A 1N6F_D 1N6D_C 1N6E_C 1K32_A ....
Probab=38.64  E-value=27  Score=19.16  Aligned_cols=12  Identities=25%  Similarity=0.318  Sum_probs=9.0

Q ss_pred             eeeeecCCcEEE
Q psy843           12 KIAITADGTTVV   23 (109)
Q Consensus        12 ~iavTsDG~tIV   23 (109)
                      ..++++||+.||
T Consensus        13 ~p~~SpDGk~i~   24 (39)
T PF07676_consen   13 SPAWSPDGKYIY   24 (39)
T ss_dssp             EEEE-TTSSEEE
T ss_pred             CEEEecCCCEEE
Confidence            567899999887


No 17 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=38.32  E-value=19  Score=27.31  Aligned_cols=25  Identities=20%  Similarity=0.421  Sum_probs=20.1

Q ss_pred             cceeeeecCCcEEEEecCCCCCCcc
Q psy843           10 THKIAITADGTTVVCWHPEQPFPYE   34 (109)
Q Consensus        10 ~~~iavTsDG~tIVcwHP~~~fPYE   34 (109)
                      .+.||.++-..++|||=|+..+=|-
T Consensus         5 ~RkVa~~~~k~C~IC~KpsttVL~t   29 (182)
T PF08432_consen    5 HRKVAETDAKACFICYKPSTTVLIT   29 (182)
T ss_pred             eeeeccCCCCceeEecCCCceEEec
Confidence            3678999999999999998655543


No 18 
>PF09561 RE_HpaII:  HpaII restriction endonuclease;  InterPro: IPR019062 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This family includes HpaII, which recognises the double-stranded sequence CCGG and cleaves after C-1. 
Probab=36.80  E-value=22  Score=30.58  Aligned_cols=14  Identities=43%  Similarity=1.016  Sum_probs=11.1

Q ss_pred             eeeecCCcEEEEecC
Q psy843           13 IAITADGTTVVCWHP   27 (109)
Q Consensus        13 iavTsDG~tIVcwHP   27 (109)
                      |.|..|| -|||||=
T Consensus       296 ivV~~dG-evlcYHi  309 (355)
T PF09561_consen  296 IVVKEDG-EVLCYHI  309 (355)
T ss_pred             EEEeCCC-CEEEEEe
Confidence            6688888 5699994


No 19 
>PF06004 DUF903:  Bacterial protein of unknown function (DUF903);  InterPro: IPR010305 This family consists of several small bacterial proteins several of which are classified as putative lipoproteins. The function of this family is unknown.; PDB: 2RB6_B 3BDU_F 2RA2_F 2RD1_C 3FIF_H 2JN0_A 2K57_A.
Probab=36.72  E-value=31  Score=21.81  Aligned_cols=13  Identities=38%  Similarity=0.549  Sum_probs=10.5

Q ss_pred             eeeeecCCcEEEE
Q psy843           12 KIAITADGTTVVC   24 (109)
Q Consensus        12 ~iavTsDG~tIVc   24 (109)
                      .+.-|.||++||+
T Consensus         2 yvi~t~dG~~i~t   14 (50)
T PF06004_consen    2 YVITTNDGRTIVT   14 (50)
T ss_dssp             EEEEETTSEEEEE
T ss_pred             cEEEeCCCcEEEe
Confidence            3567899999995


No 20 
>cd08560 GDPD_EcGlpQ_like_1 Glycerophosphodiester phosphodiesterase domain similar to Escherichia coli periplasmic phosphodiesterase (GlpQ) include uncharacterized proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) and their hypothetical homologs. Members in this subfamily show high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=33.11  E-value=27  Score=29.37  Aligned_cols=16  Identities=31%  Similarity=0.711  Sum_probs=13.5

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|.+|.|| .+||+|=.
T Consensus        51 DV~lTkDg-~lVV~HD~   66 (356)
T cd08560          51 DVTFTKDR-ELVCRHSQ   66 (356)
T ss_pred             EeeEccCC-cEEEECCC
Confidence            57899999 88889974


No 21 
>KOG1784|consensus
Probab=32.31  E-value=34  Score=24.66  Aligned_cols=13  Identities=38%  Similarity=0.429  Sum_probs=10.9

Q ss_pred             eeecCCcEEEEec
Q psy843           14 AITADGTTVVCWH   26 (109)
Q Consensus        14 avTsDG~tIVcwH   26 (109)
                      .+|.|||+||.--
T Consensus        15 vIt~DGr~ivgsL   27 (96)
T KOG1784|consen   15 VITNDGRVIVGSL   27 (96)
T ss_pred             EEecCCeEEEEEe
Confidence            5899999999753


No 22 
>cd08579 GDPD_memb_like Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial glycerophosphodiester phosphodiesterases. In addition to a C-terminal GDPD domain, most members in this family have an N-terminus that functions as a membrane anchor.
Probab=31.29  E-value=30  Score=25.72  Aligned_cols=16  Identities=31%  Similarity=0.457  Sum_probs=12.6

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|+|| .+||+|-.
T Consensus        33 DV~~T~Dg-~~vv~HD~   48 (220)
T cd08579          33 DVQETKDG-QFVVMHDA   48 (220)
T ss_pred             EeeEcCCC-CEEEEcCC
Confidence            46789999 77888864


No 23 
>PF14132 DUF4299:  Domain of unknown function (DUF4299)
Probab=31.05  E-value=35  Score=28.58  Aligned_cols=28  Identities=18%  Similarity=0.234  Sum_probs=20.7

Q ss_pred             eeeeecCCcEEEEecCCCCCCcccccCCCC
Q psy843           12 KIAITADGTTVVCWHPEQPFPYEHSLPLPV   41 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~~~fPYEhTKPIp~   41 (109)
                      -=++|.|.+||.-+.|+++|  +....+..
T Consensus       213 ~YtLte~v~TILP~kP~v~~--~~~e~~~~  240 (304)
T PF14132_consen  213 VYTLTEGVDTILPYKPSVEF--ENVEIVKN  240 (304)
T ss_pred             EEEEcCCCCEEecCCCCCCc--ccccccCC
Confidence            34799999999999995554  45555555


No 24 
>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=30.85  E-value=34  Score=26.13  Aligned_cols=16  Identities=38%  Similarity=0.679  Sum_probs=11.6

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|+|| .+|++|-.
T Consensus        35 DV~lTkDg-~~Vv~HD~   50 (256)
T cd08601          35 DLQMTKDG-VLVAMHDE   50 (256)
T ss_pred             EeeECCCC-eEEEeCCC
Confidence            47789999 66666653


No 25 
>PHA03141 helicase-primase primase subunit; Provisional
Probab=30.81  E-value=37  Score=24.67  Aligned_cols=18  Identities=44%  Similarity=1.200  Sum_probs=13.4

Q ss_pred             eeeecCCcEEEEecCCCCCC
Q psy843           13 IAITADGTTVVCWHPEQPFP   32 (109)
Q Consensus        13 iavTsDG~tIVcwHP~~~fP   32 (109)
                      ..+|.+|  =+|||+..+.|
T Consensus        40 fi~T~~G--p~cW~~~~~lP   57 (101)
T PHA03141         40 FLLTTEG--PVCWHQKLPLP   57 (101)
T ss_pred             EEEeCCc--ceEecCCCCCC
Confidence            4578888  47999986554


No 26 
>cd08561 GDPD_cytoplasmic_ScUgpQ2_like Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized cytoplasmic phosphodiesterases which predominantly exist in bacteria. The prototype of this family is a putative cytoplasmic phosphodiesterase encoded by gene ulpQ2 (SCO1419) in the Streptomyces coelicolor genome. It is distantly related to the Escherichia coli cytoplasmic phosphodiesterases UgpQ that catalyzes the hydrolysis of glycerophosphodiesters at the inner side of the cytoplasmic membrane to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=30.75  E-value=31  Score=26.21  Aligned_cols=15  Identities=33%  Similarity=0.536  Sum_probs=12.0

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|.+|.|| .+||+|-
T Consensus        33 Dv~~TkDg-~~Vv~HD   47 (249)
T cd08561          33 DVHATKDG-VLVVIHD   47 (249)
T ss_pred             EeeECCCC-CEEEECC
Confidence            46789999 8888884


No 27 
>PF06739 SBBP:  Beta-propeller repeat;  InterPro: IPR010620 This family is related to IPR001680 from INTERPRO and is likely to also form a beta-propeller. SBBP stands for Seven Bladed Beta Propeller.
Probab=29.43  E-value=80  Score=18.21  Aligned_cols=25  Identities=24%  Similarity=0.363  Sum_probs=18.7

Q ss_pred             cccceeeeecCCcEEEEecCCC-CCC
Q psy843            8 PLTHKIAITADGTTVVCWHPEQ-PFP   32 (109)
Q Consensus         8 ~l~~~iavTsDG~tIVcwHP~~-~fP   32 (109)
                      .-...|||.++|...|+=.=.. +||
T Consensus        13 ~~~~~IavD~~GNiYv~G~T~~~~fp   38 (38)
T PF06739_consen   13 DYGNGIAVDSNGNIYVTGYTNGNDFP   38 (38)
T ss_pred             eeEEEEEECCCCCEEEEEeecCCCCC
Confidence            4577899999999998855444 554


No 28 
>cd08572 GDPD_GDE5_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. GDE5 is widely expressed in mammalian tissues, with highest expression in spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant  glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=28.54  E-value=41  Score=26.87  Aligned_cols=16  Identities=31%  Similarity=0.534  Sum_probs=12.7

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| .+||+|=.
T Consensus        42 DV~lTkDG-~lVv~HD~   57 (293)
T cd08572          42 DVQLTKDG-VPVIYHDF   57 (293)
T ss_pred             EEEEccCC-eEEEEcCC
Confidence            46789999 88888853


No 29 
>cd08559 GDPD_periplasmic_GlpQ_like Periplasmic glycerophosphodiester phosphodiesterase domain (GlpQ) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in bacterial and eukaryotic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) similar to Escherichia coli periplasmic phosphodiesterase GlpQ. GP-GDEs are involved in glycerol metabolism and catalyze the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. In E. coli, there are two major G3P uptake systems: Glp and Ugp, which contain genes coding for two different GP-GDEs. GlpQ gene from the glp operon codes for a periplasmic phosphodiesterase GlpQ. GlpQ is a dimeric enzyme that hydrolyzes periplasmic glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GPG), glycerophosphoinositol (GPI), 
Probab=28.23  E-value=36  Score=27.06  Aligned_cols=15  Identities=33%  Similarity=0.638  Sum_probs=12.0

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+||.|=
T Consensus        35 DV~lTkDg-~lVv~HD   49 (296)
T cd08559          35 DLVMTKDG-VLVARHD   49 (296)
T ss_pred             eeEEccCC-CEEEecc
Confidence            47789999 7788884


No 30 
>cd08604 GDPD_SHV3_repeat_2 Glycerophosphodiester phosphodiesterase domain repeat 2 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) repeat 2 present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play important an role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP
Probab=28.09  E-value=36  Score=27.41  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=11.6

Q ss_pred             eeeeecCCcEEEEec
Q psy843           12 KIAITADGTTVVCWH   26 (109)
Q Consensus        12 ~iavTsDG~tIVcwH   26 (109)
                      .|.+|.|| .+||.|
T Consensus        35 DV~lTkDG-~lVv~H   48 (300)
T cd08604          35 SVQMSKDG-VPFCLD   48 (300)
T ss_pred             eeeEcCCC-CEEEec
Confidence            47899999 777888


No 31 
>cd08600 GDPD_EcGlpQ_like Glycerophosphodiester phosphodiesterase domain of Escherichia coli (GlpQ) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Escherichia coli periplasmic glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46), GlpQ, and similar proteins. GP-GDE plays an essential role in the metabolic pathway of E. coli. It catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols, which are major sources of carbon and phosphate. E. coli possesses two major G3P uptake systems: Glp and Ugp, which contain genes coding for two different GP-GDEs. GlpQ gene from the E. coli glp operon codes for a periplasmic phosphodiesterase GlpQ, which is the prototype of this family. GlpQ is a dimeric enzyme that hydrolyzes periplasmic glycerophosphodiesters, such as glycerophosphocholine (GPC), glycerophosphoethanolanmine (GPE), glycerophosphoglycerol (GP
Probab=27.97  E-value=37  Score=27.62  Aligned_cols=16  Identities=25%  Similarity=0.472  Sum_probs=13.1

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| .+||+|-.
T Consensus        35 DV~lTkDg-~lVv~HD~   50 (318)
T cd08600          35 DVVLTKDD-KLVVIHDH   50 (318)
T ss_pred             eeeECcCC-cEEEeCCc
Confidence            46789999 88889964


No 32 
>cd08571 GDPD_SHV3_plant Glycerophosphodiester phosphodiesterase domain of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase (GDPD) domain present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play an important role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP-GDEs are not conserv
Probab=27.82  E-value=37  Score=27.43  Aligned_cols=16  Identities=25%  Similarity=0.590  Sum_probs=12.7

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|.+|.|| .+||.|-.
T Consensus        35 DV~lTkDg-~lVv~HD~   50 (302)
T cd08571          35 DVQLTKDG-VPICLPSI   50 (302)
T ss_pred             eeeEcCCC-cEEEeCCc
Confidence            47799999 78888853


No 33 
>PF09875 DUF2102:  Uncharacterized protein conserved in archaea (DUF2102);  InterPro: IPR012025 The exact functionof this protein unknown, but likely is linked to methanogenesis or a process closely connected to it.
Probab=27.60  E-value=45  Score=24.32  Aligned_cols=29  Identities=17%  Similarity=0.171  Sum_probs=21.0

Q ss_pred             HHHHhhhhcc---ccCccccchhhhhhhhcCC
Q psy843           72 RQDLMNITFT---NKHRWFPVRKMRQKKRYFK  100 (109)
Q Consensus        72 ~eELsKmfyT---TKHRWyPr~q~~~rr~k~~  100 (109)
                      ++++.+|-.+   +|-||||.|.-|+.|+..-
T Consensus        48 i~~iR~ld~~~IF~KdRGFppgD~RRCRa~rg   79 (104)
T PF09875_consen   48 IEEIRKLDPNHIFVKDRGFPPGDPRRCRATRG   79 (104)
T ss_pred             HHHHHhhCCCceEeecCCCCCCccHHhhhccC
Confidence            4566665433   6999999998888887754


No 34 
>cd08602 GDPD_ScGlpQ1_like Glycerophosphodiester phosphodiesterase domain of Streptomycin coelicolor (GlpQ1) and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present  in a group of putative bacterial and eukaryotic glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46) similar to Escherichia coli periplasmic phosphodiesterase GlpQ, as well as plant glycerophosphodiester phosphodiesterases (GP-PDEs), all of which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. The prototypes of this family include putative secreted phosphodiesterase encoded by gene glpQ1 (SCO1565) from the pho regulon in Streptomyces coelicolor genome, and in plants, two distinct Arabidopsis thaliana genes, AT5G08030 and AT1G74210, coding putative GP-PDEs from the cell walls and vacuoles, respectively.
Probab=27.53  E-value=39  Score=27.37  Aligned_cols=15  Identities=33%  Similarity=0.784  Sum_probs=12.2

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+||+|=
T Consensus        35 DVqlTkDg-~lVv~HD   49 (309)
T cd08602          35 DLVSTKDG-VLICRHE   49 (309)
T ss_pred             eeeECCCC-cEEEeCC
Confidence            46789999 7888885


No 35 
>KOG4131|consensus
Probab=27.02  E-value=26  Score=29.36  Aligned_cols=15  Identities=27%  Similarity=0.733  Sum_probs=12.9

Q ss_pred             eeecCCcEEEEecCC
Q psy843           14 AITADGTTVVCWHPE   28 (109)
Q Consensus        14 avTsDG~tIVcwHP~   28 (109)
                      |+-+++.-||+|||-
T Consensus        62 a~ek~~e~IvAYHP~   76 (272)
T KOG4131|consen   62 ALEKNAESIVAYHPP   76 (272)
T ss_pred             HHHhCCceeEeecCc
Confidence            366999999999994


No 36 
>cd08566 GDPD_AtGDE_like Glycerophosphodiester phosphodiesterase domain of Agrobacterium tumefaciens and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase (AtGDE, EC 3.1.4.46) and its uncharacterized eukaryotic homolgoues. Members in this family shows high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. AtGDE exists as a hexamer that is a trimer of dimers, which is unique among current known GDPD family members. However, it remains unclear if the hexamer plays a physiological role in AtGDE enzymatic function.
Probab=25.98  E-value=42  Score=25.78  Aligned_cols=15  Identities=33%  Similarity=0.490  Sum_probs=11.2

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|.+|+|| .+|++|-
T Consensus        35 DV~~T~Dg-~~vv~HD   49 (240)
T cd08566          35 DVRRTKDG-VLVLMHD   49 (240)
T ss_pred             EeeEcCCC-CEEEECC
Confidence            47789999 6666674


No 37 
>PRK11143 glpQ glycerophosphodiester phosphodiesterase; Provisional
Probab=25.92  E-value=42  Score=27.98  Aligned_cols=16  Identities=25%  Similarity=0.480  Sum_probs=13.0

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| ++||+|-.
T Consensus        61 DV~lTkDg-~lVv~HD~   76 (355)
T PRK11143         61 DLVMTKDD-QLVVLHDH   76 (355)
T ss_pred             eeeEccCC-cEEEeCCc
Confidence            46789999 88899963


No 38 
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional
Probab=25.83  E-value=43  Score=25.73  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=10.8

Q ss_pred             eeeeecCCcEEEEec
Q psy843           12 KIAITADGTTVVCWH   26 (109)
Q Consensus        12 ~iavTsDG~tIVcwH   26 (109)
                      .|-+|.|| .+|++|
T Consensus        42 DV~lT~Dg-~lVV~H   55 (249)
T PRK09454         42 DAKLSADG-EIFLLH   55 (249)
T ss_pred             EeeECCCC-CEEEEC
Confidence            46789999 566677


No 39 
>cd08574 GDPD_GDE_2_3_6 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE2, GDE3, GDE6-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase domain-containing protein subtype 5 (GDE2), subtype 2 (GDE3), subtype 1 (GDE6), and their eukaryotic homologs. Mammalian GDE2, GDE3, and GDE6 show very high sequence similarity to each other and have been classified into the same family. Although they are all transmembrane proteins, based on different pattern of tissue distribution, these enzymes might display diverse cellular functions. Mammalian GDE2 is primarily expressed in mature neurons. It selectively hydrolyzes glycerophosphocholine (GPC) and mainly functions in a complex with an antioxidant scavenger peroxiredoxin1 (Prdx1) to control motor neuron differentiation in the spinal cord.  Mammalian GDE3 is specifically expressed in bo
Probab=24.88  E-value=48  Score=25.68  Aligned_cols=15  Identities=27%  Similarity=0.443  Sum_probs=11.2

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+||.|=
T Consensus        36 DV~lTkDg-~lVV~HD   50 (252)
T cd08574          36 DVTISYDG-VPFLMHD   50 (252)
T ss_pred             EEeEccCC-cEEEeCC
Confidence            46789999 6667774


No 40 
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=24.85  E-value=45  Score=25.24  Aligned_cols=15  Identities=33%  Similarity=0.725  Sum_probs=12.0

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+|++|=
T Consensus        35 DV~lTkDg-~lVv~HD   49 (237)
T cd08583          35 DLSLTSDG-VLVARHS   49 (237)
T ss_pred             EeeEccCC-CEEEEEC
Confidence            46689999 7888884


No 41 
>cd08603 GDPD_SHV3_repeat_1 Glycerophosphodiester phosphodiesterase domain repeat 1 of glycerophosphodiester phosphodiesterase-like protein SHV3 and SHV3-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) repeat 1 present in glycerophosphodiester phosphodiesterase (GP-GDE)-like protein SHV3 and SHV3-like proteins (SVLs), which may play an important role in cell wall organization. The prototype of this family is a glycosylphosphatidylinositol (GPI) anchored protein SHV3 encoded by shaven3 (shv3) gene from Arabidopsis thaliana. Members in this family show sequence homology to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.  Both, SHV3 and SVLs, have two tandemly repeated GDPD domains whose biochemical functions remain unclear. The residues essential for interactions with the substrates and calcium ions in bacterial GP
Probab=24.58  E-value=47  Score=27.53  Aligned_cols=15  Identities=27%  Similarity=0.625  Sum_probs=12.6

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|.+|.|| ..||.|=
T Consensus        37 DV~lTkDg-vlVv~HD   51 (299)
T cd08603          37 DLQLTKDG-VGICLPD   51 (299)
T ss_pred             EeeECcCC-cEEEeCC
Confidence            67899999 8888884


No 42 
>smart00199 SCY Intercrine alpha family (small cytokine C-X-C) (chemokine CXC). Family of cytokines involved in cell-specific chemotaxis,  mediation of cell growth, and the inflammatory response.
Probab=24.36  E-value=56  Score=20.21  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=12.6

Q ss_pred             ceeeeecCCcEEEEecCCC
Q psy843           11 HKIAITADGTTVVCWHPEQ   29 (109)
Q Consensus        11 ~~iavTsDG~tIVcwHP~~   29 (109)
                      .=|..|..|+. ||.+|+.
T Consensus        32 avIf~tk~g~~-~C~dP~~   49 (59)
T smart00199       32 AVIFTTKKGRK-VCADPKA   49 (59)
T ss_pred             cEEEEEeCCCE-EecCCCh
Confidence            34566667865 8999974


No 43 
>PF15641 Tox-MPTase5:  Metallopeptidase toxin 5
Probab=24.05  E-value=14  Score=26.85  Aligned_cols=17  Identities=24%  Similarity=0.466  Sum_probs=11.4

Q ss_pred             CCCCCcccccCCCCCCC
Q psy843           28 EQPFPYEHSLPLPVTEQ   44 (109)
Q Consensus        28 ~~~fPYEhTKPIp~~d~   44 (109)
                      +.||||=.--=+|+-.+
T Consensus        22 ~edf~~l~lt~~p~y~~   38 (109)
T PF15641_consen   22 SEDFPYLNLTHIPQYNY   38 (109)
T ss_pred             HhhcccccceeccccCh
Confidence            57888876666666333


No 44 
>cd08578 GDPD_NUC-2_fungi Putative glycerophosphodiester phosphodiesterase domain of ankyrin repeat protein NUC-2 and similar proteins. This subfamily corresponds to a putative glycerophosphodiester phosphodiesterase domain (GDPD) present in Neurospora crassa ankyrin repeat protein NUC-2 and its Saccharomyces cerevisiae counterpart, Phosphate system positive regulatory protein PHO81. Some uncharecaterized NUC-2 sequence homologs are also included in this family. NUC-2 plays an important role in the phosphate-regulated signal transduction pathway in Neurospora crassa. It shows high similarity to a cyclin-dependent kinase inhibitory protein PHO81, which is part of the phosphate regulatory cascade in S. cerevisiae. Both NUC-2 and PHO81 have multi-domain architecture, including an SPX N-terminal domain following by several ankyrin repeats and a putative C-terminal GDPD domain with unknown function. Although the putative GDPD domain displays sequence homology to that of bacterial glycerophos
Probab=24.03  E-value=56  Score=26.85  Aligned_cols=15  Identities=33%  Similarity=0.410  Sum_probs=11.6

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| +.|+||=
T Consensus        35 DVqLTkDg-vpVV~HD   49 (300)
T cd08578          35 KVCVLKDG-TPVVAPE   49 (300)
T ss_pred             EEEECcCC-EEEEECC
Confidence            46689999 7777773


No 45 
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized  homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form.
Probab=23.96  E-value=51  Score=24.73  Aligned_cols=15  Identities=33%  Similarity=0.581  Sum_probs=11.0

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+|++|-
T Consensus        34 DV~lT~Dg-~~Vv~HD   48 (226)
T cd08568          34 DVWLTKDG-KLVVLHD   48 (226)
T ss_pred             EEEEcCCC-CEEEECC
Confidence            46789999 5666773


No 46 
>cd08570 GDPD_YPL206cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL206cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL206cp and uncharacterized hypothetical homologs existing in fungi. The product of S. cerevisiae ORF YPL206c (PGC1), YPL206cp (Pgc1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL206cp is an integral membrane protein with a single GDPD domain following by a short hydrophobic C-terminal tail that may function as a membrane anchor. This protein plays an essential role in the regulation of the cardiolipin (CL) biosynthetic pathway in yeast by removing the excess phosphatidylglycerol (PG) content of membranes via a phospholip
Probab=23.68  E-value=52  Score=24.81  Aligned_cols=15  Identities=40%  Similarity=0.594  Sum_probs=11.7

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| .+|++|-
T Consensus        33 Dv~lTkDg-~~vv~HD   47 (234)
T cd08570          33 DVHLTKDG-VVVISHD   47 (234)
T ss_pred             EeeEccCC-cEEEeCC
Confidence            46789999 7778884


No 47 
>PF09631 Sen15:  Sen15 protein;  InterPro: IPR018593  The Sen15 subunit of the tRNA intron-splicing endonuclease is one of the two structural subunits of this heterotetrameric enzyme. Residues 36-157 of this subunit possess a novel homodimeric fold. Each monomer consists of three alpha-helices and a mixed antiparallel/parallel beta-sheet. Two monomers of Sen15 fold with two monomers of Sen34, one of the two catalytic subunits, to form an alpha2-beta2 tetramer as part of the functional endonuclease assembly []. ; PDB: 2GW6_B.
Probab=23.48  E-value=66  Score=22.02  Aligned_cols=13  Identities=38%  Similarity=0.713  Sum_probs=8.5

Q ss_pred             eeeecCCcEEEEe
Q psy843           13 IAITADGTTVVCW   25 (109)
Q Consensus        13 iavTsDG~tIVcw   25 (109)
                      ||+.+|.+|||=|
T Consensus        77 LAiv~~DsTiVYY   89 (101)
T PF09631_consen   77 LAIVDDDSTIVYY   89 (101)
T ss_dssp             EEEE-TTS-EEEE
T ss_pred             EEEEcCCCCEEEE
Confidence            6777777899966


No 48 
>cd08606 GDPD_YPL110cp_fungi Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL110cp and other uncharacterized fungal homologs. The product of S. cerevisiae ORF YPL110c (GDE1), YPL110cp (Gde1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL110cp has been characterized as a cytoplasmic glycerophosphocholine (GPC)-specific phosphodiesterase that selectively hydrolyzes GPC, not glycerophosphoinositol (GPI), to generate choline and glycerolphosphate. YPL110cp has multi-domain architecture, including not only C-terminal GDPD, but also an SPX N-terminal domain along with several ankyrin repeats, which imp
Probab=23.32  E-value=61  Score=25.23  Aligned_cols=16  Identities=25%  Similarity=0.306  Sum_probs=11.7

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| ++|++|-.
T Consensus        44 DV~lTkDg-~~VV~HD~   59 (286)
T cd08606          44 DVQLTKDL-VPVIYHDF   59 (286)
T ss_pred             EEEEccCC-EEEEeCCC
Confidence            46789999 66667754


No 49 
>KOG1765|consensus
Probab=23.09  E-value=70  Score=25.39  Aligned_cols=69  Identities=26%  Similarity=0.342  Sum_probs=39.6

Q ss_pred             ecCCcEEEEecCCCCCCcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCChhhhHHHHhhhhccccCccccchhhhhh
Q psy843           16 TADGTTVVCWHPEQPFPYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKKEEFVRQDLMNITFTNKHRWFPVRKMRQK   95 (109)
Q Consensus        16 TsDG~tIVcwHP~~~fPYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~~e~~~eELsKmfyTTKHRWyPr~q~~~r   95 (109)
                      |.+|  ||.--|+.-.+.---||||++-+     +++=+-.....+.-+.++.+.+-.|-|.       .|-|+-.|+++
T Consensus        65 t~e~--vv~qLPe~Tt~LPReK~lPr~k~-----~TkWe~FAr~KGI~krKk~~lV~DEasg-------ew~pr~GY~~~  130 (181)
T KOG1765|consen   65 TEEG--VVVQLPEPTTRLPREKPLPRPKP-----ETKWERFARKKGIEKRKKEKLVYDEASG-------EWKPRWGYKRK  130 (181)
T ss_pred             cccc--eeEeCCCccccCccccCCCCCCC-----ccHHHHHHHHcCcchhhccCcceecccc-------ccccccCcccc
Confidence            4455  45555666555556689998766     4443332222222133334455677776       89998888776


Q ss_pred             hhc
Q psy843           96 KRY   98 (109)
Q Consensus        96 r~k   98 (109)
                      ...
T Consensus       131 ndd  133 (181)
T KOG1765|consen  131 NDD  133 (181)
T ss_pred             ccc
Confidence            543


No 50 
>PF12967 DUF3855:  Domain of Unknown Function with PDB structure (DUF3855);  InterPro: IPR024482 This domain forms an unusual alpha/beta fold where a six-stranded antiparallel beta-sheet is wrapped around a central alpha-helix, flanked by an additional alpha-helix and a small sub-domain consisting of a single beta-strand and a two-stranded antiparallel beta-sheet []. It shows weak structural similarities to phosphoribosylformylglycinamidine synthases and some thioesterase superfamily members, but its function is unknown.; PDB: 1O22_A.
Probab=23.06  E-value=48  Score=25.45  Aligned_cols=25  Identities=32%  Similarity=0.539  Sum_probs=16.1

Q ss_pred             cCCChhhhHHHHhhhhccccCccccc
Q psy843           64 KPKKEEFVRQDLMNITFTNKHRWFPV   89 (109)
Q Consensus        64 k~k~~e~~~eELsKmfyTTKHRWyPr   89 (109)
                      |+|...-+.+|.||-||-|| .|=|-
T Consensus       121 k~knr~e~v~~fmkyffesk-gw~pg  145 (158)
T PF12967_consen  121 KSKNRNEVVEEFMKYFFESK-GWNPG  145 (158)
T ss_dssp             TT--HHHHHHHHHHHHHHHT-T--GG
T ss_pred             hhccHHHHHHHHHHHHHhcc-CCCCC
Confidence            55554456799999999998 57653


No 51 
>KOG1407|consensus
Probab=22.91  E-value=65  Score=27.48  Aligned_cols=21  Identities=43%  Similarity=0.819  Sum_probs=15.1

Q ss_pred             cceeeeecCCcEE-----------EEecCCCC
Q psy843           10 THKIAITADGTTV-----------VCWHPEQP   30 (109)
Q Consensus        10 ~~~iavTsDG~tI-----------VcwHP~~~   30 (109)
                      .=.||-+.+|..+           |+|||...
T Consensus       254 ~IDIA~vetGd~~~eI~~~~~t~tVAWHPk~~  285 (313)
T KOG1407|consen  254 FIDIAEVETGDRVWEIPCEGPTFTVAWHPKRP  285 (313)
T ss_pred             eEEeEecccCCeEEEeeccCCceeEEecCCCc
Confidence            3457777777765           89999754


No 52 
>cd08607 GDPD_GDE5 Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative mammalian GDE5 and similar proteins. Mammalian GDE5 is widely expressed in mammalian tissues, with highest expression in the spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant  glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. In addition to C-terminal GDPD domain, all members in this subfamily have a starch binding domain (CBM20) in the N-terminus, which suggests these proteins may play a distinct role in glycerol metabolism.
Probab=22.41  E-value=64  Score=25.09  Aligned_cols=15  Identities=27%  Similarity=0.437  Sum_probs=11.1

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.|| ++|++|-
T Consensus        41 DV~lTkDg-~~VV~HD   55 (290)
T cd08607          41 DVQLTKDL-VPVVYHD   55 (290)
T ss_pred             EEEEccCC-eEEEEcC
Confidence            46789999 6666774


No 53 
>KOG2747|consensus
Probab=21.90  E-value=58  Score=28.51  Aligned_cols=14  Identities=7%  Similarity=-0.052  Sum_probs=11.7

Q ss_pred             hhHHHHhhhhcccc
Q psy843           70 FVRQDLMNITFTNK   83 (109)
Q Consensus        70 ~~~eELsKmfyTTK   83 (109)
                      +.|.|||++|.-+.
T Consensus       330 isI~~iS~~Tgi~~  343 (396)
T KOG2747|consen  330 ISIKEISKETGIRP  343 (396)
T ss_pred             ccHHHHHHhhCCCH
Confidence            88999999987654


No 54 
>PF00400 WD40:  WD domain, G-beta repeat;  InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events.; PDB: 2ZKQ_a 3CFV_B 3CFS_B 1PEV_A 1NR0_A 1VYH_T 3RFH_A 3O2Z_T 3FRX_C 3U5G_g ....
Probab=21.64  E-value=1.1e+02  Score=15.91  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=9.5

Q ss_pred             ccceeeeecCCcEEEE
Q psy843            9 LTHKIAITADGTTVVC   24 (109)
Q Consensus         9 l~~~iavTsDG~tIVc   24 (109)
                      -+..|++.++|..|++
T Consensus        13 ~i~~i~~~~~~~~~~s   28 (39)
T PF00400_consen   13 SINSIAWSPDGNFLAS   28 (39)
T ss_dssp             SEEEEEEETTSSEEEE
T ss_pred             cEEEEEEeccccccee
Confidence            4556666666666554


No 55 
>cd08581 GDPD_like_1 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity to Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=21.58  E-value=61  Score=24.76  Aligned_cols=16  Identities=31%  Similarity=0.721  Sum_probs=12.4

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| .+|+.|-.
T Consensus        33 DV~lTkDg-~~Vv~HD~   48 (229)
T cd08581          33 DVQLSADG-VPVVFHDD   48 (229)
T ss_pred             eeeECCCC-cEEEECCC
Confidence            46789999 77788864


No 56 
>KOG2284|consensus
Probab=21.52  E-value=87  Score=28.80  Aligned_cols=51  Identities=27%  Similarity=0.365  Sum_probs=31.3

Q ss_pred             CcccccCCCCCCCCCchhHHHHHHHHHHHHhhcCCC-hhhhHHHHhhhhccccCc
Q psy843           32 PYEHSLPLPVTEQQSTNSILKVQNVQEIYNVFKPKK-EEFVRQDLMNITFTNKHR   85 (109)
Q Consensus        32 PYEhTKPIp~~d~~~~~~~lk~~~lk~~l~~~k~k~-~e~~~eELsKmfyTTKHR   85 (109)
                      -||.|--+|.+|+..+..+ ..++.... ..|.-+. -+++++|.- .|||.||.
T Consensus       483 gyefts~~~~td~~~s~~l-nn~f~~~i-~nf~~pq~l~~~iq~fe-~fyt~~~~  534 (728)
T KOG2284|consen  483 GYEFTSSWPLTDPQLSTNL-NNQFAQDI-ANFHLPQILQPVIQEFE-KFYTGKHN  534 (728)
T ss_pred             CceecccCCCCChhhcccc-chhHHHHH-HhccchHHHHHHHHHHH-HHhccccC
Confidence            5999999999888665433 33333322 3343332 356667664 59999884


No 57 
>cd08575 GDPD_GDE4_like Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE4-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE4 (also known as glycerophosphodiester phosphodiesterase domain-containing protein 1 (GDPD1)) and similar proteins. Mammalian GDE4 is a transmembrane protein whose cellular function is not elucidated. It is expressed widely, including in placenta, liver, kidney, pancreas, spleen, thymus, ovary, small intestine and peripheral blood leukocytes. It is also expressed in the growth cones in neuroblastoma Neuro2a cells, which suggests mammalian GDE4 may play some distinct role from other members of mammalian GDEs family. Also included in this subfamily are uncharacterized mammalian glycerophosphodiester phosphodiesterase domain-containing protein 3 (GDPD3) and similar proteins which display very high sequence homology to mammalian GDE4.
Probab=20.90  E-value=63  Score=25.17  Aligned_cols=16  Identities=38%  Similarity=0.646  Sum_probs=11.9

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|+|| .+|++|=.
T Consensus        35 DV~lT~Dg-~~Vv~HD~   50 (264)
T cd08575          35 DVQLTKDG-QVVVFHDW   50 (264)
T ss_pred             EEEECCCC-CEEEEcCC
Confidence            46789999 67777754


No 58 
>cd08573 GDPD_GDE1 Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE1 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian GDE1 (also known as MIR16, membrane interacting protein of RGS16) and their metazoan homologs. GDE1 is widely expressed in mammalian tissues, including the heart, brain, liver, and kidney. It shows sequence homology to bacterial glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46), which catalyzes the hydrolysis of various glycerophosphodiesters, and produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. GDE1 has been characterized as GPI-GDE (EC 3.1.4.44) that selectively hydrolyzes extracellular glycerophosphoinositol (GPI) to generate glycerol phosphate and inositol. It functions as an integral membrane-bound glycoprotein interacting with regulator of G protein signaling protein RGS16, and is modulated by G 
Probab=20.31  E-value=65  Score=25.13  Aligned_cols=16  Identities=31%  Similarity=0.518  Sum_probs=12.1

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| .+||.|-.
T Consensus        33 DV~lTkDg-~~Vv~HD~   48 (258)
T cd08573          33 DLEFTKDG-VPVLMHDD   48 (258)
T ss_pred             EeeECCCC-cEEEECCC
Confidence            46789999 67777753


No 59 
>cd08605 GDPD_GDE5_like_1_plant Glycerophosphodiester phosphodiesterase domain of uncharacterized plant glycerophosphodiester phosphodiesterase-like proteins similar to mammalian GDE5. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized plant glycerophosphodiester phosphodiesterase (GP-PDE)-like proteins. Members in this family show very high sequence homology to mammalian glycerophosphodiester phosphodiesterase GDE5 and are distantly related to plant GP-PDEs.
Probab=20.31  E-value=75  Score=24.75  Aligned_cols=15  Identities=40%  Similarity=0.882  Sum_probs=10.2

Q ss_pred             eeeeecCCcEEEEecC
Q psy843           12 KIAITADGTTVVCWHP   27 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP   27 (109)
                      .|-+|.||. +|++|-
T Consensus        45 DV~lTkDg~-~VV~HD   59 (282)
T cd08605          45 DVQVTRDGV-PVIWHD   59 (282)
T ss_pred             EEEECcCCe-EEEECC
Confidence            467899995 555554


No 60 
>cd08585 GDPD_like_3 Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial glycerophosphodiester phosphodiesterases. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized bacterial glycerophosphodiester phosphodiesterase and similar proteins. They show high sequence similarity with Escherichia coli glycerophosphodiester phosphodiesterase, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=20.02  E-value=64  Score=24.88  Aligned_cols=16  Identities=44%  Similarity=0.848  Sum_probs=11.6

Q ss_pred             eeeeecCCcEEEEecCC
Q psy843           12 KIAITADGTTVVCWHPE   28 (109)
Q Consensus        12 ~iavTsDG~tIVcwHP~   28 (109)
                      .|-+|.|| .+|++|=.
T Consensus        40 DV~lT~Dg-~lVv~HD~   55 (237)
T cd08585          40 DVQLTADG-EVVVFHDD   55 (237)
T ss_pred             EeeECCCC-CEEEeccc
Confidence            46789999 66677743


Done!