Diaphorina citri psyllid: psy8441

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----

MRWSMAAHDICFTQTSHSYFFMLGKCVPVVRGAGIYQPCGQRLMIRSFVSKSSLQFHPKPIKSFVMVRKTSCSTSSDTNHYRDYGTLKTGLPEENGSKLLPKIDWIFPILQEKSSSYFWYIASTITVAAVGIVSKWFLTWFNKVHCHNAKQLQSAFDSRPPHVPLLTVSNHDSCFDDPGLWVLLKNRQLCNNSKMRWSMAAHDICFTQTSHSYFFMLGKCVPVVRGAGIYQIPR

cccccccccccccccHHHHHcccccEEEEEcccccccHHHHHHHHHHccccccEEEccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccccEEEcccccccccccEEEEccccccccccccccccccccHHccccHHHHHHcccCEEEEEcccccccccc

*RWSMAAHDICFTQTSHSYFFMLGKCVPVVRGAGIYQPCGQRLMIRSFVSKSSLQFHPKPIKSFVMVR***********HYRDYGTLKTGL****GSKLLPKIDWIFPILQEKSSSYFWYIASTITVAAVGIVSKWFLTWFNKVHCHNAKQLQSAFDSRPPHVPLLTVSNHDSCFDDPGLWVLLKNRQLCNNSKMRWSMAAHDICFTQTSHSYFFMLGKCVPVVRGAGIYQI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007006 [BP]	mitochondrial membrane organization	probable	GO:0006996, GO:0016044, GO:0071840, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0044699, GO:0008150, GO:0007005
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0032577 [MF]	phosphatidylcholine:cardiolipin O-linoleoyltransferase activity	probable	GO:0003824, GO:0032576, GO:0016740, GO:0016746, GO:0016747, GO:0008374, GO:0003674
GO:0032048 [BP]	cardiolipin metabolic process	probable	GO:0044238, GO:0006644, GO:0006650, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0046486, GO:0046471, GO:0044255, GO:0006629

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:probable
Coverage over the Query: 126-223
View the alignment between query and template
View the model in PyMOL