Diaphorina citri psyllid: psy8442

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
METVLPNEPSYYLRSGMETVLPNEPLYYLRSGMETVLPNEPSYYLRSGMETVLPNEPPYYLRRGKTLTFHVGDPIDLAPILTDLRAANLSDREVRAALTQFIQDELYALKARTEDLHAAHLKEDARMPKG
ccccccccccEEEccccCECccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEEccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
******NEPSYYLRSGMETVLPNEPLYYLRSGMETVLPNEPSYYLRSGMETVLPNEPPYYLRRGKTLTFHVGDPIDLAPILTDLRAANLSDREVRAALTQFIQDELYALKARTE****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METVLPNEPSYYLRSGMETVLPNEPLYYLRSGMETVLPNEPSYYLRSGMETVLPNEPPYYLRRGKTLTFHVGDPIDLAPILTDLRAANLSDREVRAALTQFIQDELYALKARTEDLHAAHLKEDARMPKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tafazzin Some isoforms may be involved in cardiolipin metabolism.confidentQ6IV77

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:probable
Coverage over the Query: 12-125
View the alignment between query and template
View the model in PyMOL