RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8455
         (101 letters)



>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor
           protein C (SHC).  SHC is involved in a wide variety of
           pathways including regulating proliferation,
           angiogenesis, invasion and metastasis, and bone
           metabolism. An adapter protein, SHC has been implicated
           in Ras activation following the stimulation of a number
           of different receptors, including growth factors
           [insulin, epidermal growth factor (EGF), nerve growth
           factor, and platelet derived growth factor (PDGF)],
           cytokines [interleukins 2, 3, and 5], erythropoietin,
           and granulocyte/macrophage colony-stimulating factor,
           and antigens [T-cell and B-cell receptors]. SHC has been
           shown to bind to tyrosine-phosphorylated receptors, and
           receptor stimulation leads to tyrosine phosphorylation
           of SHC. Upon phosphorylation, SHC interacts with another
           adapter protein, Grb2, which binds to the Ras GTP/GDP
           exchange factor mSOS which leads to Ras activation. SHC
           is composed of an N-terminal domain that interacts with
           proteins containing phosphorylated tyrosines, a
           (glycine/proline)-rich collagen-homology domain that
           contains the phosphorylated binding site, and a
           C-terminal SH2 domain. SH2 has been shown to interact
           with the tyrosine-phosphorylated receptors of EGF and
           PDGF and with the tyrosine-phosphorylated C chain of the
           T-cell receptor, providing one of the mechanisms of
           T-cell-mediated Ras activation. In general SH2 domains
           are involved in signal transduction.  They typically
           bind pTyr-containing ligands via two surface pockets, a
           pTyr and hydrophobic binding pocket, allowing proteins
           with SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 104

 Score =  140 bits (354), Expect = 7e-45
 Identities = 56/77 (72%), Positives = 62/77 (80%)

Query: 12  RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
           + DGDFLVRES  +PGQYVLTG Q G  KHLLL+DPEGVVRTKDR+FES+SHL+NYH  N
Sbjct: 24  QTDGDFLVRESTTTPGQYVLTGMQNGQPKHLLLVDPEGVVRTKDRVFESISHLINYHVTN 83

Query: 72  QLPIISAESALILRNPV 88
            LPIIS  S L LR PV
Sbjct: 84  GLPIISEGSELHLRRPV 100


>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains.  Src homology 2 domains
          bind phosphotyrosine-containing polypeptides via 2
          surface pockets. Specificity is provided via
          interaction with residues that are distinct from the
          phosphotyrosine. Only a single occurrence of a SH2
          domain has been found in S. cerevisiae.
          Length = 84

 Score = 57.2 bits (139), Expect = 2e-12
 Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI-DPEGVVRTKDRM-FESVSHLVNYHCQN 71
          DGDFLVR+S+ SPG YVL+    G  KH  +  + +G    +    F S+  LV ++ +N
Sbjct: 22 DGDFLVRDSESSPGDYVLSVRVKGKVKHYRIRRNEDGKFYLEGGRKFPSLVELVEHYQKN 81

Query: 72 QLP 74
           L 
Sbjct: 82 SLG 84


>gnl|CDD|215658 pfam00017, SH2, SH2 domain. 
          Length = 77

 Score = 54.9 bits (133), Expect = 1e-11
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI--DPEGVVRTKDRMFESVSHLVNYH 68
           DG FLVRES+  PG Y L+    G  KH  +   D  G   +    F S+  LV ++
Sbjct: 20 PDGTFLVRESESKPGDYTLSVRDDGRVKHYRIQSLDNGGYYISGGVTFNSLPELVEHY 77


>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in
          feline sarcoma, Fujinami poultry sarcoma, and
          fes-related (Fes/Fps/Fer) proteins.  The Fps family
          consists of members Fps/Fes and Fer/Flk/Tyk3. They are
          cytoplasmic protein-tyrosine kinases implicated in
          signaling downstream from cytokines, growth factors and
          immune receptors.  Fes/Fps/Fer contains three
          coiled-coil regions, an SH2 (Src-homology-2) and a TK
          (tyrosine kinase catalytic) domain signature. Members
          here include: Fps/Fes, Fer, Kin-31, and  In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 90

 Score = 52.1 bits (126), Expect = 2e-10
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 12 RQDGDFLVRESQ---GSPGQYVLTGYQGGTKKHLLL-IDPEGVVRTKDRMFESVSHLVNY 67
          + DGDFLVR+++   G   + VL+    G  +H ++  D  G    + + F+S+S L+NY
Sbjct: 23 KNDGDFLVRKTEPKGGGKRKLVLSVRWDGKIRHFVINRDDGGKYYIEGKSFKSISELINY 82

Query: 68 HCQNQLPI 75
          + + + PI
Sbjct: 83 YQKTKEPI 90


>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast
           Cancer Anti-estrogen Resistance protein 3.  BCAR3 is
           part of a growing family of guanine nucleotide exchange
           factors is responsible for activation of Ras-family
           GTPases, including Sos1 and 2, GRF1 and 2,
           CalDAG-GEF/GRP1-4, C3G, cAMP-GEF/Epac 1 and 2, PDZ-GEFs,
           MR-GEF, RalGDS family members, RalGPS, RasGEF, Smg GDS,
           and phospholipase C(epsilon). 12102558  21262352  BCAR3
           binds to the carboxy-terminus of BCAR1/p130Cas, a focal
           adhesion adapter protein.  Over expression of BCAR1
           (p130Cas) and BCAR3 induces estrogen independent growth
           in normally estrogen-dependent cell lines. They have
           been linked to resistance to anti-estrogens in breast
           cancer, Rac activation, and cell motility, though the
           BCAR3/p130Cas complex is not required for this activity
           in BCAR3.  Many BCAR3-mediated signaling events in
           epithelial and mesenchymal cells are independent of
           p130Cas association. Structurally these proteins contain
           a single SH2 domain upstream of their RasGEF domain,
           which is responsible for the ability of BCAR3 to enhance
           p130Cas over-expression-induced migration. In general
           SH2 domains are involved in signal transduction. They
           typically bind pTyr-containing ligands via two surface
           pockets, a pTyr and hydrophobic binding pocket, allowing
           proteins with SH2 domains to localize to tyrosine
           phosphorylated sites.
          Length = 136

 Score = 51.2 bits (123), Expect = 1e-09
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 10/86 (11%)

Query: 12  RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI-----DPEGVVRT----KDRMFESVS 62
           +++GDFLVR+S  SPG YVLT    G   H  +        E   R     +D  F+S+ 
Sbjct: 23  QREGDFLVRDSLSSPGDYVLTCRWKGQPLHFKINRVVLRPSEAYTRVQYQFEDEQFDSIP 82

Query: 63  HLVNYHCQNQLPIISAESALILRNPV 88
            LV+++  N+ PI  A  A+I R PV
Sbjct: 83  ALVHFYVGNRRPISQASGAIISR-PV 107


>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain.  In general, SH2
          domains are involved in signal transduction; they bind
          pTyr-containing polypeptide ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites. They are present in a
          wide array of proteins including: adaptor proteins
          (Nck1, Crk, Grb2), scaffolds (Slp76, Shc, Dapp1),
          kinases (Src, Syk, Fps, Tec), phosphatases (Shp-1,
          Shp-2), transcription factors (STAT1),  Ras signaling
          molecules (Ras-Gap), ubiquitination factors (c-Cbl),
          cytoskeleton regulators (Tensin), signal regulators
          (SAP), and phospholipid second messengers (PLCgamma),
          amongst others.
          Length = 79

 Score = 48.6 bits (116), Expect = 4e-09
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 11 SRQDGDFLVRESQGSPGQYVLT-GYQGGTKKHLLLIDPEG---VVRTKDRMFESVSHLVN 66
           + DG FLVRES   PG YVL+     G  KH L+   EG   ++    R F S+  LV 
Sbjct: 18 GKPDGTFLVRESSSEPGDYVLSVRSGDGKVKHYLIERNEGGYYLLGGSGRTFPSLPELVE 77

Query: 67 YH 68
          ++
Sbjct: 78 HY 79


>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the
          Fyn-related kinase (Frk).  Frk is a member of the Src
          non-receptor type tyrosine kinase family of proteins.
          The Frk subfamily is composed of Frk/Rak and
          Iyk/Bsk/Gst. It is expressed primarily epithelial
          cells.  Frk is a nuclear protein and may function
          during G1 and S phase of the cell cycle and suppress
          growth. Unlike the other Src members it lacks a glycine
          at position 2 of SH4 which is important for addition of
          a myristic acid moiety that is involved in targeting
          Src PTKs to cellular membranes. FRK and SHB exert
          similar effects when overexpressed in rat
          phaeochromocytoma (PC12) and beta-cells, where both
          induce PC12 cell differentiation and beta-cell
          proliferation. Under conditions that cause beta-cell
          degeneration these proteins augment beta-cell
          apoptosis. The FRK-SHB responses involve FAK and
          insulin receptor substrates (IRS) -1 and -2. Frk has
          been demonstrated to interact with retinoblastoma
          protein. Frk regulates PTEN protein stability by
          phosphorylating PTEN, which in turn prevents PTEN
          degradation. Frk also plays a role in regulation of
          embryonal pancreatic beta cell formation. Frk has a
          unique N-terminal domain, an SH3 domain, an SH2 domain,
          a kinase domain and a regulatory tail, as do the other
          members of the family.  Like the other members of the
          Src family the SH2 domain in addition to binding the
          target, also plays an autoinhibitory role by binding to
          its activation loop. The tryosine involved is at the
          same site as the tyrosine involved in the
          autophosphorylation of Src. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 96

 Score = 44.9 bits (106), Expect = 2e-07
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 9  FPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLL--IDPEGVVRTKDRMFESVSHLVN 66
          +   Q G FL+RES+   G++ L+   GG  KH  +  +D  G   T+ + F +++  VN
Sbjct: 21 YSENQTGAFLIRESESQKGEFSLSVLDGGVVKHYRIRRLDEGGFFLTRRKTFSTLNEFVN 80

Query: 67 YHCQN 71
          Y+   
Sbjct: 81 YYTTT 85


>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson
          murine lymphosarcoma virus (ABL) proteins.  ABL-family
          proteins are highly conserved tyrosine kinases. Each
          ABL protein contains an SH3-SH2-TK (Src homology 3-Src
          homology 2-tyrosine kinase) domain cassette, which
          confers autoregulated kinase activity and is common
          among nonreceptor tyrosine kinases. Several types of
          posttranslational modifications control ABL catalytic
          activity, subcellular localization, and stability, with
          consequences for both cytoplasmic and nuclear ABL
          functions. Binding partners provide additional
          regulation of ABL catalytic activity, substrate
          specificity, and downstream signaling. By combining
          this cassette with actin-binding and -bundling domain,
          ABL proteins are capable of connecting
          phosphoregulation with actin-filament reorganization.
          Vertebrate paralogs, ABL1 and ABL2, have evolved to
          perform specialized functions. ABL1 includes nuclear
          localization signals and a DNA binding domain which is
          used to mediate DNA damage-repair functions, while ABL2
          has additional binding capacity for actin and for
          microtubules to enhance its cytoskeletal remodeling
          functions.  SH2 is involved in several autoinhibitory
          mechanism that constrain the enzymatic activity of the
          ABL-family kinases. In one mechanism SH2 and SH3 cradle
          the kinase domain while a cap sequence stabilizes the
          inactive conformation resulting in a locked inactive
          state. Another involves phosphatidylinositol
          4,5-bisphosphate (PIP2) which binds the SH2 domain
          through residues normally required for phosphotyrosine
          binding in the linker segment between the SH2 and
          kinase domains. The SH2 domain contributes to ABL
          catalytic activity and target site specificity. It is
          thought that the ABL catalytic site and SH2 pocket have
          coevolved to recognize the same sequences. Recent work
          now supports a hierarchical processivity model in which
          the substrate target site most compatible with ABL
          kinase domain preferences is phosphorylated with
          greatest efficiency. If this site is compatible with
          the ABL SH2 domain specificity, it will then reposition
          and dock in the SH2 pocket. This mechanism also
          explains how ABL kinases phosphorylates poor targets on
          the same substrate if they are properly positioned and
          how relatively poor substrate proteins might be
          recruited to ABL through a complex with strong
          substrates that can also dock with the SH2 pocket. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 94

 Score = 44.3 bits (105), Expect = 3e-07
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 14 DGDFLVRESQGSPGQYVLT-GYQGGTKKHLLLIDPEGVVR-TKDRMFESVSHLVNYHCQN 71
          +G FLVRES+ SPGQY ++  Y G    + +  D +G V  T++  F +++ LV++H +N
Sbjct: 24 NGSFLVRESESSPGQYSISLRYDGRVYHYRISEDSDGKVYVTQEHRFNTLAELVHHHSKN 83


>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2)
          domain found in SH2 domain Phosphatases (SHP) proteins.
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
          Drosophila corkscrew (csw), and Caenorhabditis elegans
          Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
          signaling enzymes. They are both targeted and regulated
          by interactions of their SH2 domains with
          phosphotyrosine docking sites. These proteins contain
          two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
          phosphatase (PTP) domain, and a C-terminal extension.
          Shp1 and Shp2 have two tyrosyl phosphorylation sites in
          their C-tails, which are phosphorylated differentially
          by receptor and nonreceptor PTKs. Csw retains the
          proximal tyrosine and Ptp-2 lacks both sites.
          Shp-binding proteins include receptors, scaffolding
          adapters, and inhibitory receptors. Some of these bind
          both Shp1 and Shp2 while others bind only one. Most
          proteins that bind a Shp SH2 domain contain one or more
          immuno-receptor tyrosine-based inhibitory motifs
          (ITIMs): [SIVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks
          the catalytic domain and keeps the enzyme in the
          inactive conformation, and is thus believed to regulate
          the phosphatase activity of SHP-1. Its C-SH2 domain is
          thought to be involved in searching for phosphotyrosine
          activators.  The SHP2 N-SH2 domain is a conformational
          switch; it either binds and inhibits the phosphatase,
          or it binds phosphoproteins and activates the enzyme.
          The C-SH2 domain contributes binding energy and
          specificity, but it does not have a direct role in
          activation. Csw SH2 domain function is essential, but
          either SH2 domain can fulfill this requirement. The
          role of the csw SH2 domains during Sevenless receptor
          tyrosine kinase (SEV) signaling is to bind Daughter of
          Sevenless rather than activated SEV. Ptp-2 acts in
          oocytes downstream of sheath/oocyte gap junctions to
          promote major sperm protein (MSP)-induced MAP Kinase
          (MPK-1) phosphorylation. Ptp-2 functions in the oocyte
          cytoplasm, not at the cell surface to inhibit multiple
          RasGAPs, resulting in sustained Ras activation. It is
          thought that MSP triggers PTP-2/Ras activation and ROS
          production to stimulate MPK-1 activity essential for
          oocyte maturation and that secreted MSP domains and
          Cu/Zn superoxide dismutases function antagonistically
          to control ROS and MAPK signaling. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 99

 Score = 43.4 bits (103), Expect = 6e-07
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRT---KDRMFESVSHLVNYHC 69
          + G FLVRESQ  PG +VL+      K   ++I  +G        +  F+S++ LV ++ 
Sbjct: 21 KPGSFLVRESQSKPGDFVLSVRTDDDKVTHIMIRCQGGKYDVGGGEE-FDSLTDLVEHYK 79

Query: 70 QNQLPIISAESALI-LRNPV 88
          +N  P++     ++ L+ P+
Sbjct: 80 KN--PMVETSGTVVHLKQPL 97


>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the
          Vav family.  Vav proteins are involved in several
          processes that require cytoskeletal reorganization,
          such as the formation of the immunological synapse
          (IS), phagocytosis, platelet aggregation, spreading,
          and transformation.  Vavs function as guanine
          nucleotide exchange factors (GEFs) for the Rho/Rac
          family of GTPases.  Vav family members have several
          conserved motifs/domains including: a leucine-rich
          region, a leucine-zipper, a calponin homology (CH)
          domain, an acidic domain, a Dbl-homology (DH) domain, a
          pleckstrin homology (PH) domain, a cysteine-rich
          domain, 2 SH3 domains,  a proline-rich region, and a
          SH2 domain.  Vavs are the only known Rho GEFs that have
          both the DH/PH motifs and SH2/SH3 domains in the same
          protein. The leucine-rich helix-loop-helix (HLH) domain
          is thought to be involved in protein heterodimerization
          with other HLH proteins and it may function as a
          negative regulator by forming inactive heterodimers.
          The CH domain  is usually involved in the association
          with filamentous actin, but in Vav it controls NFAT
          stimulation, Ca2+ mobilization, and its transforming
          activity. Acidic domains are involved in
          protein-protein interactions and contain regulatory
          tyrosines. The DH domain is a GDP-GTP exchange factor
          on Rho/Rac GTPases. The PH domain in involved in
          interactions with GTP-binding proteins, lipids and/or
          phosphorylated serine/threonine residues. The SH3
          domain is involved in localization of proteins to
          specific sites within the cell interacting with protein
          with proline-rich sequences.  The SH2 domain mediates a
          high affinity interaction with tyrosine phosphorylated
          proteins.  There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, Vav2 and Vav3 are more ubiquitously expressed.
          The members here include insect and amphibian Vavs. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 102

 Score = 41.1 bits (97), Expect = 5e-06
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 11 SRQDGDFLVRESQGSPGQYVLTGYQGGTKKHL-LLIDPEGVVR-TKDRMFESVSHLVNYH 68
          +R DG +LVR       QY L+    G  KH+ +    +G+   ++ R F+S+  LVNY+
Sbjct: 23 NRPDGTYLVRVRPQGETQYALSIKYNGDVKHMKIEQRSDGLYYLSESRHFKSLVELVNYY 82

Query: 69 CQNQL 73
           +N L
Sbjct: 83 ERNSL 87


>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in
          SH2B adapter protein family.  The SH2B adapter protein
          family  has 3 members:  SH2B1 (SH2-B, PSM), SH2B2
          (APS), and SH2B3 (Lnk). SH2B family members contain a
          pleckstrin homology domain, at least one dimerization
          domain, and a C-terminal SH2 domain which binds to
          phosphorylated tyrosines in a variety of tyrosine
          kinases.  SH2B1 and SH2B2  function in signaling
          pathways found downstream of growth hormone receptor
          and receptor tyrosine kinases, including the insulin,
          insulin-like growth factor-I (IGF-I), platelet-derived
          growth factor (PDGF), nerve growth factor, hepatocyte
          growth factor, and fibroblast growth factor receptors.
          SH2B2beta, a new isoform of SH2B2, is an endogenous
          inhibitor of SH2B1 and/or SH2B2 (SH2B2alpha),
          negatively regulating insulin signaling and/or
          JAK2-mediated cellular responses. SH2B3 negatively
          regulates lymphopoiesis and early hematopoiesis. The
          lnk-deficiency results in enhanced production of B
          cells, and expansion as well as enhanced function of
          hematopoietic stem cells (HSCs), demonstrating negative
          regulatory functions of Sh2b3/Lnk in cytokine
          signaling. Sh2b3/Lnk also functions in responses
          controlled by cell adhesion and in crosstalk between
          integrin- and cytokine-mediated signaling. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 40.9 bits (96), Expect = 6e-06
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 15 GDFLVRESQGSPGQYVLTGYQGGTKKHL-LLIDPEGVVRTKDRMFESVSHLVNYHCQNQL 73
          G FLVR+S+   G++VLT    G  KHL L ++ +G  R +   F S+  ++ +  QN +
Sbjct: 33 GVFLVRQSETRRGEFVLTFNFQGRAKHLRLTLNEKGQCRVQHLWFPSIFDMLEHFRQNPI 92

Query: 74 PIIS 77
          P+ S
Sbjct: 93 PLES 96


>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the
          Nck family.  Nck proteins are adaptors that modulate
          actin cytoskeleton dynamics by linking proline-rich
          effector molecules to tyrosine kinases or
          phosphorylated signaling intermediates. There are two
          members known in this family: Nck1 (Nckalpha) and Nck2
          (Nckbeta and Growth factor receptor-bound protein 4
          (Grb4)).  They are characterized by having 3 SH3
          domains and a C-terminal SH2 domain. Nck1 and Nck2 have
          overlapping functions as determined by gene knockouts.
          Both bind receptor tyrosine kinases and other
          tyrosine-phosphorylated proteins through their SH2
          domains. In addition they also bind distinct targets.
          Neuronal signaling proteins: EphrinB1, EphrinB2, and
          Disabled-1 (Dab-1) all bind to Nck-2 exclusively. And
          in the case of PDGFR, Tyr(P)751 binds to  Nck1 while
          Tyr(P)1009 binds to Nck2. Nck1 and Nck2 have a role in
          the infection process of enteropathogenic Escherichia
          coli (EPEC). Their SH3 domains are involved in
          recruiting and activating the N-WASP/Arp2/3 complex
          inducing actin polymerization resulting in the
          production of pedestals, dynamic bacteria-presenting
          protrusions of the plasma membrane. A similar thing
          occurs in the vaccinia virus where motile plasma
          membrane projections are formed beneath the virus.
          Recently it has been shown that the SH2 domains of both
          Nck1 and Nck2 bind the G-protein coupled receptor
          kinase-interacting protein 1 (GIT1) in a
          phosphorylation-dependent manner. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 93

 Score = 40.2 bits (94), Expect = 9e-06
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQL 73
          +GDFL+R+S+ +PG Y ++    G  KH  +   + V     R F ++  LV ++   + 
Sbjct: 23 EGDFLIRDSESNPGDYSVSLKAPGRNKHFKVQVVDNVYCIGQRKFHTMDELVEHY--KKA 80

Query: 74 PIISAE 79
          PI ++E
Sbjct: 81 PIFTSE 86


>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain
           found in p85.  Phosphoinositide 3-kinases (PI3Ks) are
           essential for cell growth, migration, and survival.
           p110, the catalytic subunit, is composed of an
           adaptor-binding domain, a Ras-binding domain, a C2
           domain, a helical domain, and a kinase domain.  The
           regulatory unit is called p85 and is composed of an SH3
           domain, a RhoGap domain, a N-terminal SH2 (nSH2) domain,
           an internal SH2 (iSH2) domain, and C-terminal (cSH2)
           domain.  There are 2 inhibitory interactions between
           p110alpha and p85 of P13K: (1) p85 nSH2 domain with the
           C2, helical, and kinase domains of p110alpha and (2) p85
           iSH2 domain with C2 domain of p110alpha. There are 3
           inhibitory interactions between p110beta and p85 of
           P13K: (1) p85 nSH2 domain with the C2, helical, and
           kinase domains of p110beta, (2) p85 iSH2 domain with C2
           domain of p110alpha, and (3) p85 cSH2 domain with the
           kinase domain of p110alpha. It is interesting to note
           that p110beta is oncogenic as a wild type protein while
           p110alpha lacks this ability. One explanation is the
           idea that the regulation of p110beta by p85 is unique
           because of the addition of inhibitory contacts from the
           cSH2 domain and the loss of contacts in the iSH2 domain.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 110

 Score = 40.8 bits (96), Expect = 9e-06
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 14  DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRM-FESVSHLVNYHCQNQ 72
           DG FLVR++    G Y LT  +GG  K + +   +G     D + F SV  L+NY+  N 
Sbjct: 28  DGTFLVRDASTMKGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINYYRNNS 87

Query: 73  LPIISAESALILRNPVAK 90
           L   + +  + L  PV++
Sbjct: 88  LAEYNRKLDVKLLYPVSR 105


>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain
          found in alpha2-chimerin and beta2-chimerin proteins.
          Chimerins are a family of phorbol ester- and
          diacylglycerol-responsive GTPase-activating proteins.
          Alpha1-chimerin (formerly known as n-chimerin) and
          alpha2-chimerin are alternatively spliced products of a
          single gene, as are beta1- and beta2-chimerin. alpha1-
          and beta1-chimerin have a relatively short N-terminal
          region that does not encode any recognizable domains,
          whereas alpha2- and beta2-chimerin both include a
          functional SH2 domain that can bind to phosphotyrosine
          motifs within receptors. All of the isoforms contain a
          GAP domain with specificity in vitro for Rac1 and a
          diacylglycerol (DAG)-binding C1 domain which allows
          them to translocate to membranes in response to DAG
          signaling and anchors them in close proximity to
          activated Rac. Other C1 domain-containing
          diacylglycerol receptors including: PKC, Munc-13
          proteins, phorbol ester binding scaffolding proteins
          involved in Ca2+-stimulated exocytosis, and RasGRPs,
          diacylglycerol-activated guanine-nucleotide exchange
          factors (GEFs) for Ras and Rap1. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 91

 Score = 39.3 bits (92), Expect = 2e-05
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 13 QDGDFLVRESQGSPGQYVLT-GYQGGTKKHLLLIDPEGVV-RTKDRMFESVSHLV 65
           DG +L+RES    G Y L+  + G  K + L  D +       ++ F+++  LV
Sbjct: 26 SDGSYLIRESSRDDGYYTLSLRFNGKVKNYKLYYDGKNHYHYVGEKRFDTIHDLV 80


>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth
          factor receptor-bound protein 2 (Grb2) and similar
          proteins.  The adaptor proteins here include homologs
          Grb2 in humans, Sex muscle abnormal protein 5 (Sem-5)
          in Caenorhabditis elegans, and Downstream of receptor
          kinase (drk) in Drosophila melanogaster. They are
          composed of one SH2 and two SH3 domains. Grb2/Sem-5/drk
          regulates the Ras pathway by linking the tyrosine
          kinases to the Ras guanine nucleotide releasing protein
          Sos, which converts Ras to the active GTP-bound state.
          The SH2 domain of Grb2/Sem-5/drk binds class II
          phosphotyrosyl peptides while its SH3 domain binds to
          Sos and Sos-derived, proline-rich peptides. Besides it
          function in Ras signaling, Grb2 is also thought to play
          a role in apoptosis. Unlike most SH2 structures in
          which the peptide binds in an extended conformation
          (such that the +3 peptide residue occupies a
          hydrophobic pocket in the protein, conferring a modest
          degree of selectivity), Grb2 forms several hydrogen
          bonds via main chain atoms with the side chain of +2
          Asn. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 95

 Score = 38.8 bits (91), Expect = 4e-05
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHL-LLIDPEGVVRTKDRMFESVSHLVNYHCQ 70
          R DG FL+RES+ SPG + L+   G   +H  +L D  G        F S++ LV+YH  
Sbjct: 23 RPDGAFLIRESESSPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRT 82

Query: 71 NQLPIISAESALILR 85
               +S    + LR
Sbjct: 83 TS---VSRNQQIFLR 94


>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in
          SH2 domain-containing adapter proteins B, D, E, and F
          (SHB, SHD, SHE, SHF).  SHB, SHD, SHE, and SHF are SH2
          domain-containing proteins that play various roles
          throughout the cell.  SHB functions in generating
          signaling compounds in response to tyrosine kinase
          activation. SHB contains proline-rich motifs, a
          phosphotyrosine binding (PTB) domain, tyrosine
          phosphorylation sites, and a SH2 domain. SHB mediates
          certain aspects of platelet-derived growth factor
          (PDGF) receptor-, fibroblast growth factor (FGF)
          receptor-, neural growth factor (NGF) receptor TRKA-, T
          cell receptor-, interleukin-2 (IL-2) receptor- and
          focal adhesion kinase- (FAK) signaling. SRC-like
          FYN-Related Kinase FRK/RAK (also named BSK/IYK or GTK)
          and SHB regulate apoptosis, proliferation and
          differentiation. SHB promotes apoptosis and is also
          required for proper mitogenicity, spreading and tubular
          morphogenesis in endothelial cells. SHB also plays a
          role in preventing early cavitation of embryoid bodies
          and reduces differentiation to cells expressing
          albumin, amylase, insulin and glucagon. SHB is a
          multifunctional protein that has difference responses
          in different cells under various conditions. SHE is
          expressed in heart, lung, brain, and skeletal muscle,
          while expression of SHD is restricted to the brain. SHF
          is mainly expressed in skeletal muscle, brain, liver,
          prostate, testis, ovary, small intestine, and colon.
          SHD may be a physiological substrate of c-Abl and may
          function as an adapter protein in the central nervous
          system. It is also thought to be involved in apoptotic
          regulation.  SHD contains five YXXP motifs, a substrate
          sequence preferred by Abl tyrosine kinases, in addition
          to a poly-proline rich region and a C-terminal SH2
          domain. SHE contains two pTry protein binding domains,
          protein interaction domain (PID) and a SH2 domain,
          followed by a glycine-proline rich region, all of which
          are N-terminal to the phosphotyrosine binding (PTB)
          domain. SHF contains  four putative tyrosine
          phosphorylation sites and an SH2 domain. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 98

 Score = 38.2 bits (89), Expect = 6e-05
 Identities = 24/94 (25%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 1  MSRI-AKTAFPSRQDGDFLVRESQGSPGQYVLT--GYQGGTKKHLLLI---DPEGVVRTK 54
          ++RI A++     ++G +LVR S+ +   Y L+    +G    H+ +      + ++   
Sbjct: 8  ITRIEAESLLRPCKEGSYLVRNSESTKQDYSLSLKSAKGFM--HMRIQRNETGQYILGQF 65

Query: 55 DRMFESVSHLVNYHCQNQLPIISAESALILRNPV 88
           R FE++  ++ ++C N+LP+  AE   +L  PV
Sbjct: 66 SRPFETIPEMIRHYCLNKLPVRGAEHMCLLE-PV 98


>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in
          the growth factor receptor bound, subclass 7 (Grb7)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          There are 3 members of the Grb7 family of proteins:
          Grb7, Grb10, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb7
          binds strongly to the erbB2 receptor, unlike Grb10 and
          Grb14 which bind weakly to it. Grb14 binds to
          Fibroblast Growth Factor Receptor (FGFR). Grb10 has
          been shown to interact with many different proteins,
          including the insulin and IGF1 receptors,
          platelet-derived growth factor (PDGF) receptor-beta,
          Ret, Kit, Raf1 and MEK1, and Nedd4.  Grb7 family
          proteins are phosphorylated on serine/threonine as well
          as tyrosine residues. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 108

 Score = 38.2 bits (89), Expect = 7e-05
 Identities = 26/69 (37%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI---DPEGVVRTKDR---MFESVSHLVNY 67
          DG FLVRESQ +PG +VL+   G   KH  +I   D      T D     F  +  LV +
Sbjct: 28 DGVFLVRESQSNPGAFVLSLKHGQKIKHYQIIPIEDEGQWYFTLDDGVTKFYDLLQLVEF 87

Query: 68 HCQNQ--LP 74
          +  N   LP
Sbjct: 88 YQLNAGSLP 96


>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck.  Nck
          proteins are adaptors that modulate actin cytoskeleton
          dynamics by linking proline-rich effector molecules to
          tyrosine kinases or phosphorylated signaling
          intermediates.  There are two members known in this
          family: Nck1 (Nckalpha) and Nck2 (Nckbeta and Growth
          factor receptor-bound protein 4 (Grb4)).  They are
          characterized by having 3 SH3 domains and a C-terminal
          SH2 domain. Nck1 and Nck2 have overlapping functions as
          determined by gene knockouts. Both bind receptor
          tyrosine kinases and other tyrosine-phosphorylated
          proteins through their SH2 domains. In addition they
          also bind distinct targets.  Neuronal signaling
          proteins: EphrinB1, EphrinB2, and Disabled-1 (Dab-1)
          all bind to Nck-2 exclusively. And in the case of
          PDGFR, Tyr(P)751 binds to  Nck1 while Tyr(P)1009 binds
          to Nck2. Nck1 and Nck2 have a role in the infection
          process of enteropathogenic Escherichia coli (EPEC).
          Their SH3 domains are involved in recruiting and
          activating the N-WASP/Arp2/3 complex inducing actin
          polymerization resulting in the production of
          pedestals, dynamic bacteria-presenting protrusions of
          the plasma membrane. A similar thing occurs in the
          vaccinia virus where motile plasma membrane projections
          are formed beneath the virus.  Recently it has been
          shown that the SH2 domains of both Nck1 and Nck2 bind
          the G-protein coupled receptor kinase-interacting
          protein 1 (GIT1) in a phosphorylation-dependent manner.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 38.1 bits (88), Expect = 8e-05
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQL 73
          +GDFL+R+S+ SP  + ++    G  KH  +   + V     R F S+  LV ++   + 
Sbjct: 23 EGDFLIRDSESSPSDFSVSLKAVGKNKHFKVQLVDNVYCIGQRRFNSMDELVEHY--KKA 80

Query: 74 PIISAE 79
          PI ++E
Sbjct: 81 PIFTSE 86


>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1
          proteins.  Proto-oncogene vav is a member of the Dbl
          family of guanine nucleotide exchange factors (GEF) for
          the Rho family of GTP binding proteins.  All vavs are
          activated by tyrosine phosphorylation leading to their
          activation. There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, and Vav2 and Vav3 are more ubiquitously
          expressed. Vav1 plays a role in T-cell and B-cell
          development and activation.  It has been identified as
          the specific binding partner of Nef proteins from
          HIV-1, resulting in morphological changes, cytoskeletal
          rearrangements, and the JNK/SAPK signaling cascade,
          leading to increased levels of viral transcription and
          replication. Vav1 has been shown to interact with Ku70,
          PLCG1, Lymphocyte cytosolic protein 2, Janus kinase 2,
          SIAH2, S100B, Abl gene, ARHGDIB, SHB, PIK3R1, PRKCQ,
          Grb2, MAPK1, Syk, Linker of activated T cells, Cbl gene
          and EZH2. Vav proteins are involved in several
          processes that require cytoskeletal reorganization,
          such as the formation of the immunological synapse
          (IS), phagocytosis, platelet aggregation, spreading,
          and transformation.  Vavs function as guanine
          nucleotide exchange factors (GEFs) for the Rho/Rac
          family of GTPases. Vav family members have several
          conserved motifs/domains including: a leucine-rich
          region, a leucine-zipper, a calponin homology (CH)
          domain, an acidic domain, a Dbl-homology (DH) domain, a
          pleckstrin homology (PH) domain, a cysteine-rich
          domain, 2 SH3 domains, a proline-rich region, and a SH2
          domain.  Vavs are the only known Rho GEFs that have
          both the DH/PH motifs and SH2/SH3 domains in the same
          protein. The leucine-rich helix-loop-helix (HLH) domain
          is thought to be involved in protein heterodimerization
          with other HLH proteins and it may function as a
          negative regulator by forming inactive heterodimers.
          The CH domain  is usually involved in the association
          with filamentous actin, but in Vav it controls NFAT
          stimulation, Ca2+ mobilization, and its transforming
          activity. Acidic domains are involved in
          protein-protein interactions and contain regulatory
          tyrosines. The DH domain is a GDP-GTP exchange factor
          on Rho/Rac GTPases. The PH domain in involved in
          interactions with GTP-binding proteins, lipids and/or
          phosphorylated serine/threonine residues.  The SH3
          domain is involved in localization of proteins to
          specific sites within the cell interacting with protein
          with proline-rich sequences. The SH2 domain mediates a
          high affinity interaction with tyrosine phosphorylated
          proteins. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 38.1 bits (88), Expect = 8e-05
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 5  AKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVR-TKDRMFESVSH 63
          A++   +R DG +LVR+      ++ ++       KH+ ++  EG+ R T+ + F  ++ 
Sbjct: 17 AESILANRSDGTYLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTE 76

Query: 64 LVNYHCQNQL 73
          LV ++ QN L
Sbjct: 77 LVEFYQQNSL 86


>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2)
          domain found in SH2 domains, ANK, and kinase domain
          (shark) proteins.  These non-receptor protein-tyrosine
          kinases contain two SH2 domains, five ankyrin
          (ANK)-like repeats, and a potential tyrosine
          phosphorylation site in its carboxyl-terminal tail
          which resembles the phosphorylation site in members of
          the src family. Like, mammalian non-receptor
          protein-tyrosine kinases, ZAP-70 and syk proteins, they
          do not have SH3 domains. However, the presence of ANK
          makes these unique among protein-tyrosine kinases. Both
          tyrosine kinases and ANK repeats have been shown to
          transduce developmental signals, and SH2 domains are
          known to participate intimately in tyrosine kinase
          signaling. These tyrosine kinases are believed to be
          involved in epithelial cell polarity. The members of
          this family include the shark (SH2 domains, ANK, and
          kinase domain) gene in Drosophila and yellow fever
          mosquitos, as well as the hydra protein HTK16.
          Drosophila Shark is proposed to transduce
          intracellularly the Crumbs, a protein necessary for
          proper organization of ectodermal epithelia,
          intercellular signal. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 86

 Score = 37.4 bits (87), Expect = 1e-04
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDR--MFESVSHLVNYHCQ 70
          DG FLVR S+  PG YVLT        H  + + +      D    FES+ HL+ ++ Q
Sbjct: 23 DGSFLVRYSRRRPGGYVLTLVYENHVYHFEIQNRDDKWFYIDDGPYFESLEHLIEHYTQ 81


>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in
           B-cell linker (BLNK) protein and SH2 domain-containing
           leukocyte protein of 76 kDa (SLP-76).  BLNK (also known
           as SLP-65 or BASH) is an important adaptor protein
           expressed in B-lineage cells. BLNK consists of a
           N-terminal sterile alpha motif (SAM) domain and a
           C-terminal SH2 domain.  BLNK is a cytoplasmic protein,
           but a part of it is bound to the plasma membrane through
           an N-terminal leucine zipper motif and transiently bound
           to a cytoplasmic domain of Iga through its C-terminal
           SH2 domain upon B cell antigen receptor
           (BCR)-stimulation. A non-ITAM phosphotyrosine in Iga is
           necessary for the binding with the BLNK SH2 domain
           and/or for normal BLNK function in signaling and B cell
           activation. Upon phosphorylation BLNK binds Btk and
           PLCgamma2 through their SH2 domains and mediates
           PLCgamma2 activation by Btk. BLNK also binds other
           signaling molecules such as Vav, Grb2, Syk, and HPK1.
           BLNK has been shown to be necessary for BCR-mediated
           Ca2+ mobilization, for the activation of
           mitogen-activated protein kinases such as ERK, JNK, and
           p38 in a chicken B cell line DT40, and for activation of
           transcription factors such as NF-AT and NF-kappaB in
           human or mouse B cells. BLNK is involved in B cell
           development, B cell survival, activation, proliferation,
           and T-independent immune responses. BLNK is structurally
           homologous to SLP-76. SLP-76 and (linker for activation
           of T cells) LAT are adaptor/linker proteins in T cell
           antigen receptor activation and T cell development. BLNK
           interacts with many downstream signaling proteins that
           interact directly with both SLP-76 and  LAT.  New data
           suggest functional complementation of SLP-76 and LAT in
           T cell antigen receptor function with BLNK in BCR
           function. In general SH2 domains are involved in signal
           transduction.  They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 121

 Score = 37.7 bits (88), Expect = 1e-04
 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 19/85 (22%)

Query: 11  SRQDGDFLVRESQGSPGQ--YVLT------------GYQGGTKKHLLLIDPEGVVRTKDR 56
           S +DG FLVR+S G      Y L              +   T+++ L     G     + 
Sbjct: 30  SNKDGTFLVRDSSGKDSSQPYTLMVLYNDKVYNIQIRFLENTRQYAL-----GTGLRGEE 84

Query: 57  MFESVSHLVNYHCQNQLPIISAESA 81
            F SV+ ++ +H +  L +I  +  
Sbjct: 85  TFSSVAEIIEHHQKTPLLLIDGKDN 109


>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck.  Nck
          proteins are adaptors that modulate actin cytoskeleton
          dynamics by linking proline-rich effector molecules to
          tyrosine kinases or phosphorylated signaling
          intermediates. There are two members known in this
          family: Nck1 (Nckalpha) and Nck2 (Nckbeta and Growth
          factor receptor-bound protein 4 (Grb4)). They are
          characterized by having 3 SH3 domains and a C-terminal
          SH2 domain. Nck1 and Nck2 have overlapping functions as
          determined by gene knockouts. Both bind receptor
          tyrosine kinases and other tyrosine-phosphorylated
          proteins through their SH2 domains. In addition they
          also bind distinct targets.  Neuronal signaling
          proteins: EphrinB1, EphrinB2, and Disabled-1 (Dab-1)
          all bind to Nck-2 exclusively. And in the case of
          PDGFR, Tyr(P)751 binds to  Nck1 while Tyr(P)1009 binds
          to Nck2. Nck1 and Nck2 have a role in the infection
          process of enteropathogenic Escherichia coli (EPEC).
          Their SH3 domains are involved in recruiting and
          activating the N-WASP/Arp2/3 complex inducing actin
          polymerization resulting in the production of
          pedestals, dynamic bacteria-presenting protrusions of
          the plasma membrane. A similar thing occurs in the
          vaccinia virus where motile plasma membrane projections
          are formed beneath the virus. Recently it has been
          shown that the SH2 domains of both Nck1 and Nck2 bind
          the G-protein coupled receptor kinase-interacting
          protein 1 (GIT1) in a phosphorylation-dependent manner.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 97

 Score = 36.9 bits (85), Expect = 2e-04
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 5  AKTAFPSR-QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSH 63
          A+ A   R  +GDFL+R+S+ SP  + ++    G  KH  +   E V     R F S+  
Sbjct: 13 AEMALNERGNEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKECVYCIGQRKFSSMEE 72

Query: 64 LVNYHCQNQLPIISAE 79
          LV ++   + PI ++E
Sbjct: 73 LVEHY--KKAPIFTSE 86


>gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B1 (SH2-B,
          PSM), like other members of the SH2B adapter protein
          family, contains a pleckstrin homology domain, at least
          one dimerization domain, and a C-terminal SH2 domain
          which binds to phosphorylated tyrosines in a variety of
          tyrosine kinases.  SH2B1 and SH2B2  function in
          signaling pathways found downstream of growth hormone
          receptor and receptor tyrosine kinases, including the
          insulin, insulin-like growth factor-I (IGF-I),
          platelet-derived growth factor (PDGF), nerve growth
          factor, hepatocyte growth factor, and fibroblast growth
          factor receptors. SH2B2beta, a new isoform of SH2B2, is
          an endogenous inhibitor of SH2B1 and/or SH2B2
          (SH2B2alpha), negatively regulating insulin signaling
          and/or JAK2-mediated cellular responses. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 36.5 bits (84), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 15 GDFLVRESQGSPGQYVLT-GYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQL 73
          G FLVR+S+   G+YVLT  +QG  K   L ++ EG  R +   F+S+  ++ +   + +
Sbjct: 33 GVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPI 92

Query: 74 PIISA 78
          P+ S 
Sbjct: 93 PLESG 97


>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B2 (APS),
          like other members of the SH2B adapter protein family,
          contains a pleckstrin homology domain, at least one
          dimerization domain, and a C-terminal SH2 domain which
          binds to phosphorylated tyrosines in a variety of
          tyrosine kinases. SH2B1 and SH2B2  function in
          signaling pathways found downstream of growth hormone
          receptor and receptor tyrosine kinases, including the
          insulin, insulin-like growth factor-I (IGF-I),
          platelet-derived growth factor (PDGF), nerve growth
          factor, hepatocyte growth factor, and fibroblast growth
          factor receptors. SH2B2beta, a new isoform of SH2B2, is
          an endogenous inhibitor of SH2B1 and/or SH2B2
          (SH2B2alpha), negatively regulating insulin signaling
          and/or JAK2-mediated cellular responses. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 36.5 bits (84), Expect = 3e-04
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 11 SRQDGDFLVRESQGSPGQYVLT-GYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHC 69
           R  G F++R+S+  PG+YVLT  +QG  K   L ++  G    +   F+SV  ++ +  
Sbjct: 29 PRSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVFDMLRHFH 88

Query: 70 QNQLPIIS 77
           + +P+ S
Sbjct: 89 THPIPLES 96


>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2
          (C-SH2) domain in Phospholipase C gamma.  Phospholipase
          C gamma is a signaling molecule that is recruited to
          the C-terminal tail of the receptor upon
          autophosphorylation of a highly conserved tyrosine.
          PLCgamma is composed of a Pleckstrin homology (PH)
          domain followed by an elongation factor (EF) domain, 2
          catalytic regions of PLC domains that flank 2 tandem
          SH2 domains (N-SH2, C-SH2), and ending with a SH3
          domain and C2 domain. N-SH2 SH2 domain-mediated
          interactions represent a crucial step in transmembrane
          signaling by receptor tyrosine kinases. SH2 domains
          recognize phosphotyrosine (pY) in the context of
          particular sequence motifs in receptor phosphorylation
          sites. Both N-SH2 and C-SH2 have a very similar binding
          affinity to pY. But in growth factor stimulated cells
          these domains bind to different target proteins. N-SH2
          binds to pY containing sites in the C-terminal tails of
          tyrosine kinases and other receptors. Recently it has
          been shown that this interaction is mediated by
          phosphorylation-independent interactions between a
          secondary binding site found exclusively on the N-SH2
          domain and a region of the FGFR1 tyrosine kinase
          domain. This secondary site on the SH2 cooperates with
          the canonical pY site to regulate selectivity in
          mediating a specific cellular process.  C-SH2 binds to
          an intramolecular site on PLCgamma itself which allows
          it to hydrolyze phosphatidylinositol-4,5-bisphosphate
          into diacylglycerol and inositol triphosphate. These
          then activate protein kinase C and release calcium. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 104

 Score = 36.5 bits (85), Expect = 3e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEG---VVRTKDRMFESVSHLVNYH 68
           +DG FLVR S+  P  + ++    G  KH   I  EG   V+ T    FES+  LV+Y+
Sbjct: 24 PRDGAFLVRPSETDPNSFAISFRAEGKIKH-CRIKQEGRLFVIGTSQ--FESLVELVSYY 80

Query: 69 CQNQL 73
           ++ L
Sbjct: 81 EKHPL 85


>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain
          found in Ras GTPase-activating protein 1 (GAP).  RasGAP
          is part of the GAP1 family of GTPase-activating
          proteins. The protein is located in the cytoplasm and
          stimulates the GTPase activity of normal RAS p21, but
          not its oncogenic counterpart. Acting as a suppressor
          of RAS function, the protein enhances the weak
          intrinsic GTPase activity of RAS proteins resulting in
          RAS inactivation, thereby allowing control of cellular
          proliferation and differentiation. Mutations leading to
          changes in the binding sites of either protein are
          associated with basal cell carcinomas. Alternative
          splicing results in two isoforms. The shorter isoform
          which lacks the N-terminal hydrophobic region, has the
          same activity, and is expressed in placental tissues.
          In general the longer isoform contains 2 SH2 domains, a
          SH3 domain, a pleckstrin homology (PH) domain, and a
          calcium-dependent phospholipid-binding C2 domain. The
          C-terminus contains the catalytic domain of RasGap
          which catalyzes the activation of Ras by hydrolyzing
          GTP-bound active Ras into an inactive GDP-bound form of
          Ras. This model contains the N-terminal SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 36.0 bits (83), Expect = 4e-04
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 11 SRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYH 68
          + + G +L+RES   PG +VL+        H  +I   G      R F S+S L+ Y+
Sbjct: 38 AGKLGSYLIRESDRRPGSFVLSFLSRTGVNHFRIIAMCGDYYIGGRRFSSLSDLIGYY 95


>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain
          found in Ras GTPase-activating protein 1 (GAP).  RasGAP
          is part of the GAP1 family of GTPase-activating
          proteins. The protein is located in the cytoplasm and
          stimulates the GTPase activity of normal RAS p21, but
          not its oncogenic counterpart. Acting as a suppressor
          of RAS function, the protein enhances the weak
          intrinsic GTPase activity of RAS proteins resulting in
          RAS inactivation, thereby allowing control of cellular
          proliferation and differentiation. Mutations leading to
          changes in the binding sites of either protein are
          associated with basal cell carcinomas. Alternative
          splicing results in two isoforms. The shorter isoform
          which lacks the N-terminal hydrophobic region, has the
          same activity, and is expressed in placental tissues.
          In general longer isoform contains 2 SH2 domains, a SH3
          domain, a pleckstrin homology (PH) domain, and a
          calcium-dependent phospholipid-binding C2 domain. The
          C-terminus contains the catalytic domain of RasGap
          which catalyzes the activation of Ras by hydrolyzing
          GTP-bound active Ras into an inactive GDP-bound form of
          Ras. This model contains the C-terminal SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 77

 Score = 35.5 bits (82), Expect = 4e-04
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI-DPEGVVRTKDRMFESVSHLVNYH 68
            G FLVRES  +PG Y L+       KH  +I           R F S+  +++ +
Sbjct: 21 GPGSFLVRESDNTPGDYSLSFRVNEGIKHFKIIPTGNNQFMMGGRYFSSLDDVIDRY 77


>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in
          Carboxyl-Terminal Src Kinase (Csk).  Both the
          C-terminal Src kinase (CSK) and CSK-homologous kinase
          (CHK) are members of the CSK-family of protein tyrosine
          kinases. These proteins suppress activity of Src-family
          kinases (SFK) by selectively phosphorylating the
          conserved C-terminal tail regulatory tyrosine by a
          similar mechanism. CHK is also capable of inhibiting
          SFKs by a non-catalytic mechanism that involves binding
          of CHK to SFKs to form stable protein complexes. The
          unphosphorylated form of SFKs is inhibited by CSK and
          CHK by a two-step mechanism. The first step involves
          the formation of a complex of SFKs with CSK/CHK with
          the SFKs in the complex are inactive. The second step,
          involves the phosphorylation of the C-terminal tail
          tyrosine of SFKs, which then dissociates and adopt an
          inactive conformation. The structural basis of how the
          phosphorylated SFKs dissociate from CSK/CHK to adopt
          the inactive conformation is not known. The inactive
          conformation of SFKs is stabilized by two
          intramolecular inhibitory interactions: (a) the pYT:SH2
          interaction in which the phosphorylated C-terminal tail
          tyrosine (YT) binds to the SH2 domain, and (b) the
          linker:SH3 interaction of which the SH2-kinase domain
          linker binds to the SH3 domain. SFKs are activated by
          multiple mechanisms including binding of the ligands to
          the SH2 and SH3 domains to displace the two inhibitory
          intramolecular interactions, autophosphorylation, and
          dephosphorylation of YT. By selective phosphorylation
          and the non-catalytic inhibitory mechanism CSK and CHK
          are able to inhibit the active forms of SFKs. CSK and
          CHK are regulated by phosphorylation and inter-domain
          interactions. They both contain SH3, SH2, and kinase
          domains separated by the SH3-SH2 connector and SH2
          kinase linker, intervening segments separating the
          three domains. They lack a conserved tyrosine
          phosphorylation site in the kinase domain and the
          C-terminal tail regulatory tyrosine phosphorylation
          site. The CSK SH2 domain is crucial for stabilizing the
          kinase domain in the active conformation. A disulfide
          bond here regulates CSK kinase activity. The
          subcellular localization and activity of CSK are
          regulated by its SH2 domain. In general SH2 domains are
          involved in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 98

 Score = 35.7 bits (83), Expect = 5e-04
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRM--FESVSHLV 65
           +DG FLVRES   PG Y L     G  +H  +I   G + T D    FE++  LV
Sbjct: 22 PEDGLFLVRESTNYPGDYTLCVSFEGKVEHYRVIYRNGKL-TIDEEEYFENLIQLV 76


>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2)
          domain found in SH2 domains, ANK, and kinase domain
          (shark) proteins.  These non-receptor protein-tyrosine
          kinases contain two SH2 domains, five ankyrin
          (ANK)-like repeats, and a potential tyrosine
          phosphorylation site in the carboxyl-terminal tail
          which resembles the phosphorylation site in members of
          the src family. Like, mammalian non-receptor
          protein-tyrosine kinases, ZAP-70 and syk proteins, they
          do not have SH3 domains. However, the presence of ANK
          makes these unique among protein-tyrosine kinases. Both
          tyrosine kinases and ANK repeats have been shown to
          transduce developmental signals, and SH2 domains are
          known to participate intimately in tyrosine kinase
          signaling. These tyrosine kinases are believed to be
          involved in epithelial cell polarity. The members of
          this family include the shark (SH2 domains, ANK, and
          kinase domain) gene in Drosophila and yellow fever
          mosquitos, as well as the hydra protein HTK16.
          Drosophila Shark is proposed to transduce
          intracellularly the Crumbs, a protein necessary for
          proper organization of ectodermal epithelia,
          intercellular signal. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 81

 Score = 34.7 bits (80), Expect = 9e-04
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 11 SRQDGDFLVRESQGSPGQYVLTGYQGGTKKH 41
            +DG FLVRES  +PG YVL+    G   H
Sbjct: 21 GGRDGLFLVRESTSAPGDYVLSLLAQGEVLH 51


>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B3 (Lnk),
          like other members of the SH2B adapter protein family,
          contains a pleckstrin homology domain, at least one
          dimerization domain, and a C-terminal SH2 domain which
          binds to phosphorylated tyrosines in a variety of
          tyrosine kinases.  SH2B3 negatively regulates
          lymphopoiesis and early hematopoiesis. The
          lnk-deficiency results in enhanced production of B
          cells, and expansion as well as enhanced function of
          hematopoietic stem cells (HSCs), demonstrating negative
          regulatory functions of Sh2b3/Lnk in cytokine
          signaling. Sh2b3/Lnk also functions in responses
          controlled by cell adhesion and in crosstalk between
          integrin- and cytokine-mediated signaling. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 35.3 bits (81), Expect = 0.001
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 15 GDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPE-GVVRTKDRMFESVSHLVNYHCQNQL 73
          G FLVR+S+   G+YVLT    G  KHL L   E G  R +   F SV  ++++  ++ +
Sbjct: 33 GVFLVRQSETRRGEYVLTFNFQGRAKHLRLSLTERGQCRVQHLHFPSVVDMLHHFQRSPI 92

Query: 74 PI 75
          P+
Sbjct: 93 PL 94


>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2)
          domain found in SH2 domain Phosphatases (SHP) proteins.
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
          Drosophila corkscrew (csw), and Caenorhabditis elegans
          Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
          signaling enzymes. They are both targeted and regulated
          by interactions of their SH2 domains with
          phosphotyrosine docking sites. These proteins contain
          two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
          phosphatase (PTP) domain, and a C-terminal extension.
          Shp1 and Shp2 have two tyrosyl phosphorylation sites in
          their C-tails, which are phosphorylated differentially
          by receptor and nonreceptor PTKs. Csw retains the
          proximal tyrosine and Ptp-2 lacks both sites.
          Shp-binding proteins include receptors, scaffolding
          adapters, and inhibitory receptors. Some of these bind
          both Shp1 and Shp2 while others bind only one. Most
          proteins that bind a Shp SH2 domain contain one or more
          immuno-receptor tyrosine-based inhibitory motifs
          (ITIMs): [IVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks the
          catalytic domain and keeps the enzyme in the inactive
          conformation, and is thus believed to regulate the
          phosphatase activity of SHP-1. Its C-SH2 domain is
          thought to be involved in searching for phosphotyrosine
          activators. The SHP2 N-SH2 domain is a conformational
          switch; it either binds and inhibits the phosphatase,
          or it binds phosphoproteins and activates the enzyme.
          The C-SH2 domain contributes binding energy and
          specificity, but it does not have a direct role in
          activation. Csw SH2 domain function is essential, but
          either SH2 domain can fulfill this requirement. The
          role of the csw SH2 domains during Sevenless receptor
          tyrosine kinase (SEV) signaling is to bind Daughter of
          Sevenless rather than activated SEV.  Ptp-2 acts in
          oocytes downstream of sheath/oocyte gap junctions to
          promote major sperm protein (MSP)-induced MAP Kinase
          (MPK-1) phosphorylation. Ptp-2 functions in the oocyte
          cytoplasm, not at the cell surface to inhibit multiple
          RasGAPs, resulting in sustained Ras activation. It is
          thought that MSP triggers PTP-2/Ras activation and ROS
          production to stimulate MPK-1 activity essential for
          oocyte maturation and that secreted MSP domains and
          Cu/Zn superoxide dismutases function antagonistically
          to control ROS and MAPK signaling. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 99

 Score = 35.1 bits (81), Expect = 0.001
 Identities = 18/68 (26%), Positives = 27/68 (39%), Gaps = 17/68 (25%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKH---------LLLIDPEGVVRTKDRMFESVSHL 64
          DG FL R S+ +PG + L+  +G    H           L   E         F ++S L
Sbjct: 22 DGSFLARPSKSNPGDFTLSVRRGDEVTHIKIQNTGDYYDLYGGE--------KFATLSEL 73

Query: 65 VNYHCQNQ 72
          V Y+ +  
Sbjct: 74 VQYYMEQH 81


>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the
          Src family of non-receptor tyrosine kinases.  The Src
          family kinases are nonreceptor tyrosine kinases that
          have been implicated in pathways regulating
          proliferation, angiogenesis, invasion and metastasis,
          and bone metabolism. It is thought that transforming
          ability of Src is linked to its ability to activate key
          signaling molecules in these pathways, rather than
          through direct activity. As such blocking Src
          activation has been a target for drug companies. Src
          family members can be divided into 3 groups based on
          their expression pattern: 1) Src, Fyn, and Yes; 2)
          Blk, Fgr, Hck, Lck, and Lyn; and 3) Frk-related kinases
          Frk/Rak and Iyk/Bsk Of these, cellular c-Src is the
          best studied and most frequently implicated in
          oncogenesis. The c-Src contains five distinct regions:
          a unique N-terminal domain, an SH3 domain, an SH2
          domain, a kinase domain and a regulatory tail, as do
          the other members of the family. Src exists in both
          active and inactive conformations. Negative regulation
          occurs through phosphorylation of Tyr, resulting in an
          intramolecular association between phosphorylated Tyr
          and the SH2 domain of SRC, which locks the protein in a
          closed conformation. Further stabilization of the
          inactive state occurs through interactions between the
          SH3 domain and a proline-rich stretch of residues
          within the kinase domain. Conversely, dephosphorylation
          of Tyr allows SRC to assume an open conformation. Full
          activity requires additional autophosphorylation of a
          Tyr residue within the catalytic domain. Loss of the
          negative-regulatory C-terminal segment has been shown
          to result in increased activity and transforming
          potential. Phosphorylation of the C-terminal Tyr
          residue by C-terminal Src kinase (Csk) and Csk homology
          kinase results in increased intramolecular interactions
          and consequent Src inactivation. Specific phosphatases,
          protein tyrosine phosphatase a (PTPa) and the
          SH-containing phosphatases SHP1/SHP2, have also been
          shown to take a part in Src activation. Src is also
          activated by direct binding of focal adhesion kinase
          (Fak) and Crk-associated substrate (Cas) to the SH2
          domain. SRC activity can also be regulated by numerous
          receptor tyrosine kinases (RTKs), such as Her2,
          epidermal growth factor receptor (EGFR), fibroblast
          growth factor receptor, platelet-derived growth factor
          receptor (PDGFR), and vascular endothelial growth
          factor receptor (VEGFR). In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 33.3 bits (77), Expect = 0.004
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 7/65 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVS 62
          P    G FL+RES+ +PG Y L+       +G T KH  +  +D  G   T    F ++ 
Sbjct: 22 PGNPRGTFLIRESETTPGAYSLSVRDGDDARGDTVKHYRIRKLDNGGYYITTRATFPTLQ 81

Query: 63 HLVNY 67
           LV +
Sbjct: 82 ELVQH 86


>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes.
          Yes is a member of the Src non-receptor type tyrosine
          kinase family of proteins. Yes is the cellular homolog
          of the Yamaguchi sarcoma virus oncogene. In humans it
          is encoded by the YES1 gene which maps to chromosome 18
          and is in close proximity to thymidylate synthase. A
          corresponding Yes pseudogene has been found on
          chromosome 22. YES1 has been shown to interact with
          Janus kinase 2, CTNND1,RPL10, and Occludin. Yes1 has a
          unique N-terminal domain, an SH3 domain, an SH2 domain,
          a kinase domain and a regulatory tail, as do the other
          members of the family. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 33.1 bits (75), Expect = 0.006
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVS 62
          P  Q G FLVRES+ + G Y L+       +G   KH  +  +D  G   T    F+++ 
Sbjct: 22 PGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQ 81

Query: 63 HLVNYHCQN 71
           LV ++ ++
Sbjct: 82 KLVKHYTEH 90


>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like
          adaptor proteins.  SLAP belongs to the subfamily of
          adapter proteins that negatively regulate cellular
          signaling initiated by tyrosine kinases. It has a
          myristylated N-terminus, SH3 and SH2 domains with high
          homology to Src family tyrosine kinases, and a unique
          C-terminal tail, which is important for c-Cbl binding.
          SLAP negatively regulates platelet-derived growth
          factor (PDGF)-induced mitogenesis in fibroblasts and
          regulates F-actin assembly for dorsal ruffles
          formation. c-Cbl mediated SLAP inhibition towards actin
          remodeling. Moreover, SLAP enhanced PDGF-induced c-Cbl
          phosphorylation by SFK. In contrast, SLAP mitogenic
          inhibition was not mediated by c-Cbl, but it rather
          involved a competitive mechanism with SFK for
          PDGF-receptor (PDGFR) association and mitogenic
          signaling. Accordingly, phosphorylation of the Src
          mitogenic substrates Stat3 and Shc were reduced by
          SLAP. Thus, we concluded that SLAP regulates PDGFR
          signaling by two independent mechanisms: a competitive
          mechanism for PDGF-induced Src mitogenic signaling and
          a non-competitive mechanism for dorsal ruffles
          formation mediated by c-Cbl. SLAP is a hematopoietic
          adaptor containing Src homology (SH)3 and SH2 motifs
          and a unique carboxy terminus. Unlike c-Src, SLAP lacks
          a tyrosine kinase domain. Unlike c-Src, SLAP does not
          impact resorptive function of mature osteoclasts but
          induces their early apoptosis. SLAP negatively
          regulates differentiation of osteoclasts and
          proliferation of their precursors. Conversely, SLAP
          decreases osteoclast death by inhibiting activation of
          caspase 3. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 32.8 bits (75), Expect = 0.007
 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 7/69 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT------GYQGGTKKHLLLIDPEGVVRTKDRM-FESVS 62
          P  Q G FL+RES+   G Y L+        +   K + +     G      R+ F+ + 
Sbjct: 29 PGNQVGSFLIRESETRRGCYSLSVRHRGSQSRDSVKHYRIFRLDNGWFYISPRLTFQCLE 88

Query: 63 HLVNYHCQN 71
           +VN++ ++
Sbjct: 89 DMVNHYSES 97


>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) proteins.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7).  In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 32.5 bits (74), Expect = 0.009
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 20/80 (25%)

Query: 5  AKTAFPSRQDGDFLVRESQGSPGQYVLT--------------GYQGGTKKHLLLIDPEGV 50
          AK       +G FLVR+S  S   Y+LT               YQ G  +    +D    
Sbjct: 19 AKEKLQDAPEGTFLVRDS--SHSDYLLTISVKTSAGPTNLRIEYQDGKFR----LDSIIC 72

Query: 51 VRTKDRMFESVSHLVNYHCQ 70
          V++K + F+SV HL+ Y+ Q
Sbjct: 73 VKSKLKQFDSVVHLIEYYVQ 92


>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2
          (N-SH2) domain in Phospholipase C gamma.  Phospholipase
          C gamma is a signaling molecule that is recruited to
          the C-terminal tail of the receptor upon
          autophosphorylation of a highly conserved tyrosine.
          PLCgamma is composed of a Pleckstrin homology (PH)
          domain followed by an elongation factor (EF) domain, 2
          catalytic regions of PLC domains that flank 2 tandem
          SH2 domains (N-SH2, C-SH2), and ending with a SH3
          domain and C2 domain. N-SH2 SH2 domain-mediated
          interactions represent a crucial step in transmembrane
          signaling by receptor tyrosine kinases. SH2 domains
          recognize phosphotyrosine (pY) in the context of
          particular sequence motifs in receptor phosphorylation
          sites. Both N-SH2 and C-SH2 have a very similar binding
          affinity to pY. But in growth factor stimulated cells
          these domains bind to different target proteins. N-SH2
          binds to pY containing sites in the C-terminal tails of
          tyrosine kinases and other receptors. Recently it has
          been shown that this interaction is mediated by
          phosphorylation-independent interactions between a
          secondary binding site found exclusively on the N-SH2
          domain and a region of the FGFR1 tyrosine kinase
          domain. This secondary site on the SH2 cooperates with
          the canonical pY site to regulate selectivity in
          mediating a specific cellular process.  C-SH2 binds to
          an intramolecular site on PLCgamma itself which allows
          it to hydrolyze phosphatidylinositol-4,5-bisphosphate
          into diacylglycerol and inositol triphosphate. These
          then activate protein kinase C and release calcium. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 99

 Score = 32.3 bits (74), Expect = 0.010
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 23/74 (31%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRM--------------FE 59
          DG FLVRES+   G Y L+ ++ G  +H          R + R               F+
Sbjct: 30 DGTFLVRESETFVGDYTLSFWRNGKVQH---------CRIRSRQENGEKKYYLTDNLVFD 80

Query: 60 SVSHLVNYHCQNQL 73
          S+  L++Y+ QN L
Sbjct: 81 SLYELIDYYRQNPL 94


>gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3
          proteins.  Proto-oncogene vav is a member of the Dbl
          family of guanine nucleotide exchange factors (GEF) for
          the Rho family of GTP binding proteins. All vavs are
          activated by tyrosine phosphorylation leading to their
          activation. There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, and Vav2 and Vav3 are more ubiquitously
          expressed. Vav3 preferentially activates RhoA, RhoG
          and, to a lesser extent, Rac1.  Alternatively spliced
          transcript variants encoding different isoforms have
          been described for this gene.  VAV3 has been shown to
          interact with Grb2. Vav proteins are involved in
          several processes that require cytoskeletal
          reorganization, such as the formation of the
          immunological synapse (IS), phagocytosis, platelet
          aggregation, spreading, and transformation. Vavs
          function as guanine nucleotide exchange factors (GEFs)
          for the Rho/Rac family of GTPases. Vav family members
          have several conserved motifs/domains including: a
          leucine-rich region, a leucine-zipper, a calponin
          homology (CH) domain, an acidic domain, a Dbl-homology
          (DH) domain, a pleckstrin homology (PH) domain, a
          cysteine-rich domain, 2 SH3 domains,  a proline-rich
          region, and a SH2 domain. Vavs are the only known Rho
          GEFs that have both the DH/PH motifs and SH2/SH3
          domains in the same protein. The leucine-rich
          helix-loop-helix (HLH) domain is thought to be involved
          in protein heterodimerization with other HLH proteins
          and it may function as a negative regulator by forming
          inactive heterodimers. The CH domain  is usually
          involved in the association with filamentous actin, but
          in Vav it controls NFAT stimulation, Ca2+ mobilization,
          and its transforming activity. Acidic domains are
          involved in protein-protein interactions and contain
          regulatory tyrosines.  The DH domain is a GDP-GTP
          exchange factor on Rho/Rac GTPases. The PH domain in
          involved in interactions with GTP-binding proteins,
          lipids and/or phosphorylated serine/threonine residues.
           The SH3 domain is involved in localization of proteins
          to specific sites within the cell interacting with
          protein with proline-rich sequences. The SH2 domain
          mediates a high affinity interaction with tyrosine
          phosphorylated proteins. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 31.9 bits (72), Expect = 0.015
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 1  MSRI-AKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVR-TKDRMF 58
          M R+ A+T   +R +  +LVR      G+Y ++       KH+ ++  +G     ++R F
Sbjct: 12 MERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEVKHIKILTRDGFFHIAENRKF 71

Query: 59 ESVSHLVNYHCQNQL 73
          +S+  LV Y+  + L
Sbjct: 72 KSLMELVEYYKHHSL 86


>gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in
          tyrosine kinase sarcoma (Src).  Src is a member of the
          Src non-receptor type tyrosine kinase family of
          proteins. Src is thought to play a role in the
          regulation of embryonic development and cell growth.
          Members here include v-Src and c-Src. v-Src lacks the
          C-terminal inhibitory phosphorylation site and is
          therefore constitutively active as opposed to normal
          cellular src (c-Src) which is only activated under
          certain circumstances where it is required (e.g. growth
          factor signaling). v-Src is an oncogene whereas c-Src
          is a proto-oncogene. c-Src consists of three domains,
          an N-terminal SH3 domain, a central SH2 domain and a
          tyrosine kinase domain. The SH2 and SH3 domains work
          together in the auto-inhibition of the kinase domain.
          The phosphorylation of an inhibitory tyrosine near the
          c-terminus of the protein produces a binding site for
          the SH2 domain which then facilitates binding of the
          SH3 domain to a polyproline site within the linker
          between the SH2 domain and the kinase domain. Binding
          of the SH3 domain inactivates the enzyme. This allows
          for multiple mechanisms for c-Src activation:
          dephosphorylation of the C-terminal tyrosine by a
          protein tyrosine phosphatase, binding of the SH2 domain
          by a competitive phospho-tyrosine residue, or
          competitive binding of a polyproline binding site to
          the SH3 domain.  Unlike most other Src members Src
          lacks cysteine residues in the SH4 domain that undergo
          palmitylation. Serine and threonine phosphorylation
          sites have also been identified in the unique domains
          of Src and are believed to modulate protein-protein
          interactions or regulate catalytic activity.
          Alternatively spliced forms of Src, which contain 6- or
          11-amino acid insertions in the SH3 domain, are
          expressed in CNS neurons. c-Src has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 31.6 bits (71), Expect = 0.021
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 7/69 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVS 62
               G FLVRES+ + G Y L+       +G   KH  +  +D  G   T    F S+ 
Sbjct: 22 AENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQ 81

Query: 63 HLVNYHCQN 71
           LV Y+ ++
Sbjct: 82 QLVAYYSKH 90


>gnl|CDD|198222 cd10359, SH2_SH3BP2, Src homology 2 domain found in c-Abl SH3
          domain-binding protein-2 (SH3BP2).  The adaptor protein
          3BP2/SH3BP2 plays a regulatory role in signaling from
          immunoreceptors. The protein-tyrosine kinase Syk
          phosphorylates 3BP2 which results in the activation of
          Rac1 through the interaction with the SH2 domain of
          Vav1 and induces the binding to the SH2 domain of the
          upstream protein-tyrosine kinase Lyn and enhances its
          kinase activity. 3BP2 has a positive regulatory role in
          IgE-mediated mast cell activation. In lymphocytes,
          engagement of T cell or B cell receptors triggers
          tyrosine phosphorylation of 3BP2. Suppression of the
          3BP2 expression by siRNA results in the inhibition of T
          cell or B cell receptor-mediated activation of NFAT.
          3BP2 is required for the proliferation of B cells and B
          cell receptor signaling. Mutations in the 3BP2 gene are
          responsible for cherubism resulting in excessive bone
          resorption in the jaw.  In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 31.5 bits (71), Expect = 0.021
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGT---KKHLLLIDPEGVVRTKDRMFESVSHLVNYHC 69
          QDG + +R S  + G  VL  + GG    + + +          +  +F S+  LV ++ 
Sbjct: 26 QDGLYCIRNSS-TKGGKVLVVWDGGAEKVRNYRIFEKDCKFYLHEREVFSSLGSLVEHYA 84

Query: 70 QNQLPIISAESALILRNP 87
           + LP     ++L LR P
Sbjct: 85 THVLPS---HTSLTLRVP 99


>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 14 (Grb14)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb14 is part of the Grb7 family of proteins which also
          includes Grb7, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb14
          binds to Fibroblast Growth Factor Receptor (FGFR) and
          weakly to the erbB2 receptor. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 108

 Score = 31.4 bits (71), Expect = 0.024
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPE 48
          DG FLVR+SQ +P  +VL+   G   KH  +I  E
Sbjct: 28 DGVFLVRDSQSNPRTFVLSMSHGQKIKHFQIIPVE 62


>gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte
          cell kinase (Lck).  Lck is a member of the Src
          non-receptor type tyrosine kinase family of proteins.
          It is expressed in the brain, T-cells, and NK cells.
          The unique domain of Lck mediates its interaction with
          two T-cell surface molecules, CD4 and CD8. It
          associates with their cytoplasmic tails on CD4 T helper
          cells  and CD8 cytotoxic T cells to assist signaling
          from the T cell receptor (TCR) complex. When the T cell
          receptor is engaged by the specific antigen presented
          by MHC, Lck phosphorylase the intracellular chains of
          the CD3 and zeta-chains of the TCR complex, allowing
          ZAP-70 to bind them. Lck then phosphorylates and
          activates ZAP-70, which in turn phosphorylates Linker
          of Activated T cells (LAT), a transmembrane protein
          that serves as a docking site for proteins including:
          Shc-Grb2-SOS, PI3K, and phospholipase C (PLC). The
          tyrosine phosphorylation cascade culminates in the
          intracellular mobilization of a calcium ions and
          activation of important signaling cascades within the
          lymphocyte, including the Ras-MEK-ERK pathway, which
          goes on to activate certain transcription factors such
          as NFAT, NF-kappaB, and AP-1. These transcription
          factors regulate the production cytokines such as
          Interleukin-2 that promote long-term proliferation and
          differentiation of the activated lymphocytes.  The
          N-terminal tail of Lck is myristoylated and
          palmitoylated and it tethers the protein to the plasma
          membrane of the cell. Lck also contains a SH3 domain, a
          SH2 domain, and a C-terminal tyrosine kinase domain.
          Lck has 2 phosphorylation sites, the first an
          autophosphorylation site that is linked to activation
          of the protein and the second which is phosphorylated
          by Csk, which inhibits it. Lck is also inhibited by
          SHP-1 dephosphorylation and by Cbl ubiquitin ligase,
          which is part of the ubiquitin-mediated pathway. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 31.0 bits (70), Expect = 0.032
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVS 62
          P    G FL+RES+ + G + L+       QG   KH  +  +D  G   +    F  + 
Sbjct: 22 PGNTHGSFLIRESETTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLH 81

Query: 63 HLVNYH 68
           LV ++
Sbjct: 82 ELVRHY 87


>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found  in Tec
           protein, Bruton's tyrosine kinase (Btk).  A member of
           the Tec protein tyrosine kinase Btk is expressed in bone
           marrow, spleen, all hematopoietic cells except T
           lymphocytes and plasma cells where it plays a  crucial
           role in B cell maturation and mast cell activation. Btk
           has been shown to interact with GNAQ, PLCG2, protein
           kinase D1, B-cell linker, SH3BP5, caveolin 1, ARID3A,
           and GTF2I. Most of the Tec family members have a PH
           domain (Txk and the short (type 1) splice variant of
           Drosophila Btk29A are exceptions), a Tec homology (TH)
           domain, a SH3 domain, a SH2 domain, and a protein kinase
           catalytic domain. Btk is implicated in the primary
           immunodeficiency disease X-linked agammaglobulinemia
           (Bruton's agammaglobulinemia).  The TH domain consists
           of a Zn2+-binding Btk motif and a proline-rich region.
           The Btk motif is found in Tec kinases, Ras GAP, and
           IGBP.  It is crucial for the function of Tec PH domains
           and it's lack of presence in Txk is not surprising since
           it lacks a PH domain. The type 1 splice form of the
           Drosophila homolog also lacks both the PH domain and the
           Btk motif.  The proline-rich regions are highly
           conserved for the most part with the exception of Bmx
           whose residues surrounding the PXXP motif are not
           conserved (TH-like) and Btk29A  which is entirely unique
           with large numbers of glycine residues (TH-extended).
           Tec family members all lack a C-terminal tyrosine having
           an autoinhibitory function in its phosphorylated state.
           Two tyrosine phosphorylation (pY) sites have been
           identified in Btk: one located in the activation loop of
           the catalytic domain which regulates the transition
           between open (active) and closed (inactive) states and
           the other in its SH3 domain.  In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 106

 Score = 31.0 bits (70), Expect = 0.041
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 26/91 (28%)

Query: 13  QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVR--------------TKDRMF 58
           ++G F+VR+S    G+Y ++ +           DP+GV+R               +  +F
Sbjct: 27  KEGGFIVRDSS-KAGKYTVSVFAKSAG------DPQGVIRHYVVCSTPQSQYYLAEKHLF 79

Query: 59  ESVSHLVNYHCQNQLPIISAESALILRNPVA 89
            ++  L+NYH  N   +IS      L+ PV+
Sbjct: 80  STIPELINYHQHNAAGLISR-----LKYPVS 105


>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2)
          domain found in p85.  Phosphoinositide 3-kinases
          (PI3Ks) are essential for cell growth, migration, and
          survival. p110, the catalytic subunit, is composed of
          an adaptor-binding domain, a Ras-binding domain, a C2
          domain, a helical domain, and a kinase domain.  The
          regulatory unit is called p85 and is composed of an SH3
          domain, a RhoGap domain, a N-terminal SH2 (nSH2)
          domain, a inter SH2 (iSH2) domain, and C-terminal
          (cSH2) domain.  There are 2 inhibitory interactions
          between p110alpha and p85 of P13K: 1) p85 nSH2 domain
          with the C2, helical, and kinase domains of p110alpha
          and 2) p85 iSH2 domain with C2 domain of p110alpha.
          There are 3 inhibitory interactions between p110beta
          and p85 of P13K: 1) p85 nSH2 domain with the C2,
          helical, and kinase domains of p110beta, 2) p85 iSH2
          domain with C2 domain of p110alpha, and 3) p85 cSH2
          domain with the kinase domain of p110alpha. It is
          interesting to note that p110beta is oncogenic as a
          wild type protein while p110alpha lacks this ability.
          One explanation is the idea that the regulation of
          p110beta by p85 is unique because of the addition of
          inhibitory contacts from the cSH2 domain and the loss
          of contacts in the iSH2 domain. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 29.7 bits (67), Expect = 0.12
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 11 SRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPE---GVVRTKDRMFESVSHLVNY 67
           + DG FL+RES  + G Y  +    G  KH ++   E   G     + ++ES+  LV +
Sbjct: 24 GKPDGTFLIRESS-TQGCYACSVVCNGEVKHCVIYKTETGYGFAEPYN-LYESLKELVLH 81

Query: 68 HCQNQL 73
          +  N L
Sbjct: 82 YAHNSL 87


>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2
          domain-containing adapter protein B (SHB).  SHB
          functions in generating signaling compounds in response
          to tyrosine kinase activation. SHB contains
          proline-rich motifs, a phosphotyrosine binding (PTB)
          domain, tyrosine phosphorylation sites, and a SH2
          domain. SHB mediates certain aspects of
          platelet-derived growth factor (PDGF) receptor-,
          fibroblast growth factor (FGF) receptor-, neural growth
          factor (NGF) receptor TRKA-, T cell receptor-,
          interleukin-2 (IL-2) receptor- and focal adhesion
          kinase- (FAK) signaling. SRC-like FYN-Related Kinase
          FRK/RAK (also named BSK/IYK or GTK) and SHB regulate
          apoptosis, proliferation and differentiation. SHB
          promotes apoptosis and is also required for proper
          mitogenicity, spreading and tubular morphogenesis in
          endothelial cells. SHB also plays a role in preventing
          early cavitation of embryoid bodies and reduces
          differentiation to cells expressing albumin, amylase,
          insulin and glucagon. SHB is a multifunctional protein
          that has difference responses in different cells under
          various conditions. In general SH2 domains are involved
          in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 97

 Score = 29.7 bits (66), Expect = 0.12
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 17 FLVRESQGSPGQYVLT--GYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLP 74
          +LVR SQ S   Y L+    QG     L     + V+      F+SV  +++Y+   +LP
Sbjct: 25 YLVRNSQTSKHDYSLSLKSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLP 84

Query: 75 IISAESALIL 84
          I  AE   +L
Sbjct: 85 IKGAEHLSLL 94


>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in
          cancer-related signaling adaptor protein CRK.  SH2
          domain in the CRK proteins.  CRKI (SH2-SH3) and CRKII
          (SH2-SH3-SH3) are splicing isoforms of the oncoprotein
          CRK.  CRKs regulate transcription and cytoskeletal
          reorganization for cell growth and motility by linking
          tyrosine kinases to small G proteins. The SH2 domain of
          CRK associates with tyrosine-phosphorylated receptors
          or components of focal adhesions, such as p130Cas and
          paxillin. CRK transmits signals to small G proteins
          through effectors that bind its SH3 domain, such as
          C3G, the guanine-nucleotide exchange factor (GEF) for
          Rap1 and R-Ras, and DOCK180, the GEF for Rac6. The
          binding of p130Cas to the CRK-C3G complex activates
          Rap1, leading to regulation of cell adhesion, and
          activates R-Ras, leading to JNK-mediated activation of
          cell proliferation, whereas the binding of CRK DOCK180
          induces Rac1-mediated activation of cellular migration.
          The activity of the different splicing isoforms varies
          greatly with CRKI displaying substantial transforming
          activity, CRKII less so, and phosphorylated CRKII with
          no biological activity whatsoever.  CRKII has a linker
          region with a phosphorylated Tyr and an additional
          C-terminal SH3 domain. The phosphorylated Tyr creates a
          binding site for its SH2 domain which disrupts the
          association between CRK and its SH2 target proteins.
          In general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 106

 Score = 29.4 bits (66), Expect = 0.14
 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 10/31 (32%)

Query: 11 SRQD----------GDFLVRESQGSPGQYVL 31
          SRQ+          G FLVR+S   PG YVL
Sbjct: 15 SRQEAQELLQGQRHGVFLVRDSSTIPGDYVL 45


>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 7 (Grb7)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb7 is part of the Grb7 family of proteins which also
          includes Grb10, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb7
          binds strongly to the erbB2 receptor, unlike Grb10 and
          Grb14 which bind weakly to it. Grb7 family proteins are
          phosphorylated on serine/threonine as well as tyrosine
          residues. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 108

 Score = 29.1 bits (65), Expect = 0.16
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRM------FESVSHLVNY 67
          DG FLVRESQ +P  +VL+       KH L++  E   R    M      F  +  LV +
Sbjct: 28 DGVFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEF 87

Query: 68 HCQNQ 72
          H  N+
Sbjct: 88 HQLNR 92


>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain
          found in Fyn isoform b like proteins.  Fyn is a member
          of the Src non-receptor type tyrosine kinase family of
          proteins. This cd contains the SH2 domain found in Fyn
          isoform b type proteins. Fyn is involved in the control
          of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 28.5 bits (63), Expect = 0.26
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 15 GDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVSHLVNY 67
          G FL+RES+ + G Y L+       +G   KH  +  +D  G   T    FE++  LV +
Sbjct: 27 GTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQH 86

Query: 68 HCQ 70
          + +
Sbjct: 87 YSE 89


>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the
          Src oncogene at 42A (Src42).  Src42 is a member of the
          Src non-receptor type tyrosine kinase family of
          proteins. The integration of receptor tyrosine
          kinase-induced RAS and Src42 signals by Connector
          eNhancer of KSR (CNK) as a two-component input is
          essential for RAF activation in Drosophila. Src42 is
          present in a wide variety of organisms including:
          California sea hare, pea aphid, yellow fever mosquito,
          honey bee, Panamanian leafcutter ant, and sea urchin.
          Src42 has a unique N-terminal domain, an SH3 domain, an
          SH2 domain, a kinase domain and a regulatory tail, as
          do the other members of the family. Like the other
          members of the Src family the SH2 domain in addition to
          binding the target, also plays an autoinhibitory role
          by binding to its C-terminal tail.  In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 96

 Score = 28.6 bits (64), Expect = 0.26
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLL--IDPEGVVRTKDRMFESVSHLVNY 67
          P  + G FL+R+S+     Y L+   G T KH  +  +D  G    +   F ++  LV +
Sbjct: 22 PENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEH 81

Query: 68 H 68
          +
Sbjct: 82 Y 82


>gnl|CDD|217240 pfam02816, Alpha_kinase, Alpha-kinase family.  This family is a
           novel family of eukaryotic protein kinase catalytic
           domains, which have no detectable similarity to
           conventional kinases. The family contains myosin heavy
           chain kinases and Elongation Factor-2 kinase and a
           bifunctional ion channel. This family is known as the
           alpha-kinase family. The structure of the kinase domain
           revealed unexpected similarity to eukaryotic protein
           kinases in the catalytic core as well as to metabolic
           enzymes with ATP-grasp domains.
          Length = 187

 Score = 28.8 bits (65), Expect = 0.39
 Identities = 12/58 (20%), Positives = 15/58 (25%), Gaps = 18/58 (31%)

Query: 25  SPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFES-------------VSHLVNYHC 69
           S G  ++   QG       L DP   + T D                    H  N  C
Sbjct: 135 SNGNLLVCDLQGVGN---YLTDP--QIHTTDGERFGPGNLGEEGIEKFFQQHKCNEIC 187


>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in
           Tec-like proteins.  The Tec protein tyrosine kinase is
           the founding member of a family that includes Btk, Itk,
           Bmx, and Txk. The members have a PH domain, a
           zinc-binding motif, a SH3 domain, a SH2 domain, and a
           protein kinase catalytic domain. Btk is involved in
           B-cell receptor signaling with mutations in Btk
           responsible for X-linked agammaglobulinemia (XLA) in
           humans and X-linked immunodeficiency (xid) in mice. Itk
           is involved in T-cell receptor signaling. Tec is
           expressed in both T and B cells, and is thought to
           function in activated and effector T lymphocytes to
           induce the expression of genes regulated by NFAT
           transcription factors. In general SH2 domains are
           involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 104

 Score = 28.1 bits (63), Expect = 0.42
 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 13  QDGDFLVRESQGSPGQYVLTGY----QGGTKKHLLL-IDPEGVVRTKDR-MFESVSHLVN 66
           ++G F+VR S  + G Y ++ +         KH  +  +        ++  FE++  L+N
Sbjct: 27  KEGCFVVRNSS-TKGLYTVSLFTKVPGSPHVKHYHIKQNARSEFYLAEKHCFETIPELIN 85

Query: 67  YHCQNQLPIISAESALILRNPV 88
           YH  N     S   A  L+ PV
Sbjct: 86  YHQHN-----SGGLATRLKYPV 102


>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn.
          Fyn is a member of the Src non-receptor type tyrosine
          kinase family of proteins. Fyn is involved in the
          control of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 28.1 bits (62), Expect = 0.44
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 15 GDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVSHLVNY 67
          G FL+RES+ + G Y L+       +G   KH  +  +D  G   T    FE++  LV +
Sbjct: 27 GTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQH 86

Query: 68 H 68
          +
Sbjct: 87 Y 87


>gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK.
          HCK is a member of the Src non-receptor type tyrosine
          kinase family of proteins and is expressed in
          hemopoietic cells. HCK is proposed to couple the Fc
          receptor to the activation of the respiratory burst. It
          may also play a role in neutrophil migration and in the
          degranulation of neutrophils. It has two different
          translational starts that have different subcellular
          localization. HCK has been shown to interact with BCR
          gene,  ELMO1 Cbl gene, RAS p21 protein activator 1,
          RASA3, Granulocyte colony-stimulating factor receptor,
          ADAM15 and RAPGEF1.  Like the other members of the Src
          family the SH2 domain in addition to binding the
          target, also plays an autoinhibitory role by binding to
          its C-terminal tail.  In general SH2 domains are
          involved in signal transduction. HCK has a unique
          N-terminal domain, an SH3 domain, an SH2 domain, a
          kinase domain and a regulatory tail, as do the other
          members of the family. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 28.0 bits (62), Expect = 0.53
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKH--LLLIDPEGVVRTKDRMFESVS 62
          P    G F++R+S+ + G Y L+        G T KH  +  +D  G   +    F ++ 
Sbjct: 22 PGNMLGSFMIRDSETTKGSYSLSVRDYDPQHGDTVKHYKIRTLDNGGFYISPRSTFSTLQ 81

Query: 63 HLVNYH 68
           LV+++
Sbjct: 82 ELVDHY 87


>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in
          Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene
          homolog, Fgr.  Fgr is a member of the Src non-receptor
          type tyrosine kinase family of proteins. The protein
          contains N-terminal sites for myristoylation and
          palmitoylation, a PTK domain, and SH2 and SH3 domains
          which are involved in mediating protein-protein
          interactions with phosphotyrosine-containing and
          proline-rich motifs, respectively. Fgr is expressed in
          B-cells and myeloid cells, localizes to plasma membrane
          ruffles, and functions as a negative regulator of cell
          migration and adhesion triggered by the beta-2 integrin
          signal transduction pathway. Multiple alternatively
          spliced variants, encoding the same protein, have been
          identified  Fgr has been shown to interact with
          Wiskott-Aldrich syndrome protein. Fgr has a unique
          N-terminal domain, an SH3 domain, an SH2 domain, a
          kinase domain and a regulatory tail, as do the other
          members of the family. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 27.2 bits (60), Expect = 0.87
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVS 62
          P    G FL+RES+ + G Y L+       +G   KH  +  +D  G   T    F++V 
Sbjct: 22 PGNPRGAFLIRESETTKGAYSLSIRDWDQNRGDHVKHYKIRKLDTGGYYITTRAQFDTVQ 81

Query: 63 HLVNYH 68
           LV ++
Sbjct: 82 ELVQHY 87


>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 10 (Grb10)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb10 is part of the Grb7 family of proteins which also
          includes Grb7, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb10
          has been shown to interact with many different
          proteins, including the insulin and IGF1 receptors,
          platelet-derived growth factor (PDGF) receptor-beta,
          Ret, Kit, Raf1 and MEK1, and Nedd4. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 108

 Score = 27.3 bits (60), Expect = 0.88
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPE 48
          DG FL+R+SQ +P  +VLT       K+  ++  E
Sbjct: 28 DGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE 62


>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in
          Src-related kinase lacking C-terminal regulatory
          tyrosine and N-terminal myristoylation sites (srm).
          Srm is a nonreceptor protein kinase that has two SH2
          domains, a SH3 domain, and a kinase domain with a
          tyrosine residue for autophosphorylation.  However it
          lacks an N-terminal glycine for myristoylation and a
          C-terminal tyrosine which suppresses kinase activity
          when phosphorylated.  Srm is most similar to members of
          the Tec family who other members include: Tec, Btk/Emb,
          and Itk/Tsk/Emt. However Srm differs in its N-terminal
          unique domain it being much smaller than in the Tec
          family and is closer to Src. Srm is thought to be a new
          family of nonreceptor tyrosine kinases that may be
          redundant in function. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 79

 Score = 26.5 bits (58), Expect = 1.1
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT 32
          P  + G FL+R S+ S G Y L+
Sbjct: 19 PPNEPGAFLIRPSESSLGGYSLS 41


>gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in
          protein-tyrosine kinase-6 (PTK6) which is also known as
          breast tumor kinase (Brk).  Human protein-tyrosine
          kinase-6 (PTK6, also known as breast tumor kinase
          (Brk)) is a member of the non-receptor protein-tyrosine
          kinase family and is expressed in two-thirds of all
          breast tumors. PTK6 (9). PTK6 contains a SH3 domain, a
          SH2 domain, and catalytic domains. For the case of the
          non-receptor protein-tyrosine kinases, the SH2 domain
          is typically involved in negative regulation of kinase
          activity by binding to a phosphorylated tyrosine
          residue near to the C terminus. The C-terminal sequence
          of PTK6 (PTSpYENPT where pY is phosphotyrosine) is
          thought to be a self-ligand for the SH2 domain. The
          structure of the SH2 domain resembles other SH2 domains
          except for a centrally located four-stranded
          antiparallel beta-sheet (strands betaA, betaB, betaC,
          and betaD). There are also differences in the loop
          length which might be responsible for PTK6 ligand
          specificity. There are two possible means of regulation
          of PTK6: autoinhibitory with the phosphorylation of Tyr
          playing a role in its negative regulation and
          autophosphorylation at this site, though it has been
          shown that PTK6 might phosphorylate signal
          transduction-associated proteins Sam68 and signal
          transducing adaptor family member 2 (STAP/BKS) in vivo.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 100

 Score = 27.0 bits (59), Expect = 1.2
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 15 GDFLVRESQGSPGQYVLTGYQGGTKKHL-LLIDPEGVVRTKDRM-FESVSHLVNYHCQNQ 72
          G FL+R S+     YVL+       +H  +     G +   + + F S+  LVNYH    
Sbjct: 26 GAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQS 85

Query: 73 L 73
          L
Sbjct: 86 L 86


>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain
          found in Fyn isoform a like proteins.  Fyn is a member
          of the Src non-receptor type tyrosine kinase family of
          proteins. This cd contains the SH2 domain found in Fyn
          isoform a type proteins.  Fyn is involved in the
          control of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 26.9 bits (59), Expect = 1.2
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 15 GDFLVRESQGSPGQYVLT-----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVSHLVNY 67
          G FL+RES+ + G Y L+       +G   KH  +  +D  G   T    FE++  LV +
Sbjct: 27 GTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQH 86

Query: 68 H 68
          +
Sbjct: 87 Y 87


>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2
          domain-containing adapter protein E (SHE).  SHE is
          expressed in heart, lung, brain, and skeletal muscle.
          SHE contains two pTry protein binding domains, protein
          interaction domain (PID) and a SH2 domain, followed by
          a glycine-proline rich region, all of which are
          N-terminal to the phosphotyrosine binding (PTB) domain.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 26.8 bits (59), Expect = 1.3
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 20/95 (21%)

Query: 5  AKTAFPSRQDGDFLVRESQGSPGQY--VLTGYQGGTKKHLLLIDPEGVVRTKDR------ 56
          A++     ++  +LVR S+    +Y   L   QG    H++      V +TKD       
Sbjct: 13 AESRLQPCKEASYLVRNSESGNSKYSIALKTSQGCV--HII------VAQTKDNKYTLNQ 64

Query: 57 ---MFESVSHLVNYHCQNQLPIISAESALILRNPV 88
             +F+S+  +V+Y+   +LP   AE  + L +PV
Sbjct: 65 TSAVFDSIPEVVHYYSNEKLPFKGAEH-MTLLHPV 98


>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in
           Tensin-like proteins.  SH2 domain found in Tensin-like
           proteins. The Tensins are a family of intracellular
           proteins that interact with receptor tyrosine kinases
           (RTKs), integrins, and actin. They are thought act as
           signaling bridges between the extracellular space and
           the cytoskeleton. There are four homologues: Tensin1,
           Tensin2 (TENC1, C1-TEN), Tensin3 and Tensin4 (cten), all
           of which contain a C-terminal tandem SH2-PTB domain
           pairing, as well as actin-binding regions that may
           localize them to focal adhesions. The isoforms of
           Tensin2 and Tensin3 contain N-terminal C1 domains, which
           are atypical and not expected to bind to phorbol esters.
           Tensins 1-3 contain a phosphatase (PTPase) and C2 domain
           pairing which resembles PTEN (phosphatase and tensin
           homologue deleted on chromosome 10) protein. PTEN is a
           lipid phosphatase that dephosphorylates
           phosphatidylinositol 3,4,5-trisphosphate
           (PtdIns(3,4,5)P3) to yield phosphatidylinositol
           4,5-bisphosphate (PtdIns(4,5)P2). As PtdIns(3,4,5)P3 is
           the product of phosphatidylinositol 3-kinase (PI3K)
           activity, PTEN is therefore a key negative regulator of
           the PI3K pathway. Because of their PTEN-like domains,
           the Tensins may also possess phosphoinositide-binding or
           phosphatase capabilities. However, only Tensin2 and
           Tensin3 have the potential to be phosphatases since only
           their PTPase domains contain a cysteine residue that is
           essential for catalytic activity. In general SH2 domains
           are involved in signal transduction. They typically bind
           pTyr-containing ligands via two surface pockets, a pTyr
           and hydrophobic binding pocket, allowing proteins with
           SH2 domains to localize to tyrosine phosphorylated
           sites.
          Length = 116

 Score = 26.6 bits (59), Expect = 1.4
 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 21/84 (25%)

Query: 11  SRQDGDFLVRESQGSPGQYVL-------------TGYQGGTKKHLL---LIDP-EGVVRT 53
            +  G FLVR+S    G Y L                +G  +  L+   LI+P    V+ 
Sbjct: 21  DKPPGTFLVRDSTTYKGAYGLAVKVATPPPGVNPFEAKGDPESELVRHFLIEPSPKGVKL 80

Query: 54  K----DRMFESVSHLVNYHCQNQL 73
           K    + +F S+S LV  H    L
Sbjct: 81  KGCPNEPVFGSLSALVYQHSITPL 104


>gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn.
          Lyn is a member of the Src non-receptor type tyrosine
          kinase family of proteins and is expressed in the
          hematopoietic cells, in neural tissues, liver, and
          adipose tissue. There are two alternatively spliced
          forms of Lyn.  Lyn plays an inhibitory role in myeloid
          lineage proliferation. Following engagement of the B
          cell receptors, Lyn undergoes rapid phosphorylation and
          activation, triggering a cascade of signaling events
          mediated by Lyn phosphorylation of tyrosine residues
          within the immunoreceptor tyrosine-based activation
          motifs (ITAM) of the receptor proteins, and subsequent
          recruitment and activation of other kinases including
          Syk, phospholipase C2 (PLC2) and phosphatidyl
          inositol-3 kinase. These kinases play critical roles in
          proliferation, Ca2+ mobilization and cell
          differentiation. Lyn plays an essential role in the
          transmission of inhibitory signals through
          phosphorylation of tyrosine residues within the
          immunoreceptor tyrosine-based inhibitory motifs (ITIM)
          in regulatory proteins such as CD22, PIR-B and FC
          RIIb1. Their ITIM phosphorylation subsequently leads to
          recruitment and activation of phosphatases such as
          SHIP-1 and SHP-1 which further down modulate signaling
          pathways, attenuate cell activation and can mediate
          tolerance. Lyn also plays a role in the insulin
          signaling pathway. Activated Lyn phosphorylates insulin
          receptor substrate 1 (IRS1) leading to an increase in
          translocation of Glut-4 to the cell membrane and
          increased glucose utilization. It is the primary Src
          family member involved in signaling downstream of the B
          cell receptor. Lyn plays an unusual, 2-fold role in B
          cell receptor signaling; it is essential for initiation
          of signaling but is also later involved in negative
          regulation of the signal. Lyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 26.5 bits (58), Expect = 1.4
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT 32
          P    G FL+RES+   G Y L+
Sbjct: 22 PGNSAGAFLIRESETLKGSYSLS 44


>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in
          SH2-containing inositol-5'-phosphatase (SHIP) and
          SLAM-associated protein (SAP).  The SH2-containing
          inositol-5'-phosphatase, SHIP (also called
          SHIP1/SHIP1a), is a hematopoietic-restricted
          phosphatidylinositide phosphatase that translocates to
          the plasma membrane after extracellular stimulation and
          hydrolyzes the phosphatidylinositol-3-kinase
          (PI3K)-generated second messenger PI-3,4,5-P3 (PIP3) to
          PI-3,4-P2. As a result, SHIP dampens down PIP3 mediated
          signaling and represses the proliferation,
          differentiation, survival, activation, and migration of
          hematopoietic cells.  PIP3 recruits lipid-binding
          pleckstrin homology(PH) domain-containing proteins to
          the inner wall of the plasma membrane and activates
          them. PH domain-containing downstream effectors include
          the survival/proliferation enhancing serine/threonine
          kinase, Akt (protein kinase B), the tyrosine kinase,
          Btk, the regulator of protein translation, S6K, and the
          Rac and cdc42 guanine nucleotide exchange factor, Vav.
          SHIP is believed to act  as a tumor suppressor during
          leukemogenesis and lymphomagenesis, and may play a role
          in activating the immune system to combat cancer. SHIP
          contains an N-terminal SH2 domain, a centrally located
          phosphatase domain that specifically hydrolyzes the
          5'-phosphate from PIP3, PI-4,5-P2  and
          inositol-1,3,4,5- tetrakisphosphate (IP4), a C2 domain,
          that is an allosteric activating site when bound by
          SHIP's enzymatic product, PI-3,4-P2; 2 NPXY motifs that
          bind proteins with a phosphotyrosine binding (Shc, Dok
          1, Dok 2) or an SH2 (p85a, SHIP2) domain; and a
          proline-rich domain consisting of four PxxP motifs that
          bind a subset of SH3-containing proteins including
          Grb2, Src, Lyn, Hck, Abl, PLCg1, and PIAS1. The SH2
          domain of SHIP binds to the tyrosine phosphorylated
          forms of Shc, SHP-2, Doks, Gabs, CD150,
          platelet-endothelial cell adhesion molecule, Cas,
          c-Cbl, immunoreceptor tyrosine-based inhibitory motifs
          (ITIMs), and immunoreceptor tyrosine-based activation
          motifs (ITAMs). The X-linked lymphoproliferative
          syndrome (XLP) gene encodes SAP (also called
          SH2D1A/DSHP) a protein that consists of a 5 residue
          N-terminus, a single SH2 domain, and a short 25 residue
          C-terminal tail.  XLP is characterized by an extreme
          sensitivity to Epstein-Barr virus.  Both T and natural
          killer (NK) cell dysfunctions have been seen in XLP
          patients. SAP binds the cytoplasmic tail of Signaling
          lymphocytic activation molecule (SLAM), 2B4, Ly-9, and
          CD84. SAP is believed to function as a signaling
          inhibitor, by blocking or regulating binding of other
          signaling proteins. SAP and the SAP-like protein EAT-2
          recognize the sequence motif TIpYXX(V/I), which is
          found in the cytoplasmic domains of a restricted number
          of T, B, and NK cell surface receptors and are proposed
          to be natural inhibitors or regulators of the
          physiological role of a small family of receptors on
          the surface of these cells. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 26.2 bits (58), Expect = 1.9
 Identities = 10/19 (52%), Positives = 13/19 (68%)

Query: 13 QDGDFLVRESQGSPGQYVL 31
          +DG FLVR+S+   G Y L
Sbjct: 24 KDGSFLVRDSESVSGAYAL 42


>gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in
          SLAM-associated protein (SAP) 1a.  The X-linked
          lymphoproliferative syndrome (XLP) gene encodes SAP
          (also called SH2D1A/DSHP) a protein that consists of a
          5 residue N-terminus, a single SH2 domain, and a short
          25 residue C-terminal tail. XLP is characterized by an
          extreme sensitivity to Epstein-Barr virus.  Both T and
          natural killer (NK) cell dysfunctions have been seen in
          XLP patients. SAP binds the cytoplasmic tail of
          Signaling lymphocytic activation molecule (SLAM), 2B4,
          Ly-9, and CD84. SAP is believed to function as a
          signaling inhibitor, by blocking or regulating binding
          of other signaling proteins. SAP and the SAP-like
          protein EAT-2 recognize the sequence motif TIpYXX[VI],
          which is found in the cytoplasmic domains of a
          restricted number of T, B, and NK cell surface
          receptors and are proposed to be natural inhibitors or
          regulators of the physiological role of a small family
          of receptors on the surface of these cells.  In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 103

 Score = 26.0 bits (57), Expect = 2.5
 Identities = 9/19 (47%), Positives = 13/19 (68%)

Query: 13 QDGDFLVRESQGSPGQYVL 31
           DG +L+R+S+  PG Y L
Sbjct: 24 LDGSYLLRDSESVPGVYCL 42


>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2
          domain-containing adapter protein F (SHF).  SHF is
          thought to play a role in PDGF-receptor signaling and
          regulation of apoptosis. SHF is mainly expressed in
          skeletal muscle, brain, liver, prostate, testis, ovary,
          small intestine, and colon. SHF contains  four putative
          tyrosine phosphorylation sites and an SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 25.8 bits (56), Expect = 2.7
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI---DPEGVVRTKDRMFESVSHLVNYHC 69
          ++  +LVR S+ S   + L+        H+ L    + + V+      F SV  +++++ 
Sbjct: 21 KEASYLVRNSETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIIHHYA 80

Query: 70 QNQLPIISAESALIL 84
            +LPI  AE   +L
Sbjct: 81 SRKLPIKGAEHMSLL 95


>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found  in Tec
           protein, Txk.  A member of the Tec protein tyrosine
           kinase Txk is expressed in thymus, spleen, lymph node, T
           lymphocytes, NK cells, mast cell lines, and myeloid cell
           line. Txk plays a role in TCR signal transduction, T
           cell development, and selection which is analogous to
           the function of Itk. Txk has been shown to interact with
           IFN-gamma. Unlike most of the Tec family members Txk
           lacks a  PH domain. Instead Txk has a unique region
           containing a palmitoylated cysteine string which has a
           similar membrane tethering function as the PH domain.
           Txk also has a zinc-binding motif, a SH3 domain, a SH2
           domain, and a protein kinase catalytic domain. The TH
           domain consists of a Zn2+-binding Btk motif and a
           proline-rich region. The Btk motif is found in Tec
           kinases, Ras GAP, and IGBP and crucial to the function
           of the PH domain. It is not present in Txk which is not
           surprising since it lacks a PH domain. The type 1 splice
           form of the Drosophila homolog also lacks both the PH
           domain and the Btk motif. The proline-rich regions are
           highly conserved for the most part with the exception of
           Bmx whose residues surrounding the PXXP motif are not
           conserved (TH-like) and Btk29A  which is entirely unique
           with large numbers of glycine residues (TH-extended).
           Tec family members all lack a C-terminal tyrosine having
           an autoinhibitory function in its phosphorylated state.
           In general SH2 domains are involved in signal
           transduction. They typically bind pTyr-containing
           ligands via two surface pockets, a pTyr and hydrophobic
           binding pocket, allowing proteins with SH2 domains to
           localize to tyrosine phosphorylated sites.
          Length = 106

 Score = 25.7 bits (56), Expect = 3.3
 Identities = 19/84 (22%), Positives = 37/84 (44%), Gaps = 14/84 (16%)

Query: 13  QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVR--------TKDRMFESVSHL 64
           ++G F+VR+S+   G Y ++ +    +     I    + +         +  +F+S+  L
Sbjct: 27  KEGAFIVRDSR-HLGSYTISVFTRARRSTEASIKHYQIKKNDSGQWYVAERHLFQSIPEL 85

Query: 65  VNYHCQNQLPIISAESALILRNPV 88
           + YH  N   ++S      LR PV
Sbjct: 86  IQYHQHNAAGLMSR-----LRYPV 104


>gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B
          lymphoid kinase (Blk).  Blk is a member of the Src
          non-receptor type tyrosine kinase family of proteins.
          Blk is expressed in the B-cells. Unlike most other Src
          members Blk lacks cysteine residues in the SH4 domain
          that undergo palmitylation. Blk is required for the
          development of IL-17-producing gamma-delta T cells.
          Furthermore, Blk is expressed in lymphoid precursors
          and, in this capacity, plays a role in regulating
          thymus cellularity during ontogeny. Blk has a unique
          N-terminal domain, an SH3 domain, an SH2 domain, a
          kinase domain and a regulatory tail, as do the other
          members of the family. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 100

 Score = 25.4 bits (55), Expect = 3.8
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 10 PSRQDGDFLVRESQGSPGQYVLT----GYQGGTKKHLLL--IDPEGVVRTKDRMFESVSH 63
          P  + G FL+RES+ + G + L+      QG   KH  +  +D  G   +    F ++  
Sbjct: 22 PMNKAGSFLIRESESNKGAFSLSVKDVTTQGEVVKHYKIRSLDNGGYYISPRITFPTLQA 81

Query: 64 LVNYHCQ 70
          LV ++ +
Sbjct: 82 LVQHYSK 88


>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2
          domain-bearing protein kinases A and C (ShkA and ShkC).
           SH2-bearing genes cloned from Dictyostelium include
          two transcription factors, STATa and STATc, and a
          signaling factor, SHK1 (shkA). A database search of the
          Dictyostelium discoideum genome revealed two additional
          putative STAT sequences, dd-STATb and dd-STATd, and
          four additional putative SHK genes, dd-SHK2 (shkB),
          dd-SHK3 (shkC), dd-SHK4 (shkD), and dd-SHK5 (shkE).
          This model contains members of shkA and shkC.  All of
          the SHK members are most closely related to the protein
          kinases found in plants.  However these kinases in
          plants are not conjugated to any SH2 or SH2-like
          sequences. Alignment data indicates that the SHK SH2
          domains carry some features of the STAT SH2 domains in
          Dictyostelium. When STATc's linker domain was used for
          a BLAST search, the sequence between the protein kinase
          domain and the SH2 domain (the linker) of SHK was
          recovered, suggesting a close relationship among these
          molecules within this region. SHK's linker domain is
          predicted to contain an alpha-helix which is indeed
          homologous to that of STAT. Based on the phylogenetic
          alignment, SH2 domains can be grouped into two
          categories, STAT-type and Src-type. SHK family members
          are in between, but are closer to the STAT-type which
          indicates a close relationship between SHK and STAT
          families in their SH2 domains and further supports the
          notion that SHKs linker-SH2 domain evolved from STAT or
          STATL (STAT-like Linker-SH2) domain found in plants. In
          SHK, STAT, and SPT6, the linker-SH2 domains all reside
          exclusively in the C-terminal regions. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 113

 Score = 25.6 bits (56), Expect = 4.0
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 15 GDFLVRESQGSPGQYVLTGY-QGGTKKHLLLIDPEGVVRTKDRMFESVSHLV 65
          G FLVR S   PG Y ++   + G   H  +  P G  +  +  + SV  L+
Sbjct: 32 GTFLVRFSTSEPGAYTISKVSKNGGISHQRIHRPGGKFQVNNSKYLSVKELI 83


>gnl|CDD|177050 CHL00128, psbW, photosystem II protein W; Reviewed.
          Length = 113

 Score = 25.4 bits (56), Expect = 4.0
 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 10/46 (21%)

Query: 44 LIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAESALILRNPVA 89
          LID EG + T+D         VN    N  P    E+  I++NP A
Sbjct: 56 LIDEEGELSTRD---------VNAKFINGKPQA-IEAIYIMKNPEA 91


>gnl|CDD|239269 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the
           different classes of PRXs including many proteins
           originally known as bacterioferritin comigratory
           proteins (BCP), based on their electrophoretic mobility
           before their function was identified. PRXs are
           thiol-specific antioxidant (TSA) proteins also known as
           TRX peroxidases and alkyl hydroperoxide reductase C22
           (AhpC) proteins. They confer a protective antioxidant
           role in cells through their peroxidase activity in which
           hydrogen peroxide, peroxynitrate, and organic
           hydroperoxides are reduced and detoxified using reducing
           equivalents derived from either TRX, glutathione,
           trypanothione and AhpF. They are distinct from other
           peroxidases in that they have no cofactors such as
           metals or prosthetic groups. The first step of
           catalysis, common to all PRXs, is the nucleophilic
           attack by the catalytic cysteine (also known as the
           peroxidatic cysteine) on the peroxide leading to
           cleavage of the oxygen-oxygen bond and the formation of
           a cysteine sulfenic acid intermediate. The second step
           of the reaction, the resolution of the intermediate,
           distinguishes the different types of PRXs. The presence
           or absence of a second cysteine (the resolving cysteine)
           classifies PRXs as either belonging to the 2-cys or
           1-cys type. The resolving cysteine of 2-cys PRXs is
           either on the same chain (atypical) or on the second
           chain (typical) of a functional homodimer. Structural
           and motif analysis of this growing family supports the
           need for a new classification system. The peroxidase
           activity of PRXs is regulated in vivo by irreversible
           cysteine over-oxidation into a sulfinic acid,
           phosphorylation and limited proteolysis.
          Length = 140

 Score = 25.2 bits (56), Expect = 6.0
 Identities = 6/17 (35%), Positives = 10/17 (58%)

Query: 36  GGTKKHLLLIDPEGVVR 52
           G   +   +IDP+G +R
Sbjct: 107 GLAARATFIIDPDGKIR 123


>gnl|CDD|198177 cd09921, SH2_Jak_family, Src homology 2 (SH2) domain in the Janus
          kinase (Jak) family.  The Janus kinases (Jak) are a
          family of 4 non-receptor tyrosine kinases (Jak1, Jak2,
          Jak3, Tyk2) which respond to cytokine or growth factor
          receptor activation. To transduce cytokine signaling, a
          series of conformational changes occur in the
          receptor-Jak complex upon extracellular ligand binding.
          This results in trans-activation of the
          receptor-associated Jaks followed by phosphorylation of
          receptor tail tyrosine sites. The Signal Transducers
          and Activators of Transcription (STAT) are then
          recruited to the receptor tail, become phosphorylated
          and translocate to the nucleus to regulate
          transcription. Jaks have four domains: the pseudokinase
          domain, the catalytic tyrosine kinase domain, the FERM
          (band four-point-one, ezrin, radixin, and moesin)
          domain, and the SH2 (Src Homology-2) domain.  The Jak
          kinases are regulated by several enzymatic and
          non-enzymatic mechanisms. First, the Jak kinase domain
          is regulated by phosphorylation of the activation loop
          which is associated with the catalytically competent
          kinase conformation and is distinct from the inactive
          kinase conformation. Second, the pseudokinase domain
          directly modulates Jak catalytic activity with the FERM
          domain maintaining an active state. Third, the
          suppressor of cytokine signaling (SOCS) family and
          tyrosine phosphatases directly regulate Jak activity.
          Dysregulation of Jak activity can manifest as either a
          reduction or an increase in kinase activity resulting
          in immunodeficiency, inflammatory diseases,
          hematological defects, autoimmune and
          myeloproliferative disorders, and susceptibility to
          infection. Altered Jak regulation occurs by many
          mechanisms, including: gene translocations, somatic or
          inherited point mutations, receptor mutations, and
          alterations in the activity of Jak regulators such as
          SOCS or phosphatases.  In general SH2 domains are
          involved in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 97

 Score = 24.6 bits (54), Expect = 6.7
 Identities = 15/70 (21%), Positives = 25/70 (35%), Gaps = 7/70 (10%)

Query: 4  IAKTAFPSRQDGDFLVRESQGSPGQYVLT----GYQGGTKKHLLLIDPEGVVRTKD---R 56
            K      + G +++RES+     Y +            K   +   EG V   D   R
Sbjct: 25 YRKLKERGNKPGSYILRESETEYDTYYIDVCVKDGSRFQTKTFKIEKKEGGVFFLDGDSR 84

Query: 57 MFESVSHLVN 66
           + S+  L+N
Sbjct: 85 EYPSLRDLLN 94


>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in
          dual adaptor for phosphotyrosine and
          3-phosphoinositides ( DAPP1)/B lymphocyte adaptor
          molecule of 32 kDa (Bam32)-like proteins.  DAPP1/Bam32
          contains a putative myristoylation site at its
          N-terminus, followed by a SH2 domain, and a pleckstrin
          homology (PH) domain at its C-terminus. DAPP1 could
          potentially be recruited to the cell membrane by any of
          these domains. Its putative myristoylation site could
          facilitate the interaction of DAPP1 with the lipid
          bilayer. Its SH2 domain may also interact with
          phosphotyrosine residues on membrane-associated
          proteins such as activated tyrosine kinase receptors.
          And finally its PH domain exhibits a high-affinity
          interaction with the PtdIns(3,4,5)P(3) PtdIns(3,4)P(2)
          second messengers produced at the cell membrane
          following the activation of PI 3-kinases. DAPP1 is
          thought to interact with both tyrosine phosphorylated
          proteins and 3-phosphoinositides and therefore may play
          a role in regulating the location and/or activity of
          such proteins(s) in response to agonists that elevate
          PtdIns(3,4,5)P(3) and PtdIns(3,4)P(2). This protein is
          likely to play an important role in triggering signal
          transduction pathways that lie downstream from receptor
          tyrosine kinases and PI 3-kinase. It is likely that
          DAPP1 functions as an adaptor to recruit other proteins
          to the plasma membrane in response to extracellular
          signals. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 92

 Score = 24.7 bits (54), Expect = 7.0
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 2/68 (2%)

Query: 13 QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQ 72
           DG +L+R S    G + L+     + KH  +       +     F S+   V  H  NQ
Sbjct: 27 VDGSYLLRNSNEGTGLFSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLQDFVK-HFANQ 85

Query: 73 LPIISAES 80
           P+I +E+
Sbjct: 86 -PLIGSET 92


>gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in
          SLAM-associated protein (SAP)1.  The X-linked
          lymphoproliferative syndrome (XLP) gene encodes SAP
          (also called SH2D1A/DSHP) a protein that consists of a
          5 residue N-terminus, a single SH2 domain, and a short
          25 residue C-terminal tail.  XLP is characterized by an
          extreme sensitivity to Epstein-Barr virus.  Both T and
          natural killer (NK) cell dysfunctions have been seen in
          XLP patients. SAP binds the cytoplasmic tail of
          Signaling lymphocytic activation molecule (SLAM), 2B4,
          Ly-9, and CD84. SAP is believed to function as a
          signaling inhibitor, by blocking or regulating binding
          of other signaling proteins. SAP and the SAP-like
          protein EAT-2 recognize the sequence motif TIpYXX[VI],
          which is found in the cytoplasmic domains of a
          restricted number of T, B, and NK cell surface
          receptors and are proposed to be natural inhibitors or
          regulators of the physiological role of a small family
          of receptors on the surface of these cells.  In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 103

 Score = 24.6 bits (53), Expect = 7.1
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 14 DGDFLVRESQGSPGQYVL 31
          DG +L+R+S+  PG Y L
Sbjct: 25 DGSYLLRDSESVPGVYCL 42


>gnl|CDD|234571 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.
          Length = 416

 Score = 25.0 bits (56), Expect = 7.8
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 4/20 (20%)

Query: 36  GGTKKHLLLIDPEGVVRTKD 55
           GGT  HL+L+D    +R+K 
Sbjct: 309 GGTDNHLVLVD----LRSKG 324


>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2
          (SH2) domain found in Zeta-chain-associated protein
          kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk)
          proteins.  ZAP-70 and Syk comprise a family of
          hematopoietic cell specific protein tyrosine kinases
          (PTKs) that are required for antigen and antibody
          receptor function. ZAP-70 is expressed in T and natural
          killer (NK) cells and Syk is expressed in B cells, mast
          cells, polymorphonuclear leukocytes, platelets,
          macrophages, and immature T cells. They are required
          for the proper development of T and B cells, immune
          receptors, and activating NK cells. They consist of two
          N-terminal Src homology 2 (SH2) domains and a
          C-terminal kinase domain separated from the SH2 domains
          by a linker or hinge region. Phosphorylation of both
          tyrosine residues within the Immunoreceptor
          Tyrosine-based Activation Motifs (ITAM; consensus
          sequence Yxx[LI]x(7,8)Yxx[LI]) by the Src-family PTKs
          is required for efficient interaction of ZAP-70 and Syk
          with the receptor subunits and for receptor function.
          ZAP-70 forms two phosphotyrosine binding pockets, one
          of which is shared by both SH2 domains.  In Syk the two
          SH2 domains do not form such a phosphotyrosine-binding
          site.  The SH2 domains here are believed to function
          independently. In addition, the two SH2 domains of Syk
          display flexibility in their relative orientation,
          allowing Syk to accommodate a greater variety of
          spacing sequences between the ITAM phosphotyrosines and
          singly phosphorylated non-classical ITAM ligands. This
          model contains the N-terminus SH2 domains of both Syk
          and Zap70. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 24.7 bits (54), Expect = 8.4
 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 2/59 (3%)

Query: 14 DGDFLVRESQGSPGQYVLTGYQGGTKKHLLL-IDPEGVVRTKD-RMFESVSHLVNYHCQ 70
          DG FL+R+S  S G YVL+   G    H  +     G       +     + L  YH  
Sbjct: 24 DGLFLLRQSLRSLGGYVLSVCHGRKFHHYTIERQLNGTYAIAGGKAHCGPAELCEYHST 82


>gnl|CDD|184990 PRK15030, PRK15030, multidrug efflux system transporter AcrA;
           Provisional.
          Length = 397

 Score = 25.1 bits (54), Expect = 9.7
 Identities = 9/28 (32%), Positives = 15/28 (53%)

Query: 26  PGQYVLTGYQGGTKKHLLLIDPEGVVRT 53
           PG +V    + G   + +L+  +GV RT
Sbjct: 289 PGMFVRARLEEGLNPNAILVPQQGVTRT 316


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0772    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,924,696
Number of extensions: 395103
Number of successful extensions: 387
Number of sequences better than 10.0: 1
Number of HSP's gapped: 369
Number of HSP's successfully gapped: 78
Length of query: 101
Length of database: 10,937,602
Length adjustment: 67
Effective length of query: 34
Effective length of database: 7,965,884
Effective search space: 270840056
Effective search space used: 270840056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (24.1 bits)