Diaphorina citri psyllid: psy8460

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MGQKRSLMYLGRNSLISHPQDEDPDEGVRDLVELALRKMDYDKDGKISFQDFQQSVTDEPLLLEAFGQCLPSDAARQSFLSTLQAC
cccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHc
**QKRSLMYLGRN****************DLVELALRKMDYDKDGKISFQDFQQSVTDEPLLLEAFGQCLPSDAARQSFLSTLQAC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQKRSLMYLGRNSLISHPQDEDPDEGVRDLVELALRKMDYDKDGKISFQDFQQSVTDEPLLLEAFGQCLPSDAARQSFLSTLQAC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
EF-hand calcium-binding domain-containing protein 1 confidentQ32L26
EF-hand calcium-binding domain-containing protein 1 confidentQ9D3N2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L4H, chain A
Confidence level:confident
Coverage over the Query: 2-70
View the alignment between query and template
View the model in PyMOL