Diaphorina citri psyllid: psy8501


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MASRGMYVTGTDGTDFSHRQQIASHYQTSVLNKTRLKYTIFFHYLLFFVMLAKLSADILDRLDIFILEIEELLIPKPLLWEYIWCFSLLVSFLGLSSIRKNNISTMKKYVYGIVAFGYMPILYAVIYYFHDFWTYITLDPDEDIEDKEITMWQGYPYALLWYIFIVLALQVHTFSLYFSNNLIQCWRLRAAIKKQ
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
***************FSHRQQIASHYQTSVLNKTRLKYTIFFHYLLFFVMLAKLSADILDRLDIFILEIEELLIPKPLLWEYIWCFSLLVSFLGLSSIRKNNISTMKKYVYGIVAFGYMPILYAVIYYFHDFWTYITLDPDEDIEDKEITMWQGYPYALLWYIFIVLALQVHTFSLYFSNNLIQCWRLRA*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRGMYVTGTDGTDFSHRQQIASHYQTSVLNKTRLKYTIFFHYLLFFVMLAKLSADILDRLDIFILEIEELLIPKPLLWEYIWCFSLLVSFLGLSSIRKNNISTMKKYVYGIVAFGYMPILYAVIYYFHDFWTYITLDPDEDIEDKEITMWQGYPYALLWYIFIVLALQVHTFSLYFSNNLIQCWRLRAAIKKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein jagunal Required for endoplasmic reticulum organization and proper vesicular traffic during vitellogenesis. Required for oocyte and bristle growth.very confidentQ7K1V5
Protein jagunal Required for endoplasmic reticulum organization and proper vesicular traffic during vitellogenesis. Required for oocyte and bristle growth.very confidentQ297K8
Protein jagunal homolog 1 May be required for endoplasmic reticulum organization.confidentQ5XKN4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0007296 [BP]vitellogenesisprobableGO:0044702, GO:0048610, GO:0000003, GO:0032504, GO:0007028, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0007276, GO:0048609
GO:0006887 [BP]exocytosisprobableGO:0046903, GO:0009987, GO:0016192, GO:0006810, GO:0044765, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0008407 [BP]chaeta morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0022416
GO:0051686 [BP]establishment of ER localizationprobableGO:0051656, GO:0009987, GO:0051179, GO:0044763, GO:0044699, GO:0051649, GO:0008150, GO:0051234, GO:0051643, GO:0051640, GO:0051641
GO:0001555 [BP]oocyte growthprobableGO:0048610, GO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007276, GO:0016049, GO:0000003, GO:0048869, GO:0009994, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0040007, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0007029 [BP]endoplasmic reticulum organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted