Diaphorina citri psyllid: psy8504


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MALIKYWDPVKSQAGVGILGCCLISFSILAGLGFCSILGIPFNASTTQIVPFLALGLSVDDMFLITKTFAKYTSKNQFDSECTGIVLRKTGLSIILSSVCKSVAFFSASLIPIPALRVFNLQLAILILFNMFVLLLVYPAIVSLDLRRSR
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
**LIKYWDPVKSQAGVGILGCCLISFSILAGLGFCSILGIPFNASTTQIVPFLALGLSVDDMFLITKTFAKYTSKNQFDSECTGIVLRKTGLSIILSSVCKSVAFFSASLIPIPALRVFNLQLAILILFNMFVLLLVYPAIVSLDLRRS*
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIKYWDPVKSQAGVGILGCCLISFSILAGLGFCSILGIPFNASTTQIVPFLALGLSVDDMFLITKTFAKYTSKNQFDSECTGIVLRKTGLSIILSSVCKSVAFFSASLIPIPALRVFNLQLAILILFNMFVLLLVYPAIVSLDLRRSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein patched homolog 1 Acts as a receptor for sonic hedgehog (SHH), indian hedgehog (IHH) and desert hedgehog (DHH). Associates with the smoothened protein (SMO) to transduce the hedgehog's proteins signal. Seems to have a tumor suppressor function, as inactivation of this protein is probably a necessary, if not sufficient step for tumorigenesis.confidentQ61115
Protein patched homolog 1 Acts as a receptor for sonic hedgehog (SHH), indian hedgehog (IHH) and desert hedgehog (DHH). Associates with the smoothened protein (SMO) to transduce the hedgehog's proteins signal. Seems to have a tumor suppressor function, as inactivation of this protein is probably a necessary, if not sufficient step for tumorigenesis.confidentQ13635

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0072001 [BP]renal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0001655, GO:0048731, GO:0007275, GO:0044699
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0021532 [BP]neural tube patterningprobableGO:0032502, GO:0007389, GO:0032501, GO:0021915, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0010875 [BP]positive regulation of cholesterol effluxprobableGO:0032368, GO:0051050, GO:0032374, GO:0032376, GO:0032371, GO:0032370, GO:0032373, GO:0065007, GO:0051049, GO:0048518, GO:0008150, GO:0032879, GO:0050789, GO:0010874
GO:0045668 [BP]negative regulation of osteoblast differentiationprobableGO:0051093, GO:0050793, GO:0045595, GO:0050794, GO:0008150, GO:0045596, GO:0045667, GO:0065007, GO:0051239, GO:0048519, GO:0030278, GO:0050789, GO:0048523
GO:0044295 [CC]axonal growth coneprobableGO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0044294 [CC]dendritic growth coneprobableGO:0044292, GO:0044463, GO:0030427, GO:0030426, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0044464, GO:0042995
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0007224 [BP]smoothened signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0072661 [BP]protein targeting to plasma membraneprobableGO:0008104, GO:0006612, GO:0061024, GO:0007009, GO:0090002, GO:0044699, GO:0072659, GO:0070727, GO:0016044, GO:0006886, GO:0016043, GO:0071840, GO:0071702, GO:0033036, GO:0006810, GO:0034613, GO:0006605, GO:0045184, GO:0044765, GO:0044763, GO:0072657, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0090150, GO:0015031, GO:0008150, GO:0009987
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0030182 [BP]neuron differentiationprobableGO:0032502, GO:0048699, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0060037 [BP]pharyngeal system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0043433 [BP]negative regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0044092, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0051252, GO:0010468
GO:0010157 [BP]response to chlorateprobableGO:1901700, GO:0042221, GO:0050896, GO:0010035, GO:0008150
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0008544 [BP]epidermis developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005119 [MF]smoothened bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0035108 [BP]limb morphogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0060173, GO:0035107, GO:0044767, GO:0032501, GO:0008150, GO:0044699, GO:0009653, GO:0007275, GO:0048736
GO:0097108 [MF]hedgehog family protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005113 [MF]patched bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015485 [MF]cholesterol bindingprobableGO:0032934, GO:0043178, GO:0097159, GO:0008289, GO:0036094, GO:0003674, GO:0005488, GO:0005496
GO:0001841 [BP]neural tube formationprobableGO:0048598, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0035239, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0021915, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0001838, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0072372 [CC]primary ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AQP, chain A
Confidence level:confident
Coverage over the Query: 13-148
View the alignment between query and template
View the model in PyMOL