Diaphorina citri psyllid: psy8507


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MRVPNIVKNDDGGLPGNFWLELFRDWLLGLQESFDKDYAAGCITQERWFPNASESSILAYKLLVQTGRVDNPVDKSLIKHNRLVSRDGIINPKLLLVMYLMNIKLNPISCVLIVNSSGIYIHFISYICLSFLTCIGNRDRRVRLSIEHMYSVVLHAGLILLVAISILAFSEFQFILRIFFYMLFGIVLVGLLYMVLL
cccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcc
*RVPNIVKNDDGGLPGNFWLELFRDWLLGLQESFDKDYAAGCITQERWFPNASESSILAYKLLVQTGRVDNPVDKSLIKHNRLVSRDGIINPKLLLVMYLMNIKLNPISCVLIVNSSGIYIHFISYICLSFLTCIGNRDRRVRLSIEHMYSVVLHAGLILLVAISILAFSEFQFILRIFFYMLFGIVLVGLLYMVLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVPNIVKNDDGGLPGNFWLELFRDWLLGLQESFDKDYAAGCITQERWFPNASESSILAYKLLVQTGRVDNPVDKSLIKHNRLVSRDGIINPKLLLVMYLMNIKLNPISCVLIVNSSGIYIHFISYICLSFLTCIGNRDRRVRLSIEHMYSVVLHAGLILLVAISILAFSEFQFILRIFFYMLFGIVLVGLLYMVLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein patched Segmentation polarity protein. Acts as a receptor for the hedgehog protein (HH). Associates with the smoothened protein (SMO) to transduce the hedgehog signal leading to the activation of wingless, decapentaplegic and patched itself. Participates in cell interactions that establish pattern within the segment and the imaginal disks during development. In the absence of HH, represses the constitutive signaling activity of smo through fused (FU).confidentP18502

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030228 [MF]lipoprotein particle receptor activityprobableGO:0038024, GO:0003674, GO:0004872
GO:0051049 [BP]regulation of transportprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AQP, chain A
Confidence level:probable
Coverage over the Query: 97-196
View the alignment between query and template
View the model in PyMOL