Diaphorina citri psyllid: psy8508

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------

MSAPSKKAARLPAENESSGSEYDSDAEEEGYTGGEEIQVTFEGRSAIDSDFHGVKQLLKQLFLKAHINLSELTDVIISQSNIGSVVKQSTADEDMDDDDDESDVNDVFGITTVINITNKKHIECVQQLRSLLSELAEEHADDRIKAFVNKILTDDTQNVGLIINERFVNIPPQISVPLLQGLSKEIQQAKDKKMPYDFQHYILISKLYKSDGSKKKKNKVTGQTDPDILFSNAEEEVFDEVSIKDY

ccccHHHHcccccccccccccccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHccccccEEEEEccccccccccccccccccCEEEEEEEEccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccccccccccccccccccccccHHHHHHHHccccc

************************************IQVTFEGRSAIDSDFHGVKQLLKQLFLKAHINLSELTDVIISQSNIGSVVKQ**************DVNDVFGITTVINITNKKHIECVQQLRSLLSELAEEHADDRIKAFVNKILTDDTQNVGLIINERFVNIPPQISVPLLQGLSKEIQQAKDKKMPYDFQHYILISKLY*********************FSNAEEEVFDEVSI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BRCA2 and CDKN1A-interacting protein	May promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A. May be required for repair of DNA damage by homologous recombination in conjunction with BRCA2. May not be involved in non-homologous end joining (NHEJ).	confident	Q9P287
Protein BCCIP homolog		confident	O64885
Protein BCP1	Involved in nuclear export, actin cytoskeleton organization and vesicular transport.	confident	Q6C7K5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019908 [CC]	nuclear cyclin-dependent protein kinase holoenzyme complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0000307, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0043226, GO:0044424, GO:0043227, GO:0005634, GO:0044422
GO:0061101 [BP]	neuroendocrine cell differentiation	probable	GO:0032502, GO:0030154, GO:0048856, GO:0048869, GO:0060429, GO:0009888, GO:0044763, GO:0030855, GO:0060563, GO:0008150, GO:0009987, GO:0044699, GO:0002065
GO:0019207 [MF]	kinase regulator activity	probable	GO:0030234, GO:0003674
GO:0005635 [CC]	nuclear envelope	probable	GO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000079 [BP]	regulation of cyclin-dependent protein serine/threonine kinase activity	probable	GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0071900, GO:0050789, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051726, GO:0051338, GO:0001932

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!