Diaphorina citri psyllid: psy8536

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------

KTRTKDKYRVVYSDQQRLELEKEFHYSRYITIRRKAELANSLGLSERQVKIWFQNRRAKERKQLKKREEVVIKDPSKDLFLSNKVMYTYLVFQVKIWFQNRRAKERKQLKKREEVVIKDPSKDLFLSNKVMIRKISVSPPFSFRSSETTATSYILDIDTRKTRTKDKYRVVYSDQQRLELEKEFHY

cccccccccEEEccHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHcHHHHHHHHcHHHHHHHHHccccHcccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********VYSDQQRLELEKEFHYSRYITIRRKAELANSLGLSERQVKIWFQNRRA******************************YLVFQVKIWFQNR***************I*****DLFLSNKV****ISVSPPFSF*****TATSYILDIDTRKTRTKDKYRVVYSDQQRLELEK**H*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

KTRTKDKYRVVYSDQQRLELEKEFHYSRYITIRRKAELANSLGLSERQVKIWFQNRRAKERKQLKKREEVVIKDPSKDLFLSNKVMYTYLVFQVKIWFQNRRAKERKQLKKREEVVIKDPSKDLFLSNKVMIRKISVSPPFSFRSSETTATSYILDIDTRKTRTKDKYRVVYSDQQRLELEKEFHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox protein CDX-1 (Fragment)	Could play a role in the terminal differentiation of the intestine.	confident	Q05095

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0001756 [BP]	somitogenesis	probable	GO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0048568 [BP]	embryonic organ development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0009948 [BP]	anterior/posterior axis specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0008150, GO:0003002, GO:0009798, GO:0007275, GO:0044699
GO:0048705 [BP]	skeletal system morphogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0048706 [BP]	embryonic skeletal system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009790, GO:0048856, GO:0044767, GO:0001501, GO:0009792, GO:0008150, GO:0048731, GO:0043009, GO:0007275, GO:0044699
GO:0048793 [BP]	pronephros development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0000976 [MF]	transcription regulatory region sequence-specific DNA binding	probable	GO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0048384 [BP]	retinoic acid receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0031016 [BP]	pancreas development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030097 [BP]	hemopoiesis	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0021906 [BP]	hindbrain-spinal cord boundary formation	probable	GO:0021903, GO:0044707, GO:0021532, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0021915, GO:0044767, GO:0008150, GO:0003002, GO:0048859, GO:0009952, GO:0007399, GO:0048856, GO:0048731

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A01, chain A
Confidence level:very confident
Coverage over the Query: 2-60
View the alignment between query and template
View the model in PyMOL

Template: 1B72, chain A
Confidence level:confident
Coverage over the Query: 47-111
View the alignment between query and template
View the model in PyMOL

Template: 1B8I, chain A
Confidence level:confident
Coverage over the Query: 152-157,169-185
View the alignment between query and template
View the model in PyMOL