Query         psy8538
Match_columns 64
No_of_seqs    123 out of 1048
Neff          7.3 
Searched_HMMs 46136
Date          Fri Aug 16 21:27:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8538.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8538hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0848|consensus               99.7 2.3E-18   5E-23  113.2   1.5   48    2-49    214-261 (317)
  2 KOG0487|consensus               99.7 1.7E-18 3.7E-23  115.4   0.4   51    2-52    250-300 (308)
  3 KOG0842|consensus               99.7 5.3E-18 1.1E-22  113.0   2.7   51    2-53    168-218 (307)
  4 KOG0488|consensus               99.7 3.9E-18 8.5E-23  113.8   1.6   58    2-61    187-244 (309)
  5 KOG0489|consensus               99.7 9.6E-19 2.1E-23  114.3  -1.7   51    2-52    174-224 (261)
  6 KOG0843|consensus               99.7 1.8E-17 3.9E-22  103.8   1.6   48    2-49    117-164 (197)
  7 KOG0484|consensus               99.6   7E-17 1.5E-21   94.1   0.2   55    2-56     32-86  (125)
  8 KOG0485|consensus               99.6   6E-17 1.3E-21  104.3  -0.7   45    1-45    118-162 (268)
  9 KOG0850|consensus               99.6 1.8E-16 3.8E-21  102.3   0.3   47    1-47    136-182 (245)
 10 KOG0492|consensus               99.6 6.1E-16 1.3E-20   99.0   1.2   45    1-45    158-202 (246)
 11 KOG0483|consensus               99.6 1.5E-15 3.2E-20   96.4   1.9   48    1-48     64-111 (198)
 12 PF00046 Homeobox:  Homeobox do  99.5 4.8E-16   1E-20   80.6  -2.6   43    2-44     15-57  (57)
 13 smart00389 HOX Homeodomain. DN  99.5 5.9E-15 1.3E-19   75.8   0.1   43    1-43     14-56  (56)
 14 cd00086 homeodomain Homeodomai  99.5 4.3E-15 9.3E-20   76.8  -0.5   45    1-45     14-58  (59)
 15 COG5576 Homeodomain-containing  99.5 1.1E-14 2.4E-19   89.6   1.1   44    2-45     66-109 (156)
 16 KOG2251|consensus               99.4 6.8E-14 1.5E-18   89.8   2.7   47    2-48     52-98  (228)
 17 KOG0494|consensus               99.4 3.3E-14 7.2E-19   93.6   1.0   48    2-49    156-203 (332)
 18 KOG0491|consensus               99.4 2.7E-14   6E-19   88.8  -1.1   47    2-48    115-161 (194)
 19 KOG0844|consensus               99.4 1.2E-13 2.6E-18   92.7   1.3   47    2-49    196-242 (408)
 20 KOG0493|consensus               99.3 2.1E-13 4.6E-18   90.0   0.2   44    2-45    261-304 (342)
 21 TIGR01565 homeo_ZF_HD homeobox  99.3 1.3E-12 2.7E-17   69.0   2.6   38    2-39     16-57  (58)
 22 KOG3802|consensus               99.2 4.2E-12   9E-17   87.0   2.8   47    1-47    308-354 (398)
 23 KOG0847|consensus               99.2 1.1E-12 2.5E-17   84.9  -0.2   45    1-45    181-225 (288)
 24 KOG4577|consensus               99.2 4.4E-12 9.5E-17   84.8   1.0   47    2-48    182-228 (383)
 25 KOG0486|consensus               99.1 2.5E-11 5.5E-16   81.5   2.7   56    2-58    127-182 (351)
 26 KOG0775|consensus               99.1 2.3E-11 4.9E-16   80.5   1.9   43    2-44    191-233 (304)
 27 KOG0490|consensus               99.1 1.8E-11 3.8E-16   77.1   0.6   46    1-46     74-119 (235)
 28 KOG0849|consensus               98.8 7.8E-10 1.7E-14   75.2   0.7   46    1-46    190-235 (354)
 29 PF05920 Homeobox_KN:  Homeobox  98.7 8.9E-10 1.9E-14   54.2  -1.8   32    8-39      7-38  (40)
 30 KOG1168|consensus               98.6 1.4E-08   3E-13   68.2   1.7   47    2-48    324-370 (385)
 31 KOG0774|consensus               98.1 2.2E-06 4.7E-11   57.1   2.9   44    2-45    203-249 (334)
 32 KOG0490|consensus               97.8 7.3E-06 1.6E-10   51.5   0.9   44    2-45    168-211 (235)
 33 PF11569 Homez:  Homeodomain le  97.3 2.4E-05 5.1E-10   41.0  -1.2   39    2-40     13-51  (56)
 34 KOG2252|consensus               97.1 0.00021 4.6E-09   51.3   1.0   40    2-41    435-474 (558)
 35 KOG0773|consensus               96.9 0.00044 9.6E-09   46.4   1.5   37    9-45    264-300 (342)
 36 KOG1146|consensus               96.7 0.00061 1.3E-08   53.0   1.1   41    5-45    921-961 (1406)
 37 KOG3623|consensus               94.5  0.0093   2E-07   44.8  -0.2   44    2-45    571-614 (1007)
 38 PF10668 Phage_terminase:  Phag  86.6    0.21 4.6E-06   26.4   0.1   18   17-34     25-42  (60)
 39 PF04218 CENP-B_N:  CENP-B N-te  81.8    0.43 9.4E-06   24.2  -0.0   24   16-39     24-47  (53)
 40 PF13518 HTH_28:  Helix-turn-he  78.1    0.65 1.4E-05   22.5  -0.1   23   17-39     15-37  (52)
 41 PRK10072 putative transcriptio  77.5     1.6 3.4E-05   24.9   1.4   24   17-40     49-72  (96)
 42 PF06056 Terminase_5:  Putative  74.1     1.2 2.6E-05   23.0   0.3   21   17-37     16-36  (58)
 43 cd04761 HTH_MerR-SF Helix-Turn  70.8     1.1 2.3E-05   21.4  -0.4   22   18-39      4-25  (49)
 44 PF13384 HTH_23:  Homeodomain-l  69.0     1.1 2.3E-05   21.7  -0.6   23   17-39     20-42  (50)
 45 PF13411 MerR_1:  MerR HTH fami  64.3       2 4.4E-05   21.9  -0.1   21   18-38      4-24  (69)
 46 cd02413 40S_S3_KH K homology R  63.9     6.1 0.00013   21.7   1.7   21   16-36     55-75  (81)
 47 TIGR03879 near_KaiC_dom probab  62.5    0.54 1.2E-05   25.7  -2.6   34    6-39     24-57  (73)
 48 cd04762 HTH_MerR-trunc Helix-T  62.4     2.4 5.3E-05   19.6  -0.1   22   18-39      4-25  (49)
 49 COG2944 Predicted transcriptio  59.2       6 0.00013   23.0   1.2   40   18-60     61-100 (104)
 50 PF13443 HTH_26:  Cro/C1-type H  58.1     2.7 5.9E-05   21.1  -0.3   23   17-39     13-35  (63)
 51 cd04764 HTH_MlrA-like_sg1 Heli  57.4     3.3 7.2E-05   21.2  -0.1   20   18-37      4-23  (67)
 52 PF09607 BrkDBD:  Brinker DNA-b  55.9     1.9 4.1E-05   22.6  -1.1   17   20-36     31-47  (58)
 53 cd01392 HTH_LacI Helix-turn-he  55.8     2.7 5.8E-05   20.3  -0.6   22   19-40      2-23  (52)
 54 PF00376 MerR:  MerR family reg  51.1     3.3 7.2E-05   19.5  -0.6   19   18-36      3-21  (38)
 55 cd01104 HTH_MlrA-CarA Helix-Tu  50.1     5.4 0.00012   20.2   0.0   20   18-37      4-23  (68)
 56 PF08281 Sigma70_r4_2:  Sigma-7  50.0     2.5 5.5E-05   20.7  -1.2   23   15-37     27-49  (54)
 57 PF01381 HTH_3:  Helix-turn-hel  49.6     5.5 0.00012   19.3   0.0   23   17-39     12-34  (55)
 58 cd04763 HTH_MlrA-like Helix-Tu  49.1     5.3 0.00012   20.5  -0.1   20   18-37      4-23  (68)
 59 TIGR01764 excise DNA binding d  48.8     5.3 0.00012   18.5  -0.1   22   18-39      5-26  (49)
 60 TIGR03070 couple_hipB transcri  48.0     7.9 0.00017   18.5   0.4   23   17-39     18-40  (58)
 61 smart00422 HTH_MERR helix_turn  46.9       6 0.00013   20.1  -0.1   20   18-37      4-23  (70)
 62 PF01527 HTH_Tnp_1:  Transposas  45.8     5.8 0.00013   20.5  -0.3   22   16-37     25-46  (76)
 63 cd00093 HTH_XRE Helix-turn-hel  44.9     8.5 0.00018   17.4   0.3   22   18-39     16-37  (58)
 64 PRK09643 RNA polymerase sigma   44.7      16 0.00034   22.4   1.5   40   17-62    153-192 (192)
 65 PF12728 HTH_17:  Helix-turn-he  42.9     7.3 0.00016   18.8  -0.2   22   18-39      5-26  (51)
 66 cd00569 HTH_Hin_like Helix-tur  42.7     9.8 0.00021   15.5   0.3   18   17-34     24-41  (42)
 67 cd06171 Sigma70_r4 Sigma70, re  42.6       6 0.00013   18.2  -0.5   21   17-37     29-49  (55)
 68 COG5484 Uncharacterized conser  41.4      12 0.00025   25.3   0.6   22   16-37     21-42  (279)
 69 PHA00542 putative Cro-like pro  39.4      22 0.00047   19.2   1.4   40   17-56     34-75  (82)
 70 PHA01976 helix-turn-helix prot  38.9      12 0.00027   18.8   0.3   23   17-39     18-40  (67)
 71 TIGR02607 antidote_HigA addict  38.5      12 0.00027   19.3   0.3   23   17-39     21-43  (78)
 72 PF14229 DUF4332:  Domain of un  38.3      15 0.00032   21.5   0.6   23   12-34     27-49  (122)
 73 PHA02955 hypothetical protein;  36.7      41 0.00089   22.0   2.5   28   11-38     76-103 (213)
 74 PF13404 HTH_AsnC-type:  AsnC-t  36.2      12 0.00026   17.9   0.0   16   17-32     20-35  (42)
 75 PF04936 DUF658:  Protein of un  36.1      13 0.00028   23.6   0.2   28   16-43     16-43  (186)
 76 cd01106 HTH_TipAL-Mta Helix-Tu  36.0      11 0.00023   21.1  -0.2   22   18-39      4-25  (103)
 77 smart00530 HTH_XRE Helix-turn-  36.0      16 0.00035   16.2   0.5   23   17-39     13-35  (56)
 78 COG1905 NuoE NADH:ubiquinone o  35.8      25 0.00054   21.9   1.4   31    2-32     31-61  (160)
 79 PRK09413 IS2 repressor TnpA; R  35.7      12 0.00025   21.6  -0.1   21   17-37     32-52  (121)
 80 PF13542 HTH_Tnp_ISL3:  Helix-t  35.6      10 0.00022   18.2  -0.3   19   17-35     30-48  (52)
 81 PRK13890 conjugal transfer pro  35.3      15 0.00033   21.3   0.4   23   17-39     21-43  (120)
 82 PF01710 HTH_Tnp_IS630:  Transp  35.2     9.7 0.00021   22.0  -0.5   21   17-37     21-41  (119)
 83 PF06971 Put_DNA-bind_N:  Putat  35.1      12 0.00026   18.9  -0.1   15   18-32     32-46  (50)
 84 cd01105 HTH_GlnR-like Helix-Tu  34.9      11 0.00023   20.6  -0.3   18   18-35      5-22  (88)
 85 PF14549 P22_Cro:  DNA-binding   34.6     9.9 0.00022   19.8  -0.5   17   18-34     13-29  (60)
 86 PF13551 HTH_29:  Winged helix-  33.5     9.8 0.00021   20.8  -0.6   23   17-39     15-37  (112)
 87 PRK09706 transcriptional repre  33.3      17 0.00037   21.2   0.3   24   17-40     21-44  (135)
 88 PF08279 HTH_11:  HTH domain;    33.1      12 0.00027   18.1  -0.2   16   17-32     18-33  (55)
 89 cd06170 LuxR_C_like C-terminal  33.0      14  0.0003   17.4  -0.0   20   17-36     18-37  (57)
 90 cd04766 HTH_HspR Helix-Turn-He  32.9      15 0.00032   20.0   0.1   22   17-38      4-25  (91)
 91 cd01798 parkin_N amino-termina  32.4      34 0.00073   17.5   1.4   28   15-42     23-50  (70)
 92 PRK05988 formate dehydrogenase  32.1      27 0.00059   21.3   1.1   25    8-32     35-59  (156)
 93 cd08313 Death_TNFR1 Death doma  32.1      37  0.0008   18.6   1.6   19   14-32     11-29  (80)
 94 cd01796 DDI1_N DNA damage indu  31.4      35 0.00076   17.7   1.4   26   15-40     24-49  (71)
 95 PF03584 Herpes_ICP4_N:  Herpes  31.4      92   0.002   19.8   3.4   46   15-61     61-106 (173)
 96 PTZ00044 ubiquitin; Provisiona  31.3      34 0.00074   17.6   1.3   28   15-42     25-52  (76)
 97 PF08765 Mor:  Mor transcriptio  30.8      16 0.00034   20.8  -0.1   17   16-32     74-90  (108)
 98 PF05269 Phage_CII:  Bacterioph  30.4      32 0.00069   19.5   1.1   19   18-36     27-45  (91)
 99 cd01793 Fubi Fubi ubiquitin-li  30.0      39 0.00084   17.5   1.4   28   16-43     24-51  (74)
100 TIGR01958 nuoE_fam NADH-quinon  29.9      30 0.00065   20.7   1.0   24    9-32     29-52  (148)
101 smart00421 HTH_LUXR helix_turn  29.8      17 0.00037   17.0  -0.1   21   17-37     21-41  (58)
102 cd00592 HTH_MerR-like Helix-Tu  29.8      17 0.00037   19.9  -0.1   21   18-38      4-24  (100)
103 PF07471 Phage_Nu1:  Phage DNA   29.8      16 0.00036   22.6  -0.1   21   17-37      5-25  (164)
104 cd04789 HTH_Cfa Helix-Turn-Hel  29.7      15 0.00033   20.6  -0.3   22   17-38      4-25  (102)
105 cd04775 HTH_Cfa-like Helix-Tur  29.4      16 0.00034   20.5  -0.3   21   17-37      4-24  (102)
106 cd04788 HTH_NolA-AlbR Helix-Tu  29.2      16 0.00034   20.3  -0.3   21   18-38      4-24  (96)
107 PF08280 HTH_Mga:  M protein tr  29.2      16 0.00034   18.5  -0.2   16   18-33     23-38  (59)
108 TIGR03830 CxxCG_CxxCG_HTH puta  28.9      49  0.0011   18.6   1.8   22   18-39     82-103 (127)
109 cd04774 HTH_YfmP Helix-Turn-He  28.9      19 0.00041   20.0   0.1   21   18-38      4-24  (96)
110 cd01769 UBL Ubiquitin-like dom  28.8      42 0.00092   16.4   1.4   25   15-39     22-46  (69)
111 cd04779 HTH_MerR-like_sg4 Heli  28.7      14 0.00031   22.0  -0.5   22   18-39      4-25  (134)
112 cd04768 HTH_BmrR-like Helix-Tu  28.4      18 0.00039   20.0  -0.1   21   18-38      4-24  (96)
113 TIGR03826 YvyF flagellar opero  28.0      18 0.00038   22.0  -0.2   29   16-44     48-76  (137)
114 PRK07539 NADH dehydrogenase su  27.8      34 0.00074   20.6   1.0   25    8-32     34-58  (154)
115 PF13560 HTH_31:  Helix-turn-he  27.6      19 0.00041   18.1  -0.1   24   17-40     17-40  (64)
116 cd04773 HTH_TioE_rpt2 Second H  27.6      23 0.00049   20.1   0.2   21   18-38      4-24  (108)
117 PF08452 DNAP_B_exo_N:  DNA pol  27.2      23  0.0005   15.0   0.1    7   33-39      7-13  (22)
118 cd04780 HTH_MerR-like_sg5 Heli  27.0      18 0.00039   20.1  -0.3   20   18-37      4-23  (95)
119 PRK11511 DNA-binding transcrip  26.9      16 0.00035   21.1  -0.5   23   16-38     27-49  (127)
120 PRK09726 antitoxin HipB; Provi  26.8      27 0.00059   18.9   0.4   23   17-39     28-50  (88)
121 cd01109 HTH_YyaN Helix-Turn-He  26.7      20 0.00043   20.3  -0.1   20   18-37      4-23  (113)
122 cd01111 HTH_MerD Helix-Turn-He  26.1      19 0.00042   20.5  -0.3   21   18-38      4-24  (107)
123 cd04782 HTH_BltR Helix-Turn-He  26.0      19 0.00042   19.9  -0.3   21   18-38      4-24  (97)
124 cd01107 HTH_BmrR Helix-Turn-He  25.7      22 0.00047   20.1  -0.1   21   18-38      4-24  (108)
125 cd08306 Death_FADD Fas-associa  25.6      27 0.00059   19.1   0.3   21   17-37     16-36  (86)
126 cd01803 Ubiquitin Ubiquitin. U  24.6      50  0.0011   16.7   1.2   26   14-39     24-49  (76)
127 COG0789 SoxR Predicted transcr  24.5      23 0.00049   20.0  -0.2   18   18-35      4-21  (124)
128 TIGR02054 MerD mercuric resist  24.5      26 0.00057   20.5   0.1   21   17-37      6-26  (120)
129 PF04545 Sigma70_r4:  Sigma-70,  24.2      21 0.00046   17.1  -0.3   18   17-34     23-40  (50)
130 cd01797 NIRF_N amino-terminal   24.0      55  0.0012   17.4   1.3   29   15-43     27-55  (78)
131 PRK07571 bidirectional hydroge  23.7      47   0.001   20.7   1.1   25    8-32     48-72  (169)
132 cd04765 HTH_MlrA-like_sg2 Heli  23.7      25 0.00053   19.7  -0.1   20   18-37      4-23  (99)
133 PF01257 2Fe-2S_thioredx:  Thio  23.7      24 0.00052   21.1  -0.2   25    8-32     25-49  (145)
134 PF13730 HTH_36:  Helix-turn-he  23.3      13 0.00029   18.0  -1.2   20   16-35     27-46  (55)
135 cd04767 HTH_HspR-like_MBC Heli  23.3      23 0.00051   20.9  -0.3   22   17-38      4-25  (120)
136 PRK06759 RNA polymerase factor  23.2      26 0.00057   20.1  -0.1   21   17-37    125-145 (154)
137 PF09292 Neil1-DNA_bind:  Endon  23.2      29 0.00064   16.7   0.1    6   32-37     27-32  (39)
138 PRK12537 RNA polymerase sigma   22.9      38 0.00082   20.3   0.6   20   17-36    152-171 (182)
139 cd01794 DC_UbP_C dendritic cel  22.9      61  0.0013   16.9   1.3   28   16-43     24-51  (70)
140 PF05848 CtsR:  Firmicute trans  22.7      42 0.00091   20.7   0.8   18   16-33     27-44  (152)
141 cd08318 Death_NMPP84 Death dom  22.7      32 0.00069   18.8   0.2   16   18-33     22-37  (86)
142 PRK11924 RNA polymerase sigma   22.6      26 0.00057   20.4  -0.2   21   17-37    144-164 (179)
143 PF12200 DUF3597:  Domain of un  22.6      83  0.0018   19.0   2.0   17   12-28     83-99  (127)
144 cd01807 GDX_N ubiquitin-like d  22.4      59  0.0013   16.8   1.2   28   16-43     26-53  (74)
145 cd01282 HTH_MerR-like_sg3 Heli  22.2      26 0.00056   19.9  -0.2   21   18-38      4-24  (112)
146 PRK13182 racA polar chromosome  21.7      32 0.00068   21.6   0.1   21   18-38      4-24  (175)
147 PF07022 Phage_CI_repr:  Bacter  21.6     9.8 0.00021   19.7  -1.9   21   17-37     15-36  (66)
148 TIGR02051 MerR Hg(II)-responsi  21.6      26 0.00057   20.3  -0.3   17   18-34      3-19  (124)
149 cd01812 BAG1_N Ubiquitin-like   21.5      65  0.0014   16.1   1.3   25   15-39     24-48  (71)
150 smart00351 PAX Paired Box doma  21.2      24 0.00053   20.5  -0.5   21   17-37     36-56  (125)
151 PF07037 DUF1323:  Putative tra  21.1      28 0.00062   20.8  -0.2   20   18-37      4-23  (122)
152 PF06505 XylR_N:  Activator of   21.1      37 0.00081   19.5   0.3   21   20-40      2-22  (103)
153 KOG3755|consensus               21.1      13 0.00029   28.0  -1.9   19   27-45    739-757 (769)
154 COG2197 CitB Response regulato  21.0      47   0.001   20.9   0.7   20   18-37    167-186 (211)
155 PF09581 Spore_III_AF:  Stage I  20.9      49  0.0011   20.2   0.8   19   16-34    169-187 (188)
156 cd01279 HTH_HspR-like Helix-Tu  20.9      28  0.0006   19.4  -0.3   22   17-38      4-25  (98)
157 TIGR03629 arch_S13P archaeal r  20.6      79  0.0017   19.2   1.6   29   11-39     51-79  (144)
158 cd01108 HTH_CueR Helix-Turn-He  20.6      31 0.00066   20.0  -0.1   21   18-38      4-24  (127)
159 cd04776 HTH_GnyR Helix-Turn-He  20.6      29 0.00062   20.0  -0.3   18   18-35      4-21  (118)
160 cd08316 Death_FAS_TNFRSF6 Deat  20.4      82  0.0018   17.8   1.6   21   12-32     18-38  (97)
161 PRK09514 zntR zinc-responsive   20.3      29 0.00063   20.6  -0.3   22   17-38      4-25  (140)
162 cd01806 Nedd8 Nebb8-like  ubiq  20.3      95  0.0021   15.6   1.8   27   14-40     24-50  (76)
163 PF12244 DUF3606:  Protein of u  20.2      58  0.0013   16.6   0.9   18   15-32     21-38  (57)
164 TIGR03209 P21_Cbot clostridium  20.1      55  0.0012   18.6   0.9   15   18-32    127-141 (142)
165 cd04772 HTH_TioE_rpt1 First He  20.0      30 0.00066   19.3  -0.2   21   18-38      4-24  (99)
166 PF02796 HTH_7:  Helix-turn-hel  20.0      25 0.00054   16.7  -0.5   20   16-35     23-42  (45)
167 cd08804 Death_ank2 Death domai  20.0      42 0.00091   18.3   0.3   16   18-33     19-34  (84)

No 1  
>KOG0848|consensus
Probab=99.71  E-value=2.3e-18  Score=113.20  Aligned_cols=48  Identities=48%  Similarity=0.562  Sum_probs=45.1

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIV   49 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~   49 (64)
                      ||++|+.++|+++..+.+||.-|+|+|+||+|||||||+|+|+..+..
T Consensus       214 LEKEfh~SryITirRKSELA~~LgLsERQVKIWFQNRRAKERK~nKKk  261 (317)
T KOG0848|consen  214 LEKEFHTSRYITIRRKSELAATLGLSERQVKIWFQNRRAKERKDNKKK  261 (317)
T ss_pred             hhhhhccccceeeehhHHHHHhhCccHhhhhHhhhhhhHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999885544


No 2  
>KOG0487|consensus
Probab=99.70  E-value=1.7e-18  Score=115.41  Aligned_cols=51  Identities=25%  Similarity=0.309  Sum_probs=46.5

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFL   52 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~   52 (64)
                      ||++|..|.|++.+.|.+|++.|+|+++||+|||||||-|+|++.+.....
T Consensus       250 LEkEFlfN~YitkeKR~ElSr~lNLTeRQVKIWFQNRRMK~KK~~re~r~~  300 (308)
T KOG0487|consen  250 LEKEFLFNMYITKEKRLELSRTLNLTERQVKIWFQNRRMKEKKVNRENRLK  300 (308)
T ss_pred             HHHHHHHHHHHhHHHHHHHHHhcccchhheeeeehhhhhHHhhhhhhhhcc
Confidence            899999999999999999999999999999999999999999885544443


No 3  
>KOG0842|consensus
Probab=99.70  E-value=5.3e-18  Score=113.03  Aligned_cols=51  Identities=24%  Similarity=0.230  Sum_probs=46.1

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLE   53 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~   53 (64)
                      ||+.|...+|++..+|++||..|+||++||+|||||||.|.||. ...+..+
T Consensus       168 LERRFrqQRYLSAPERE~LA~~LrLT~TQVKIWFQNrRYK~KR~-~~dk~~~  218 (307)
T KOG0842|consen  168 LERRFRQQRYLSAPEREHLASSLRLTPTQVKIWFQNRRYKTKRQ-QKDKALE  218 (307)
T ss_pred             HHHHHHhhhccccHhHHHHHHhcCCCchheeeeeecchhhhhhh-hhhhhhh
Confidence            89999999999999999999999999999999999999999998 4444433


No 4  
>KOG0488|consensus
Probab=99.70  E-value=3.9e-18  Score=113.84  Aligned_cols=58  Identities=24%  Similarity=0.277  Sum_probs=49.8

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhcCCCCC
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVHGDGRN   61 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~~~g~~   61 (64)
                      ||+.|++..|++..+|++||..|||+..||++||||||+|+|+.. . ...+.....|+.
T Consensus       187 LEkrF~~QKYLS~~DR~~LA~~LgLTdaQVKtWfQNRRtKWKrq~-a-~g~~~~~~~~~~  244 (309)
T KOG0488|consen  187 LEKRFEKQKYLSVADRIELAASLGLTDAQVKTWFQNRRTKWKRQT-A-EGGELLYQAGNS  244 (309)
T ss_pred             HHHHHHHhhcccHHHHHHHHHHcCCchhhHHHHHhhhhHHHHHHH-H-hhhccccccccc
Confidence            899999999999999999999999999999999999999999993 2 355555555544


No 5  
>KOG0489|consensus
Probab=99.69  E-value=9.6e-19  Score=114.32  Aligned_cols=51  Identities=27%  Similarity=0.368  Sum_probs=46.6

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFL   52 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~   52 (64)
                      ||++|+.|+|++...|.+||..|+|+|+||+|||||||.|+|+..+.....
T Consensus       174 LEkEFhfN~YLtR~RRiEiA~~L~LtErQIKIWFQNRRMK~Kk~~k~~~~~  224 (261)
T KOG0489|consen  174 LEKEFHFNKYLTRSRRIEIAHALNLTERQIKIWFQNRRMKWKKENKAKSSQ  224 (261)
T ss_pred             hhhhhccccccchHHHHHHHhhcchhHHHHHHHHHHHHHHHHHhhcccccc
Confidence            899999999999999999999999999999999999999999885555443


No 6  
>KOG0843|consensus
Probab=99.67  E-value=1.8e-17  Score=103.82  Aligned_cols=48  Identities=25%  Similarity=0.221  Sum_probs=44.9

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIV   49 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~   49 (64)
                      ||.+|..++|....+|+.||..|+|++.||+|||||||+|.|+.....
T Consensus       117 LE~~F~~~~Yvvg~eR~~LA~~L~LsetQVkvWFQNRRtk~kr~~~e~  164 (197)
T KOG0843|consen  117 LEHAFEGNQYVVGAERKQLAQSLSLSETQVKVWFQNRRTKHKRMQQED  164 (197)
T ss_pred             HHHHHhcCCeeechHHHHHHHHcCCChhHhhhhhhhhhHHHHHHHHHh
Confidence            899999999999999999999999999999999999999999885443


No 7  
>KOG0484|consensus
Probab=99.61  E-value=7e-17  Score=94.09  Aligned_cols=55  Identities=15%  Similarity=0.073  Sum_probs=49.7

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVH   56 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~   56 (64)
                      ||+.|...+||++..|++||.+++|++..|||||||||++-+++.+.+.......
T Consensus        32 LErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~~~~~~   86 (125)
T KOG0484|consen   32 LERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIAKMAAK   86 (125)
T ss_pred             HHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHHHhhhh
Confidence            7999999999999999999999999999999999999999998877776655544


No 8  
>KOG0485|consensus
Probab=99.61  E-value=6e-17  Score=104.27  Aligned_cols=45  Identities=27%  Similarity=0.285  Sum_probs=43.7

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      +||.+|...+|++..+|..||.+|.|+++||+|||||||+|+||.
T Consensus       118 qLEs~Fe~krYLSsaeRa~LA~sLqLTETQVKIWFQNRRnKwKRq  162 (268)
T KOG0485|consen  118 QLESTFELKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQ  162 (268)
T ss_pred             HHHHHHHHHhhhhHHHHhHHHHhhhhhhhhhhhhhhhhhHHHHHH
Confidence            489999999999999999999999999999999999999999998


No 9  
>KOG0850|consensus
Probab=99.59  E-value=1.8e-16  Score=102.29  Aligned_cols=47  Identities=26%  Similarity=0.346  Sum_probs=43.4

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHH
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAI   47 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~   47 (64)
                      ||.+.|+.++|+--.+|.+||..|||+.+||+|||||||.|-|+..+
T Consensus       136 aL~rRFQkTQYLALPERAeLAAsLGLTQTQVKIWFQNrRSK~KKl~k  182 (245)
T KOG0850|consen  136 ALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLKK  182 (245)
T ss_pred             HHHHHHhhcchhcCcHHHHHHHHhCCchhHhhhhhhhhHHHHHHHHh
Confidence            57889999999999999999999999999999999999999886633


No 10 
>KOG0492|consensus
Probab=99.56  E-value=6.1e-16  Score=98.95  Aligned_cols=45  Identities=24%  Similarity=0.330  Sum_probs=43.3

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      .||+-|...+|++++++.+++..|.|+++||+|||||||++.||.
T Consensus       158 aLErkfrekqYLSiaEraefSsSL~LTeTqVKIWFQNRRAKaKRl  202 (246)
T KOG0492|consen  158 ALERKFREKQYLSIAERAEFSSSLELTETQVKIWFQNRRAKAKRL  202 (246)
T ss_pred             HHHHHHhHhhhhhHHHHHhhhhhhhhhhhheehhhhhhhHHHHHH
Confidence            389999999999999999999999999999999999999999987


No 11 
>KOG0483|consensus
Probab=99.55  E-value=1.5e-15  Score=96.43  Aligned_cols=48  Identities=23%  Similarity=0.238  Sum_probs=44.5

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHH
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAII   48 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~   48 (64)
                      +||..|..+.++.+..+..||+.|||.++||.|||||||+++|.....
T Consensus        64 ~LE~~F~~~~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE  111 (198)
T KOG0483|consen   64 FLEKSFESEKKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLE  111 (198)
T ss_pred             HhHHhhccccccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhh
Confidence            589999999999999999999999999999999999999999977433


No 12 
>PF00046 Homeobox:  Homeobox domain not present here.;  InterPro: IPR001356 The homeobox domain was first identified in a number of drosophila homeotic and segmentation proteins, but is now known to be well-conserved in many other animals, including vertebrates [, , ]. Hox genes encode homeodomain-containing transcriptional regulators that operate differential genetic programs along the anterior-posterior axis of animal bodies []. The domain binds DNA through a helix-turn-helix (HTH) structure. The HTH motif is characterised by two alpha-helices, which make intimate contacts with the DNA and are joined by a short turn. The second helix binds to DNA via a number of hydrogen bonds and hydrophobic interactions, which occur between specific side chains and the exposed bases and thymine methyl groups within the major groove of the DNA []. The first helix helps to stabilise the structure. The motif is very similar in sequence and structure in a wide range of DNA-binding proteins (e.g., cro and repressor proteins, homeotic proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereo-chemical requirement for glycine in the turn which is needed to avoid steric interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, while for many of the homeotic and other DNA-binding proteins the requirement is relaxed.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2DA3_A 1LFB_A 2LFB_A 2ECB_A 2DA5_A 3D1N_O 3A03_A 2XSD_C 3CMY_A 1AHD_P ....
Probab=99.50  E-value=4.8e-16  Score=80.57  Aligned_cols=43  Identities=28%  Similarity=0.325  Sum_probs=40.6

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNN   44 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~   44 (64)
                      ||..|..++||+..++..||..+||+..+|++||+|+|.++|+
T Consensus        15 L~~~f~~~~~p~~~~~~~la~~l~l~~~~V~~WF~nrR~k~kk   57 (57)
T PF00046_consen   15 LEEYFQENPYPSKEEREELAKELGLTERQVKNWFQNRRRKEKK   57 (57)
T ss_dssp             HHHHHHHSSSCHHHHHHHHHHHHTSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhccccccccccccccccccccccccCHHHhHHHhCc
Confidence            8899999999999999999999999999999999999987763


No 13 
>smart00389 HOX Homeodomain. DNA-binding factors that are involved in the transcriptional regulation of key developmental processes
Probab=99.47  E-value=5.9e-15  Score=75.84  Aligned_cols=43  Identities=33%  Similarity=0.341  Sum_probs=40.0

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCccccc
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      .||..|..++||+..++..||..+||+..+|+.||+|+|.+.+
T Consensus        14 ~L~~~f~~~~~P~~~~~~~la~~~~l~~~qV~~WF~nrR~~~~   56 (56)
T smart00389       14 ELEKEFQKNPYPSREEREELAAKLGLSERQVKVWFQNRRAKWK   56 (56)
T ss_pred             HHHHHHHhCCCCCHHHHHHHHHHHCcCHHHHHHhHHHHhhccC
Confidence            3889999999999999999999999999999999999997653


No 14 
>cd00086 homeodomain Homeodomain;  DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.
Probab=99.47  E-value=4.3e-15  Score=76.77  Aligned_cols=45  Identities=29%  Similarity=0.333  Sum_probs=41.6

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      .||..|..++||+..++..||..+||++.+|++||+|+|.+.++.
T Consensus        14 ~Le~~f~~~~~P~~~~~~~la~~~~l~~~qV~~WF~nrR~~~~~~   58 (59)
T cd00086          14 ELEKEFEKNPYPSREEREELAKELGLTERQVKIWFQNRRAKLKRS   58 (59)
T ss_pred             HHHHHHHhCCCCCHHHHHHHHHHHCcCHHHHHHHHHHHHHHHhcc
Confidence            388999999999999999999999999999999999999877653


No 15 
>COG5576 Homeodomain-containing transcription factor [Transcription]
Probab=99.47  E-value=1.1e-14  Score=89.59  Aligned_cols=44  Identities=14%  Similarity=0.150  Sum_probs=41.9

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      |+..|..++||+...+..|+..++|+++.|+|||||+|++.|..
T Consensus        66 L~~~F~i~p~Ps~~~r~~L~~~lnm~~ksVqIWFQNkR~~~k~~  109 (156)
T COG5576          66 LEREFEINPYPSSITRIKLSLLLNMPPKSVQIWFQNKRAKEKKK  109 (156)
T ss_pred             HHHHhccCCCCCHHHHHHHHHhcCCChhhhhhhhchHHHHHHHh
Confidence            78999999999999999999999999999999999999988765


No 16 
>KOG2251|consensus
Probab=99.43  E-value=6.8e-14  Score=89.83  Aligned_cols=47  Identities=19%  Similarity=0.134  Sum_probs=44.1

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAII   48 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~   48 (64)
                      ||..|..+.||+...+++||.+|+|++.+|+|||.|||+|.++...-
T Consensus        52 Le~LF~kTqYPDv~~rEelAlklnLpeSrVqVWFKNRRAK~r~qq~q   98 (228)
T KOG2251|consen   52 LEALFAKTQYPDVFMREELALKLNLPESRVQVWFKNRRAKCRRQQQQ   98 (228)
T ss_pred             HHHHHHhhcCccHHHHHHHHHHhCCchhhhhhhhccccchhhHhhhh
Confidence            78999999999999999999999999999999999999999987443


No 17 
>KOG0494|consensus
Probab=99.42  E-value=3.3e-14  Score=93.63  Aligned_cols=48  Identities=15%  Similarity=0.099  Sum_probs=45.0

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIV   49 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~   49 (64)
                      ||+.|...+||+...|+-||.++.|++..|+|||||||+|+++.++..
T Consensus       156 LEkaFkeaHYPDv~Are~la~ktelpEDRIqVWfQNRRAKWRk~Ek~w  203 (332)
T KOG0494|consen  156 LEKAFKEAHYPDVYAREMLADKTELPEDRIQVWFQNRRAKWRKTEKRW  203 (332)
T ss_pred             HHHHHhhccCccHHHHHHHhhhccCchhhhhHHhhhhhHHhhhhhhhc
Confidence            799999999999999999999999999999999999999999886544


No 18 
>KOG0491|consensus
Probab=99.39  E-value=2.7e-14  Score=88.77  Aligned_cols=47  Identities=28%  Similarity=0.322  Sum_probs=43.7

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAII   48 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~   48 (64)
                      ||+.|+..+|++..++.+||..|+|+++||+.||||||.|.|+..+.
T Consensus       115 l~~rFe~QrYLS~~e~~ELan~L~LS~~QVKTWFQNrRMK~Kk~~r~  161 (194)
T KOG0491|consen  115 LEKRFERQRYLSTPERQELANALSLSETQVKTWFQNRRMKHKKQQRN  161 (194)
T ss_pred             cHHHHhhhhhcccHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHhc
Confidence            79999999999999999999999999999999999999998887333


No 19 
>KOG0844|consensus
Probab=99.37  E-value=1.2e-13  Score=92.68  Aligned_cols=47  Identities=21%  Similarity=0.306  Sum_probs=44.1

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIV   49 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~   49 (64)
                      ||++|-+..|.+...|-+||..|+|++..|+|||||||.|+||+ +++
T Consensus       196 LEKEFyrENYVSRprRcELAAaLNLPEtTIKVWFQNRRMKDKRQ-Rla  242 (408)
T KOG0844|consen  196 LEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQ-RLA  242 (408)
T ss_pred             HHHHHHHhccccCchhhhHHHhhCCCcceeehhhhhchhhhhhh-hhh
Confidence            89999999999999999999999999999999999999999998 543


No 20 
>KOG0493|consensus
Probab=99.33  E-value=2.1e-13  Score=89.99  Aligned_cols=44  Identities=32%  Similarity=0.453  Sum_probs=40.9

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      |..+|+.++|++...|.+||.+|+|.+.||+|||||+|+|-|+.
T Consensus       261 LK~EF~enRYlTEqRRQ~La~ELgLNEsQIKIWFQNKRAKiKKs  304 (342)
T KOG0493|consen  261 LKAEFQENRYLTEQRRQELAQELGLNESQIKIWFQNKRAKIKKS  304 (342)
T ss_pred             HHHHHhhhhhHHHHHHHHHHHHhCcCHHHhhHHhhhhhhhhhhc
Confidence            56789999999999999999999999999999999999987754


No 21 
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class. This model represents a class of homoebox domain that differs substantially from the typical homoebox domain described in pfam model pfam00046. It is found in both C4 and C3 plants.
Probab=99.31  E-value=1.3e-12  Score=69.05  Aligned_cols=38  Identities=8%  Similarity=0.016  Sum_probs=36.4

Q ss_pred             chhhhccCCC----CCHHHHHHHHHHhCCCCCcccccccCCc
Q psy8538           2 DSLEFHYSRY----ITIRRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus         2 ~e~~F~~~~~----p~~~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ||..|..++|    |+...+.+||..+||++.+|+|||||.+
T Consensus        16 Le~~fe~~~y~~~~~~~~~r~~la~~lgl~~~vvKVWfqN~k   57 (58)
T TIGR01565        16 MRDFAEKLGWKLKDKRREEVREFCEEIGVTRKVFKVWMHNNK   57 (58)
T ss_pred             HHHHHHHcCCCCCCCCHHHHHHHHHHhCCCHHHeeeecccCC
Confidence            7889999999    9999999999999999999999999975


No 22 
>KOG3802|consensus
Probab=99.24  E-value=4.2e-12  Score=87.00  Aligned_cols=47  Identities=17%  Similarity=0.051  Sum_probs=44.5

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHH
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAI   47 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~   47 (64)
                      .||+.|..|+.|+..++..||.+|+|-...|+|||+|||.++||...
T Consensus       308 aLE~~F~~npKPt~qEIt~iA~~L~leKEVVRVWFCNRRQkeKR~~~  354 (398)
T KOG3802|consen  308 ALEKHFLKNPKPTSQEITHIAESLQLEKEVVRVWFCNRRQKEKRITP  354 (398)
T ss_pred             HHHHHHHhCCCCCHHHHHHHHHHhccccceEEEEeeccccccccCCC
Confidence            38999999999999999999999999999999999999999999844


No 23 
>KOG0847|consensus
Probab=99.23  E-value=1.1e-12  Score=84.88  Aligned_cols=45  Identities=22%  Similarity=0.281  Sum_probs=42.6

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      .||..|....|+-.+++.+||..+|+++.||+|||||||+++++.
T Consensus       181 ~le~~feqtkylaG~~ra~lA~~lgmteSqvkVWFQNRRTKWRKk  225 (288)
T KOG0847|consen  181 QLERKFEQTKYLAGADRAQLAQELNMTESQVKVWFQNRRTKWRKK  225 (288)
T ss_pred             hhhhhhhhhhcccchhHHHhhccccccHHHHHHHHhcchhhhhhh
Confidence            378999999999999999999999999999999999999999876


No 24 
>KOG4577|consensus
Probab=99.19  E-value=4.4e-12  Score=84.77  Aligned_cols=47  Identities=13%  Similarity=0.049  Sum_probs=42.4

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAII   48 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~   48 (64)
                      |...|...+.|..+.|++|+.++||..+.|||||||||+|+||.++-
T Consensus       182 LK~AYn~SpKPARHVREQLsseTGLDMRVVQVWFQNRRAKEKRLKKD  228 (383)
T KOG4577|consen  182 LKQAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKD  228 (383)
T ss_pred             HHHHhcCCCchhHHHHHHhhhccCcceeehhhhhhhhhHHHHhhhhh
Confidence            45678889999999999999999999999999999999999988443


No 25 
>KOG0486|consensus
Probab=99.14  E-value=2.5e-11  Score=81.48  Aligned_cols=56  Identities=20%  Similarity=0.172  Sum_probs=49.2

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhcCC
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVHGD   58 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~~~   58 (64)
                      ||..|++++||+...|+++|.-++|++..|.|||.|||+++++.++-.. .|.+.++
T Consensus       127 le~tF~rNrypdMstrEEIavwtNlTE~rvrvwfknrrakwrkrErN~~-ae~~k~~  182 (351)
T KOG0486|consen  127 LEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQ-AELAKGG  182 (351)
T ss_pred             HHHHHhhccCCccchhhHHHhhccccchhhhhhcccchhhhhhhhhhHH-HHhhhcC
Confidence            6888999999999999999999999999999999999999998866655 5555444


No 26 
>KOG0775|consensus
Probab=99.12  E-value=2.3e-11  Score=80.47  Aligned_cols=43  Identities=23%  Similarity=0.157  Sum_probs=40.1

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNN   44 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~   44 (64)
                      |...|..++||+..++.+||+.+||+..||-.||.|||.++|.
T Consensus       191 LrewY~~~~YPsp~eKReLA~aTgLt~tQVsNWFKNRRQRDRa  233 (304)
T KOG0775|consen  191 LREWYLQNPYPSPREKRELAEATGLTITQVSNWFKNRRQRDRA  233 (304)
T ss_pred             HHHHHhcCCCCChHHHHHHHHHhCCchhhhhhhhhhhhhhhhh
Confidence            5667899999999999999999999999999999999998883


No 27 
>KOG0490|consensus
Probab=99.10  E-value=1.8e-11  Score=77.11  Aligned_cols=46  Identities=13%  Similarity=-0.031  Sum_probs=43.5

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchH
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTA   46 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~   46 (64)
                      +||+.|...+||+...++.||..+++++..|+|||||+|+++++..
T Consensus        74 ~ler~f~~~h~Pd~~~r~~la~~~~~~e~rVqvwFqnrrak~r~~~  119 (235)
T KOG0490|consen   74 ELERAFEKVHLPCFACRECLALLLTGDEFRVQVWFQNRRAKDRKEE  119 (235)
T ss_pred             HHHHhhcCCCcCccchHHHHhhcCCCCeeeeehhhhhhcHhhhhhh
Confidence            5899999999999999999999999999999999999999999774


No 28 
>KOG0849|consensus
Probab=98.83  E-value=7.8e-10  Score=75.19  Aligned_cols=46  Identities=20%  Similarity=0.156  Sum_probs=43.2

Q ss_pred             CchhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchH
Q psy8538           1 MDSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTA   46 (64)
Q Consensus         1 ~~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~   46 (64)
                      +||+.|..++||+...|+.||.++++++..|+|||+|+|++.++..
T Consensus       190 ~le~~f~rt~yP~i~~Re~La~~i~l~e~riqvwf~nrra~~rr~~  235 (354)
T KOG0849|consen  190 ALEECFQRTPYPDIVGRETLAKETGLPEPRVQVWFQNRRAKWRRQH  235 (354)
T ss_pred             HHHHHhcCCCCCchhhHHHHhhhccCCchHHHHHHhhhhhhhhhcc
Confidence            5899999999999999999999999999999999999999888773


No 29 
>PF05920 Homeobox_KN:  Homeobox KN domain;  InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 3K2A_B 2LK2_A 1X2N_A 2DMN_A.
Probab=98.69  E-value=8.9e-10  Score=54.21  Aligned_cols=32  Identities=28%  Similarity=0.291  Sum_probs=27.2

Q ss_pred             cCCCCCHHHHHHHHHHhCCCCCcccccccCCc
Q psy8538           8 YSRYITIRRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus         8 ~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++||+..++..||..+||+..||..||-|-|
T Consensus         7 ~nPYPs~~ek~~L~~~tgls~~Qi~~WF~NaR   38 (40)
T PF05920_consen    7 HNPYPSKEEKEELAKQTGLSRKQISNWFINAR   38 (40)
T ss_dssp             TSGS--HHHHHHHHHHHTS-HHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHcCCCHHHHHHHHHHhH
Confidence            47899999999999999999999999999976


No 30 
>KOG1168|consensus
Probab=98.62  E-value=1.4e-08  Score=68.21  Aligned_cols=47  Identities=15%  Similarity=0.021  Sum_probs=43.5

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccchHHH
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNTAII   48 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~   48 (64)
                      ||.+|...+.|+.+....+|.+|+|....|+|||.|.|.|.||++..
T Consensus       324 LEayFavQPRPS~EkIAaIAekLDLKKNVVRVWFCNQRQKQKRm~~S  370 (385)
T KOG1168|consen  324 LEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKRS  370 (385)
T ss_pred             HHHHhccCCCCchhHHHHHHHhhhhhhceEEEEeeccHHHHHHhhhh
Confidence            78999999999999999999999999999999999999999987443


No 31 
>KOG0774|consensus
Probab=98.12  E-value=2.2e-06  Score=57.11  Aligned_cols=44  Identities=18%  Similarity=0.061  Sum_probs=37.6

Q ss_pred             chhhh---ccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           2 DSLEF---HYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         2 ~e~~F---~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      |...|   ..++||+...+++||+++|++..||..||.|.|-+-|+.
T Consensus       203 LneyF~~h~~nPYPSee~K~eLAkqCnItvsQvsnwfgnkrIrykK~  249 (334)
T KOG0774|consen  203 LNEYFYSHLSNPYPSEEAKEELAKQCNITVSQVSNWFGNKRIRYKKN  249 (334)
T ss_pred             HHHHHHHhcCCCCCcHHHHHHHHHHcCceehhhccccccceeehhhh
Confidence            44556   468999999999999999999999999999998766544


No 32 
>KOG0490|consensus
Probab=97.79  E-value=7.3e-06  Score=51.54  Aligned_cols=44  Identities=18%  Similarity=0.144  Sum_probs=39.6

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      ++..|..+.+|+...+..|+..+|+++..|++||||++.+.++.
T Consensus       168 ~~~~~~~~~~P~~~~~~~l~~~~~~~~~~~q~~~~~~~~~~~~~  211 (235)
T KOG0490|consen  168 LETVFRATPKPDADDREQLAEETGLSERVIQVWFQNRRAKLRKH  211 (235)
T ss_pred             hhhcccCCCCCchhhHHHHHHhcCCChhhhhhhcccHHHHHHhh
Confidence            35568889999999999999999999999999999999888765


No 33 
>PF11569 Homez:  Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A.
Probab=97.33  E-value=2.4e-05  Score=41.00  Aligned_cols=39  Identities=15%  Similarity=0.010  Sum_probs=28.9

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      |+..|...+++...+...|+.+.+|+..||+.||--+..
T Consensus        13 L~~Yy~~h~~L~E~DL~~L~~kS~ms~qqVr~WFa~~~~   51 (56)
T PF11569_consen   13 LEDYYLKHKQLQEEDLDELCDKSRMSYQQVRDWFAERMQ   51 (56)
T ss_dssp             HHHHHHHT----TTHHHHHHHHTT--HHHHHHHHHHHS-
T ss_pred             HHHHHHHcCCccHhhHHHHHHHHCCCHHHHHHHHHHhcc
Confidence            788899889998899999999999999999999976653


No 34 
>KOG2252|consensus
Probab=97.06  E-value=0.00021  Score=51.29  Aligned_cols=40  Identities=10%  Similarity=-0.022  Sum_probs=36.6

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCccc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTV   41 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~   41 (64)
                      |-.+|+.+++|+.+....|+.+|+|....|..||-|-|.+
T Consensus       435 L~aiFke~~RPS~Emq~tIS~qL~L~~sTV~NfFmNaRRR  474 (558)
T KOG2252|consen  435 LQAIFKENKRPSREMQETISQQLNLELSTVINFFMNARRR  474 (558)
T ss_pred             HHHHHhcCCCCCHHHHHHHHHHhCCcHHHHHHHHHhhhhh
Confidence            5678999999999999999999999999999999997644


No 35 
>KOG0773|consensus
Probab=96.92  E-value=0.00044  Score=46.45  Aligned_cols=37  Identities=24%  Similarity=0.081  Sum_probs=32.4

Q ss_pred             CCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           9 SRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         9 ~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      .+||+..++..||.++||+..||..||-|.|-+....
T Consensus       264 ~PYPse~~K~~La~~TGLs~~Qv~NWFINaR~R~w~p  300 (342)
T KOG0773|consen  264 HPYPSDDEKLMLAKQTGLSRPQVSNWFINARVRLWKP  300 (342)
T ss_pred             CCCCcchhccccchhcCCCcccCCchhhhcccccCCc
Confidence            5899999999999999999999999999977655433


No 36 
>KOG1146|consensus
Probab=96.73  E-value=0.00061  Score=53.03  Aligned_cols=41  Identities=15%  Similarity=0.233  Sum_probs=36.4

Q ss_pred             hhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           5 EFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         5 ~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      .|....||...+.+.|...++++.+.|++||||-|.+.+..
T Consensus       921 ~~~~q~~~~~~~~E~l~~~~~~~~~~i~vw~qna~~~s~k~  961 (1406)
T KOG1146|consen  921 CYEAQRTPTMQECEVLEEPIGLPKRVIQVWFQNARAKSKKA  961 (1406)
T ss_pred             HHhhccCChHHHHHhhcccccCCcchhHHhhhhhhhhhhhh
Confidence            45667788888888999999999999999999999988876


No 37 
>KOG3623|consensus
Probab=94.54  E-value=0.0093  Score=44.82  Aligned_cols=44  Identities=9%  Similarity=0.038  Sum_probs=39.2

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCcccccccCCcccccch
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~   45 (64)
                      |...|..|..|+..+-..+|.+.||+..-|+.||++.++.+...
T Consensus       571 lkayyaln~~ps~eelskia~qvglp~~vvk~wfE~~~a~e~sv  614 (1007)
T KOG3623|consen  571 LKAYYALNGLPSEEELSKIAQQVGLPFAVVKAWFEDEEAEEMSV  614 (1007)
T ss_pred             HHHHHHhcCCCCHHHHHHHHHHhcccHHHHHHHHHhhhhhhhhh
Confidence            45578999999999999999999999999999999998766655


No 38 
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=86.57  E-value=0.21  Score=26.35  Aligned_cols=18  Identities=33%  Similarity=0.453  Sum_probs=16.1

Q ss_pred             HHHHHHHhCCCCCccccc
Q psy8538          17 KAELANSLGLSERQVRCP   34 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vW   34 (64)
                      -..+|.+||+++.+|..|
T Consensus        25 lkdIA~~Lgvs~~tIr~W   42 (60)
T PF10668_consen   25 LKDIAEKLGVSESTIRKW   42 (60)
T ss_pred             HHHHHHHHCCCHHHHHHH
Confidence            346899999999999999


No 39 
>PF04218 CENP-B_N:  CENP-B N-terminal DNA-binding domain;  InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure [].; GO: 0003677 DNA binding, 0000775 chromosome, centromeric region; PDB: 1BW6_A 1HLV_A 2ELH_A.
Probab=81.81  E-value=0.43  Score=24.17  Aligned_cols=24  Identities=21%  Similarity=0.293  Sum_probs=18.2

Q ss_pred             HHHHHHHHhCCCCCcccccccCCc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ....||..+|++..+|..|..|+.
T Consensus        24 s~~~ia~~fgv~~sTv~~I~K~k~   47 (53)
T PF04218_consen   24 SKRDIAREFGVSRSTVSTILKNKD   47 (53)
T ss_dssp             -HHHHHHHHT--CCHHHHHHHCHH
T ss_pred             CHHHHHHHhCCCHHHHHHHHHhHH
Confidence            356899999999999999988864


No 40 
>PF13518 HTH_28:  Helix-turn-helix domain
Probab=78.05  E-value=0.65  Score=22.47  Aligned_cols=23  Identities=22%  Similarity=0.218  Sum_probs=19.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..++|..+|++..+|..|.+.-+
T Consensus        15 ~~~~a~~~gis~~tv~~w~~~y~   37 (52)
T PF13518_consen   15 VREIAREFGISRSTVYRWIKRYR   37 (52)
T ss_pred             HHHHHHHHCCCHhHHHHHHHHHH
Confidence            45689999999999999976543


No 41 
>PRK10072 putative transcriptional regulator; Provisional
Probab=77.51  E-value=1.6  Score=24.89  Aligned_cols=24  Identities=21%  Similarity=0.180  Sum_probs=20.9

Q ss_pred             HHHHHHHhCCCCCcccccccCCcc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      ..+||..+|++...|..|.+.++.
T Consensus        49 Q~elA~~lGvS~~TVs~WE~G~r~   72 (96)
T PRK10072         49 IDDFARVLGVSVAMVKEWESRRVK   72 (96)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCCC
Confidence            457899999999999999998874


No 42 
>PF06056 Terminase_5:  Putative ATPase subunit of terminase (gpP-like);  InterPro: IPR010332 This family of proteins are annotated as ATPase subunits of phage terminase after []. Terminases are viral proteins that are involved in packaging viral DNA into the capsid.; GO: 0005524 ATP binding, 0019069 viral capsid assembly
Probab=74.13  E-value=1.2  Score=23.05  Aligned_cols=21  Identities=24%  Similarity=0.313  Sum_probs=17.8

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|..||++...|..|-+-
T Consensus        16 ~~eIA~~Lg~~~~TV~~W~~r   36 (58)
T PF06056_consen   16 IKEIAEELGVPRSTVYSWKDR   36 (58)
T ss_pred             HHHHHHHHCCChHHHHHHHHh
Confidence            457899999999999999553


No 43 
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. Helix-turn-helix (HTH) transcription regulator MerR superfamily, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=70.75  E-value=1.1  Score=21.37  Aligned_cols=22  Identities=27%  Similarity=0.215  Sum_probs=18.8

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|..+|+++..|..|.+...
T Consensus         4 ~e~a~~~gv~~~tlr~~~~~g~   25 (49)
T cd04761           4 GELAKLTGVSPSTLRYYERIGL   25 (49)
T ss_pred             HHHHHHHCcCHHHHHHHHHCCC
Confidence            4789999999999999977654


No 44 
>PF13384 HTH_23:  Homeodomain-like domain; PDB: 2X48_C.
Probab=68.97  E-value=1.1  Score=21.71  Aligned_cols=23  Identities=26%  Similarity=0.228  Sum_probs=16.8

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..++|..+|++...|..|...-+
T Consensus        20 ~~~ia~~lgvs~~Tv~~w~kr~~   42 (50)
T PF13384_consen   20 IREIAKRLGVSRSTVYRWIKRYR   42 (50)
T ss_dssp             HHHHHHHHTS-HHHHHHHHT---
T ss_pred             HHHHHHHHCcCHHHHHHHHHHcc
Confidence            45789999999999999976543


No 45 
>PF13411 MerR_1:  MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B.
Probab=64.33  E-value=2  Score=21.94  Aligned_cols=21  Identities=29%  Similarity=0.338  Sum_probs=17.6

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++..+|+.|=...
T Consensus         4 ~eva~~~gvs~~tlr~y~~~g   24 (69)
T PF13411_consen    4 KEVAKLLGVSPSTLRYYEREG   24 (69)
T ss_dssp             HHHHHHTTTTHHHHHHHHHTT
T ss_pred             HHHHHHHCcCHHHHHHHHHhc
Confidence            478999999999999995543


No 46 
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3. S3  is part of the head region of the 40S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH motif is a beta-alpha-alpha-beta-beta unit that folds into an alpha-beta structure with a three stranded beta-sheet interupted by two contiguous helices.  In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=63.89  E-value=6.1  Score=21.67  Aligned_cols=21  Identities=10%  Similarity=0.078  Sum_probs=18.0

Q ss_pred             HHHHHHHHhCCCCCccccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHH   36 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFq   36 (64)
                      -+..|...++|.+.+|++|+.
T Consensus        55 L~~~L~k~~~~~~~~i~v~~~   75 (81)
T cd02413          55 LTSLVQKRFNFPEGSVELYAE   75 (81)
T ss_pred             HHHHHHHHhCCCCCeEEEEEE
Confidence            445788999999999999985


No 47 
>TIGR03879 near_KaiC_dom probable regulatory domain. This model describes a common domain shared by two different families of proteins, each of which occurs regularly next to its corresponding partner family, a probable regulatory with homology to KaiC. By implication, this protein family likely is also involved in sensory transduction and/or regulation.
Probab=62.52  E-value=0.54  Score=25.72  Aligned_cols=34  Identities=26%  Similarity=0.238  Sum_probs=23.6

Q ss_pred             hccCCCCCHHHHHHHHHHhCCCCCcccccccCCc
Q psy8538           6 FHYSRYITIRRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus         6 F~~~~~p~~~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      |...+|...-...++|..+|+|+..|+.|+.+.-
T Consensus        24 f~L~R~~eGlS~kEIAe~LGIS~~TVk~~l~~~~   57 (73)
T TIGR03879        24 AALAREEAGKTASEIAEELGRTEQTVRNHLKGET   57 (73)
T ss_pred             HHHHHHHcCCCHHHHHHHHCcCHHHHHHHHhcCc
Confidence            4333332333456899999999999999987543


No 48 
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.
Probab=62.35  E-value=2.4  Score=19.60  Aligned_cols=22  Identities=27%  Similarity=0.190  Sum_probs=19.0

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|..+|++...|..|.++..
T Consensus         4 ~e~a~~lgvs~~tl~~~~~~g~   25 (49)
T cd04762           4 KEAAELLGVSPSTLRRWVKEGK   25 (49)
T ss_pred             HHHHHHHCcCHHHHHHHHHcCC
Confidence            5789999999999999987754


No 49 
>COG2944 Predicted transcriptional regulator [Transcription]
Probab=59.24  E-value=6  Score=23.05  Aligned_cols=40  Identities=20%  Similarity=0.174  Sum_probs=28.9

Q ss_pred             HHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhcCCCC
Q psy8538          18 AELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVHGDGR   60 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~~~g~   60 (64)
                      ..+|..+|++...|+.|=|+|+   ++..........+..+|.
T Consensus        61 ~vFA~~L~vs~~Tv~~WEqGr~---kPsg~AlkLL~ivq~~p~  100 (104)
T COG2944          61 PVFARYLGVSVSTVRKWEQGRK---KPSGAALKLLRIVQNHPL  100 (104)
T ss_pred             HHHHHHHCCCHHHHHHHHcCCc---CCCCHHHHHHHHHHhcch
Confidence            3578889999999999999998   666555555555544443


No 50 
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=58.13  E-value=2.7  Score=21.08  Aligned_cols=23  Identities=17%  Similarity=0.208  Sum_probs=18.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ...||+.+|++..+|..|+.++.
T Consensus        13 ~~~La~~~gis~~tl~~~~~~~~   35 (63)
T PF13443_consen   13 QKDLARKTGISRSTLSRILNGKP   35 (63)
T ss_dssp             HHHHHHHHT--HHHHHHHHTTT-
T ss_pred             HHHHHHHHCcCHHHHHHHHhccc
Confidence            45799999999999999999873


No 51 
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 1). The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen in the N-terminal domains of typical MerR-like proteins.
Probab=57.38  E-value=3.3  Score=21.21  Aligned_cols=20  Identities=15%  Similarity=0.371  Sum_probs=17.4

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|+++..|+.|-+.
T Consensus         4 ~evA~~~gvs~~tlR~~~~~   23 (67)
T cd04764           4 KEVSEIIGVKPHTLRYYEKE   23 (67)
T ss_pred             HHHHHHHCcCHHHHHHHHHh
Confidence            47899999999999999764


No 52 
>PF09607 BrkDBD:  Brinker DNA-binding domain;  InterPro: IPR018586  This DNA-binding domain is the first approx. 100 residues of the N-terminal end of Brinker. The structure of this domain in complex with DNA consists of four alpha-helices that contain a helix-turn-helix DNA recognition motif specific for GC-rich DNA. The Brinker nuclear repressor is a major element of the Drosophila Decapentaplegic morphogen signalling pathway []. ; PDB: 2GLO_A.
Probab=55.95  E-value=1.9  Score=22.64  Aligned_cols=17  Identities=35%  Similarity=0.341  Sum_probs=14.1

Q ss_pred             HHHHhCCCCCccccccc
Q psy8538          20 LANSLGLSERQVRCPHH   36 (64)
Q Consensus        20 La~~l~l~~~qV~vWFq   36 (64)
                      .|.++|+++.+|+-|-+
T Consensus        31 aarkf~V~r~~Vr~W~k   47 (58)
T PF09607_consen   31 AARKFNVSRRQVRKWRK   47 (58)
T ss_dssp             HHHHTTS-HHHHHHHHT
T ss_pred             HHHHhCccHHHHHHHHH
Confidence            49999999999999954


No 53 
>cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators. HTH-DNA binding domain of the LacI (lactose operon repressor) family of bacterial transcriptional regulators and their putative homologs found in plants. The LacI family has more than 500 members distributed among almost all bacterial species. The monomeric proteins of the LacI family contain common structural features that include a small DNA-binding domain with a helix-turn-helix motif in the N-terminus, a regulatory ligand-binding domain which exhibits the type I periplasmic binding protein fold in the C-terminus for oligomerization and for effector binding, and an approximately 18-amino acid linker connecting these two functional domains. In LacI-like transcriptional regulators, the ligands are monosaccharides including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars, with a few exceptions. When the C-terminal domain of the LacI family repre
Probab=55.77  E-value=2.7  Score=20.28  Aligned_cols=22  Identities=18%  Similarity=0.176  Sum_probs=19.5

Q ss_pred             HHHHHhCCCCCcccccccCCcc
Q psy8538          19 ELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        19 ~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      +||..+|++...|..|+.+...
T Consensus         2 ~lA~~~gvs~~tvs~~l~g~~~   23 (52)
T cd01392           2 DIARAAGVSVATVSRVLNGKPR   23 (52)
T ss_pred             cHHHHHCcCHHHHHHHHcCCCC
Confidence            5899999999999999998863


No 54 
>PF00376 MerR:  MerR family regulatory protein;  InterPro: IPR000551 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One of these is the MerR subfamily. MerR, which is found in many bacterial species mediates the mercuric-dependent induction of the mercury resistance operon. In the absence of mercury merR represses transcription by binding tightly, as a dimer, to the 'mer' operator region; when mercury is present the dimeric complex binds a single ion and becomes a potent transcriptional activator, while remaining bound to the mer site. Members of the family include the mercuric resistance operon regulatory protein merR; Bacillus subtilis bltR and bmrR; Bacillus glnR; Streptomyces coelicolor hspR; Bradyrhizobium japonicum nolA; Escherichia coli superoxide response regulator soxR; and Streptomyces lividans transcriptional activator tipA [, , , , , ]. Other members include hypothetical proteins from E. coli, B. subtilis and Haemophilus influenzae. Within this family, the HTH motif is situated towards the N terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3HH0_A 2DG6_A 1R8D_B 1JBG_A 2VZ4_A 2ZHH_A 2ZHG_A 1Q07_A 1Q06_A 1Q05_B ....
Probab=51.13  E-value=3.3  Score=19.51  Aligned_cols=19  Identities=37%  Similarity=0.522  Sum_probs=14.5

Q ss_pred             HHHHHHhCCCCCccccccc
Q psy8538          18 AELANSLGLSERQVRCPHH   36 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFq   36 (64)
                      .++|+.+|++.+.|+.|=+
T Consensus         3 ~e~A~~~gvs~~tlR~ye~   21 (38)
T PF00376_consen    3 GEVAKLLGVSPRTLRYYER   21 (38)
T ss_dssp             HHHHHHHTS-HHHHHHHHH
T ss_pred             HHHHHHHCCCHHHHHHHHH
Confidence            4689999999999888843


No 55 
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium.  Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA- and CarA-like proteins in this group appear to lack the long dimerization helix seen i
Probab=50.06  E-value=5.4  Score=20.21  Aligned_cols=20  Identities=20%  Similarity=0.267  Sum_probs=17.4

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|++...|..|-+.
T Consensus         4 ~eva~~~gvs~~tlr~w~~~   23 (68)
T cd01104           4 GAVARLTGVSPDTLRAWERR   23 (68)
T ss_pred             HHHHHHHCcCHHHHHHHHHh
Confidence            47899999999999999763


No 56 
>PF08281 Sigma70_r4_2:  Sigma-70, region 4;  InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors are involved in binding to the -35 promoter element via a helix-turn-helix motif [].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2LFW_A 1OR7_B 2H27_D 2O8X_B.
Probab=49.97  E-value=2.5  Score=20.67  Aligned_cols=23  Identities=35%  Similarity=0.414  Sum_probs=16.5

Q ss_pred             HHHHHHHHHhCCCCCcccccccC
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqN   37 (64)
                      -.-.++|..+|+++..|+.|.+.
T Consensus        27 ~s~~eIa~~l~~s~~~v~~~l~r   49 (54)
T PF08281_consen   27 MSYAEIAEILGISESTVKRRLRR   49 (54)
T ss_dssp             --HHHHHHHCTS-HHHHHHHHHH
T ss_pred             cCHHHHHHHHCcCHHHHHHHHHH
Confidence            34567899999999999887653


No 57 
>PF01381 HTH_3:  Helix-turn-helix;  InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould).; GO: 0043565 sequence-specific DNA binding; PDB: 2AXU_A 2AWI_D 2AXV_D 2AXZ_C 2AW6_A 3KXA_C 3BS3_A 2CRO_A 1ZUG_A 3CRO_R ....
Probab=49.58  E-value=5.5  Score=19.29  Aligned_cols=23  Identities=26%  Similarity=0.354  Sum_probs=19.3

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..+||..+|++...|..|..+.+
T Consensus        12 ~~~la~~~gis~~~i~~~~~g~~   34 (55)
T PF01381_consen   12 QKELAEKLGISRSTISRIENGKR   34 (55)
T ss_dssp             HHHHHHHHTS-HHHHHHHHTTSS
T ss_pred             HHHHHHHhCCCcchhHHHhcCCC
Confidence            36799999999999999999855


No 58 
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators. Helix-turn-helix (HTH) transcription regulator MlrA (merR-like regulator A) and related proteins, N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. Its close homolog, CarA from Myxococcus xanthus, is involved in activation of the carotenoid biosynthesis genes by light. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules. Many MlrA-like proteins in this group appear to lack the long dimerization helix seen
Probab=49.12  E-value=5.3  Score=20.51  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=17.4

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|+++..|+.|.+.
T Consensus         4 ~e~A~~~gVs~~tlr~ye~~   23 (68)
T cd04763           4 GEVALLTGIKPHVLRAWERE   23 (68)
T ss_pred             HHHHHHHCcCHHHHHHHHHh
Confidence            47899999999999999764


No 59 
>TIGR01764 excise DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376).
Probab=48.82  E-value=5.3  Score=18.52  Aligned_cols=22  Identities=32%  Similarity=0.265  Sum_probs=18.1

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|..+|++...|..|.+...
T Consensus         5 ~e~a~~lgis~~ti~~~~~~g~   26 (49)
T TIGR01764         5 EEAAEYLGVSKDTVYRLIHEGE   26 (49)
T ss_pred             HHHHHHHCCCHHHHHHHHHcCC
Confidence            4678999999999999986654


No 60 
>TIGR03070 couple_hipB transcriptional regulator, y4mF family. Members of this family belong to a clade of helix-turn-helix DNA-binding proteins, among the larger family pfam01381 (HTH_3; Helix-turn-helix). Members are similar in sequence to the HipB protein of E. coli. Genes for members of the seed alignment for this protein family were found to be closely linked to genes encoding proteins related to HipA. The HibBA operon appears to have some features in common with toxin-antitoxin post-segregational killing systems.
Probab=48.00  E-value=7.9  Score=18.53  Aligned_cols=23  Identities=26%  Similarity=0.312  Sum_probs=20.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..+||..+|++...|..|...++
T Consensus        18 q~~lA~~~gvs~~~vs~~e~g~~   40 (58)
T TIGR03070        18 QADLADLAGVGLRFIRDVENGKP   40 (58)
T ss_pred             HHHHHHHhCCCHHHHHHHHCCCC
Confidence            35799999999999999987775


No 61 
>smart00422 HTH_MERR helix_turn_helix, mercury resistance.
Probab=46.88  E-value=6  Score=20.07  Aligned_cols=20  Identities=30%  Similarity=0.355  Sum_probs=16.7

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|+++..|..|-..
T Consensus         4 ~eva~~~gvs~~tlr~~~~~   23 (70)
T smart00422        4 GEVAKLAGVSVRTLRYYERI   23 (70)
T ss_pred             HHHHHHHCcCHHHHHHHHHC
Confidence            46899999999999999543


No 62 
>PF01527 HTH_Tnp_1:  Transposase;  InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition. This family consists of various Escherichia coli insertion elements and other bacterial transposases some of which are members of the IS3 family. This region includes a helix-turn-helix motif (HTH) at the N terminus followed by a leucine zipper (LZ) motif. The LZ motif has been shown to mediate oligomerisation of the transposase components in IS911 []. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated; PDB: 2JN6_A 2RN7_A.
Probab=45.83  E-value=5.8  Score=20.52  Aligned_cols=22  Identities=23%  Similarity=0.237  Sum_probs=17.0

Q ss_pred             HHHHHHHHhCCCCCcccccccC
Q psy8538          16 RKAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ....+|..+|+++.++..|-.-
T Consensus        25 sv~~va~~~gi~~~~l~~W~~~   46 (76)
T PF01527_consen   25 SVSEVAREYGISPSTLYNWRKQ   46 (76)
T ss_dssp             HHHHHHHHHTS-HHHHHHHHHH
T ss_pred             ceEeeecccccccccccHHHHH
Confidence            4567899999999999999543


No 63 
>cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.
Probab=44.94  E-value=8.5  Score=17.40  Aligned_cols=22  Identities=27%  Similarity=0.338  Sum_probs=19.2

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..+|..+|+++..|..|..+..
T Consensus        16 ~~~a~~~~~~~~~v~~~~~g~~   37 (58)
T cd00093          16 EELAEKLGVSRSTISRIENGKR   37 (58)
T ss_pred             HHHHHHHCCCHHHHHHHHcCCC
Confidence            4789999999999999988765


No 64 
>PRK09643 RNA polymerase sigma factor SigM; Reviewed
Probab=44.67  E-value=16  Score=22.37  Aligned_cols=40  Identities=25%  Similarity=0.302  Sum_probs=26.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhcCCCCCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVHGDGRNS   62 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~~~g~~s   62 (64)
                      -.++|..+|++...|++=  -.|++    .++.+..+...++||.|
T Consensus       153 ~~EIA~~lg~s~~tV~~r--l~rar----~~Lr~~l~~~~~~~~~~  192 (192)
T PRK09643        153 VADAARMLGVAEGTVKSR--CARGR----ARLAELLGYLRAGGNAS  192 (192)
T ss_pred             HHHHHHHHCcCHHHHHHH--HHHHH----HHHHHHHHHhcCCCCCC
Confidence            457899999999988641  12221    24566666777777754


No 65 
>PF12728 HTH_17:  Helix-turn-helix domain
Probab=42.88  E-value=7.3  Score=18.78  Aligned_cols=22  Identities=32%  Similarity=0.157  Sum_probs=18.3

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|..||++...|..|.....
T Consensus         5 ~e~a~~l~is~~tv~~~~~~g~   26 (51)
T PF12728_consen    5 KEAAELLGISRSTVYRWIRQGK   26 (51)
T ss_pred             HHHHHHHCcCHHHHHHHHHcCC
Confidence            4689999999999999986653


No 66 
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed helical bundle. The principal DNA-protein interface is formed by the third helix, the recognition helix, inserting itself into the major groove of the DNA. A diverse array of HTH domains participate in a variety of functions that depend on their DNA-binding properties. HTH_Hin represents one of the simplest versions of the HTH domains; the characterization of homologous relationships between various sequence-diverse HTH domain families remains difficult. The Hin recombinase induces the site-specific inversion of a chromosomal DNA segment containing a promoter, which controls the alternate expression of two genes by reversibly switching orientation. The Hin recombinase consists of a single polypeptide chain containing a D
Probab=42.70  E-value=9.8  Score=15.52  Aligned_cols=18  Identities=33%  Similarity=0.355  Sum_probs=12.6

Q ss_pred             HHHHHHHhCCCCCccccc
Q psy8538          17 KAELANSLGLSERQVRCP   34 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vW   34 (64)
                      ...+|..+|++...|..|
T Consensus        24 ~~~ia~~~~is~~tv~~~   41 (42)
T cd00569          24 VAEIARRLGVSRSTLYRY   41 (42)
T ss_pred             HHHHHHHHCCCHHHHHHh
Confidence            346778888887776655


No 67 
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or plastid core RNA polymerase to specific promoter elements located upstream of transcription initiation points. The SR4 of Ec sigma70 and other essential primary SFs contact promoter sequences located 35 base-pairs upstream of the initiation point, recognizing a 6-base-pair -35 consensus TTGACA.  Sigma70 related SFs also include SFs which are dispensable for bacterial cell growth for example Ec sigmaS, SFs which activate regulons in response to a specific signal for example heat-shock Ec sigmaH, and a group of SFs which includes the extracytoplasmic function (ECF) SFs and is typified by Ec sigmaE which contains SR2 and -4 only. ECF SFs direct the transcription of genes that regulate various responses including periplas
Probab=42.62  E-value=6  Score=18.22  Aligned_cols=21  Identities=38%  Similarity=0.509  Sum_probs=16.8

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ...+|..+|++...|..|...
T Consensus        29 ~~~ia~~~~~s~~~i~~~~~~   49 (55)
T cd06171          29 YEEIAEILGISRSTVRQRLHR   49 (55)
T ss_pred             HHHHHHHHCcCHHHHHHHHHH
Confidence            456799999999999887654


No 68 
>COG5484 Uncharacterized conserved protein [Function unknown]
Probab=41.41  E-value=12  Score=25.34  Aligned_cols=22  Identities=18%  Similarity=0.412  Sum_probs=18.3

Q ss_pred             HHHHHHHHhCCCCCcccccccC
Q psy8538          16 RKAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqN   37 (64)
                      .-..+|.++|+++.+|+-|-+.
T Consensus        21 k~~dIAeklGvspntiksWKrr   42 (279)
T COG5484          21 KLKDIAEKLGVSPNTIKSWKRR   42 (279)
T ss_pred             cHHHHHHHhCCChHHHHHHHHh
Confidence            3457899999999999999543


No 69 
>PHA00542 putative Cro-like protein
Probab=39.45  E-value=22  Score=19.24  Aligned_cols=40  Identities=5%  Similarity=0.031  Sum_probs=26.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCc--ccccchHHHHHHHHHhc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT--TVNNNTAIIVSFLEKVH   56 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR--~~~k~~~~~~~~~~~~~   56 (64)
                      ..+||..+|++...|..|...+.  ........++.+.....
T Consensus        34 q~elA~~lgIs~~tIsr~e~g~~~~p~~~~l~ki~~~~~~~~   75 (82)
T PHA00542         34 QEQIADATDVSQPTICRIYSGRHKDPRYSVVEKLRHLVLNLD   75 (82)
T ss_pred             HHHHHHHHCcCHHHHHHHHcCCCCCCCHHHHHHHHHHHHHhc
Confidence            34689999999999999988763  33333334444444443


No 70 
>PHA01976 helix-turn-helix protein
Probab=38.87  E-value=12  Score=18.79  Aligned_cols=23  Identities=13%  Similarity=0.101  Sum_probs=19.5

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..+||..+|++...|..|-...+
T Consensus        18 ~~~lA~~~gvs~~~v~~~e~g~~   40 (67)
T PHA01976         18 APELSRRAGVRHSLIYDFEADKR   40 (67)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCC
Confidence            45799999999999999987654


No 71 
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by Pfam model pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair.
Probab=38.45  E-value=12  Score=19.30  Aligned_cols=23  Identities=22%  Similarity=0.190  Sum_probs=20.0

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ...||..+|++...|..|..+++
T Consensus        21 ~~~lA~~~gis~~tis~~~~g~~   43 (78)
T TIGR02607        21 IRALAKALGVSRSTLSRIVNGRR   43 (78)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCC
Confidence            35799999999999999998765


No 72 
>PF14229 DUF4332:  Domain of unknown function (DUF4332)
Probab=38.26  E-value=15  Score=21.47  Aligned_cols=23  Identities=35%  Similarity=0.276  Sum_probs=20.2

Q ss_pred             CCHHHHHHHHHHhCCCCCccccc
Q psy8538          12 ITIRRKAELANSLGLSERQVRCP   34 (64)
Q Consensus        12 p~~~~r~~La~~l~l~~~qV~vW   34 (64)
                      ++...|..||.+++++...|..|
T Consensus        27 ~~~~~r~~La~~~~i~~~~l~~w   49 (122)
T PF14229_consen   27 DTPLGRKALAKKLGISERNLLKW   49 (122)
T ss_pred             CCHHHHHHHHHhcCCCHHHHHHH
Confidence            55667888999999999999999


No 73 
>PHA02955 hypothetical protein; Provisional
Probab=36.69  E-value=41  Score=21.98  Aligned_cols=28  Identities=11%  Similarity=0.227  Sum_probs=23.3

Q ss_pred             CCCHHHHHHHHHHhCCCCCcccccccCC
Q psy8538          11 YITIRRKAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        11 ~p~~~~r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      -++..++..++..+|+....|..||.+-
T Consensus        76 ~Lp~~qk~~ia~~lgI~~~~~~~d~~t~  103 (213)
T PHA02955         76 NFPEKEQKEIAADIGINIDDYKAGKKTD  103 (213)
T ss_pred             hCCHHHHHHHHHHhCCChhhccCcccch
Confidence            3667889999999999997778888773


No 74 
>PF13404 HTH_AsnC-type:  AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B ....
Probab=36.24  E-value=12  Score=17.92  Aligned_cols=16  Identities=69%  Similarity=0.827  Sum_probs=11.6

Q ss_pred             HHHHHHHhCCCCCccc
Q psy8538          17 KAELANSLGLSERQVR   32 (64)
Q Consensus        17 r~~La~~l~l~~~qV~   32 (64)
                      -.+||..+|+++..|.
T Consensus        20 ~~~la~~lglS~~~v~   35 (42)
T PF13404_consen   20 YAELAEELGLSESTVR   35 (42)
T ss_dssp             HHHHHHHHTS-HHHHH
T ss_pred             HHHHHHHHCcCHHHHH
Confidence            3478999999987654


No 75 
>PF04936 DUF658:  Protein of unknown function (DUF658);  InterPro: IPR007020 This entry is represented by Bacteriophage r1t, Orf18. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. These are proteins of unknown function found in Lactococcus lactis and in their associated bacteriophage. 
Probab=36.12  E-value=13  Score=23.57  Aligned_cols=28  Identities=18%  Similarity=0.080  Sum_probs=23.9

Q ss_pred             HHHHHHHHhCCCCCcccccccCCccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      ...+|+.-+++|..+|-+|..|.+.-.+
T Consensus        16 t~~e~~~~~~VS~~sv~~WiKNG~~~~~   43 (186)
T PF04936_consen   16 TIDELADYFDVSRTSVSVWIKNGKDPKR   43 (186)
T ss_pred             cHHHHHHHHccCHHHHHHHHHcCCCccc
Confidence            4678999999999999999999876443


No 76 
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an  N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcrip
Probab=36.03  E-value=11  Score=21.07  Aligned_cols=22  Identities=23%  Similarity=0.170  Sum_probs=18.4

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|+.+|++...|+.|..+.-
T Consensus         4 ~eva~~~gvs~~tlR~ye~~Gl   25 (103)
T cd01106           4 GEVAKLTGVSVRTLHYYDEIGL   25 (103)
T ss_pred             HHHHHHHCcCHHHHHHHHHCCC
Confidence            4689999999999999976643


No 77 
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=35.99  E-value=16  Score=16.25  Aligned_cols=23  Identities=26%  Similarity=0.326  Sum_probs=19.2

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ...+|..+|++...|..|-.+..
T Consensus        13 ~~~la~~~~i~~~~i~~~~~~~~   35 (56)
T smart00530       13 QEELAEKLGVSRSTLSRIENGKR   35 (56)
T ss_pred             HHHHHHHhCCCHHHHHHHHCCCC
Confidence            34789999999999999977664


No 78 
>COG1905 NuoE NADH:ubiquinone oxidoreductase 24 kD subunit [Energy production and conversion]
Probab=35.81  E-value=25  Score=21.93  Aligned_cols=31  Identities=16%  Similarity=0.209  Sum_probs=25.4

Q ss_pred             chhhhccCCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           2 DSLEFHYSRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         2 ~e~~F~~~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      |...+....|.+......+|..||++...|.
T Consensus        31 L~~aQ~~~G~l~~~ai~~iA~~L~i~~~~v~   61 (160)
T COG1905          31 LHIAQEQFGWLPPEAIEEIADMLGIPRARVY   61 (160)
T ss_pred             HHHHHHHhCCCCHHHHHHHHHHhCCCHHHhe
Confidence            5556667779999999999999999987664


No 79 
>PRK09413 IS2 repressor TnpA; Reviewed
Probab=35.70  E-value=12  Score=21.65  Aligned_cols=21  Identities=19%  Similarity=0.120  Sum_probs=17.8

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ...+|.++|+++.+|..|.+-
T Consensus        32 v~evA~e~gIs~~tl~~W~r~   52 (121)
T PRK09413         32 VSLVARQHGVAASQLFLWRKQ   52 (121)
T ss_pred             HHHHHHHHCcCHHHHHHHHHH
Confidence            457899999999999999654


No 80 
>PF13542 HTH_Tnp_ISL3:  Helix-turn-helix domain of transposase family ISL3
Probab=35.62  E-value=10  Score=18.21  Aligned_cols=19  Identities=32%  Similarity=0.300  Sum_probs=15.2

Q ss_pred             HHHHHHHhCCCCCcccccc
Q psy8538          17 KAELANSLGLSERQVRCPH   35 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWF   35 (64)
                      ...+|+.+|++...|...|
T Consensus        30 ~~~vA~~~~vs~~TV~ri~   48 (52)
T PF13542_consen   30 FKDVARELGVSWSTVRRIF   48 (52)
T ss_pred             HHHHHHHHCCCHHHHHHHH
Confidence            4578999999998887665


No 81 
>PRK13890 conjugal transfer protein TrbA; Provisional
Probab=35.32  E-value=15  Score=21.34  Aligned_cols=23  Identities=22%  Similarity=0.121  Sum_probs=20.6

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      +.+||..+|++...|..|.+++.
T Consensus        21 q~eLA~~~Gis~~~is~iE~g~~   43 (120)
T PRK13890         21 KKELSERSGVSISFLSDLTTGKA   43 (120)
T ss_pred             HHHHHHHHCcCHHHHHHHHcCCC
Confidence            45799999999999999999886


No 82 
>PF01710 HTH_Tnp_IS630:  Transposase;  InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition. This entry includes insertion sequences from Synechocystis sp. (strain PCC 6803) three of which are characterised as homologous to bacterial IS5- and IS4- and to several members of the IS630-Tc1-mariner superfamily []. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=35.17  E-value=9.7  Score=21.98  Aligned_cols=21  Identities=24%  Similarity=0.170  Sum_probs=18.4

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|..++++...|..|++.
T Consensus        21 ~~eaa~~F~VS~~Tv~~W~k~   41 (119)
T PF01710_consen   21 IREAAKRFGVSRNTVYRWLKR   41 (119)
T ss_pred             HHHHHHHhCcHHHHHHHHHHh
Confidence            456799999999999999993


No 83 
>PF06971 Put_DNA-bind_N:  Putative DNA-binding protein N-terminus;  InterPro: IPR009718 This entry represents the C terminus (approximately 30 residues) of a number of Rex proteins. These are redox-sensing repressors that appear to be widespread among Gram-positive bacteria []. They modulate transcription in response to changes in cellular NADH/NAD(+) redox state. Rex is predicted to include a pyridine nucleotide-binding domain (Rossmann fold), and residues that might play key structural and nucleotide binding roles are highly conserved.; GO: 0045892 negative regulation of transcription, DNA-dependent, 0051775 response to redox state, 0005737 cytoplasm; PDB: 3IL2_B 3IKT_A 3IKV_B 1XCB_F 2DT5_A 2VT3_A 2VT2_A 3KEO_B 3KET_A 3KEQ_A ....
Probab=35.08  E-value=12  Score=18.85  Aligned_cols=15  Identities=53%  Similarity=0.809  Sum_probs=11.5

Q ss_pred             HHHHHHhCCCCCccc
Q psy8538          18 AELANSLGLSERQVR   32 (64)
Q Consensus        18 ~~La~~l~l~~~qV~   32 (64)
                      .+||..+|+++.||+
T Consensus        32 ~~La~~~gi~~~qVR   46 (50)
T PF06971_consen   32 QELAEALGITPAQVR   46 (50)
T ss_dssp             HHHHHHHTS-HHHHH
T ss_pred             HHHHHHHCCCHHHhc
Confidence            368999999998875


No 84 
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=34.93  E-value=11  Score=20.63  Aligned_cols=18  Identities=33%  Similarity=0.433  Sum_probs=15.9

Q ss_pred             HHHHHHhCCCCCcccccc
Q psy8538          18 AELANSLGLSERQVRCPH   35 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWF   35 (64)
                      .++|+.+|++..+++.|-
T Consensus         5 ~evA~~~gvs~~tLR~ye   22 (88)
T cd01105           5 GEVSKLTGVSPRQLRYWE   22 (88)
T ss_pred             HHHHHHHCcCHHHHHHHH
Confidence            478999999999999993


No 85 
>PF14549 P22_Cro:  DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B.
Probab=34.56  E-value=9.9  Score=19.80  Aligned_cols=17  Identities=35%  Similarity=0.429  Sum_probs=14.8

Q ss_pred             HHHHHHhCCCCCccccc
Q psy8538          18 AELANSLGLSERQVRCP   34 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vW   34 (64)
                      ..||+.||++...|--|
T Consensus        13 ~~lAkalGVs~~aVs~W   29 (60)
T PF14549_consen   13 SKLAKALGVSPQAVSQW   29 (60)
T ss_dssp             HHHHHHHTS-HHHHHHH
T ss_pred             HHHHHHHCCCHHHHHHh
Confidence            47899999999999999


No 86 
>PF13551 HTH_29:  Winged helix-turn helix
Probab=33.54  E-value=9.8  Score=20.77  Aligned_cols=23  Identities=35%  Similarity=0.353  Sum_probs=19.3

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..++|..+|++...|..|.+.-+
T Consensus        15 ~~~ia~~lg~s~~Tv~r~~~~~~   37 (112)
T PF13551_consen   15 IAEIARRLGISRRTVYRWLKRYR   37 (112)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHH
Confidence            56789999999999999977633


No 87 
>PRK09706 transcriptional repressor DicA; Reviewed
Probab=33.31  E-value=17  Score=21.18  Aligned_cols=24  Identities=17%  Similarity=0.137  Sum_probs=20.7

Q ss_pred             HHHHHHHhCCCCCcccccccCCcc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      ..+||..+|++...|..|..+.+.
T Consensus        21 q~~lA~~~gvs~~~is~~E~g~~~   44 (135)
T PRK09706         21 QRSLAKAVKVSHVSISQWERDETE   44 (135)
T ss_pred             HHHHHHHhCCCHHHHHHHHcCCCC
Confidence            357899999999999999988763


No 88 
>PF08279 HTH_11:  HTH domain;  InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets. The winged helix motif consists of two wings (W1, W2), three alpha helices (H1, H2, H3) and three beta-sheets (S1, S2, S3) arranged in the order H1-S1-H2-H3-S2-W1-S3-W2 []. The DNA-recognition helix makes sequence-specific DNA contacts with the major groove of DNA, while the wings make different DNA contacts, often with the minor groove or the backbone of DNA. Several winged-helix proteins display an exposed patch of hydrophobic residues thought to mediate protein-protein interactions. This entry represents a subset of the winged helix domain superfamily which is predominantly found in bacterial proteins, though there are also some archaeal and eukaryotic examples. This domain is commonly found in the biotin (vitamin H) repressor protein BirA which regulates transcription of the biotin operon []. It is also found in other proteins including regulators of amino acid biosynthsis such as LysM [], and regulators of carbohydrate metabolisms such as LicR and FrvR [, ].; PDB: 1HXD_B 2EWN_B 1BIA_A 1BIB_A 1J5Y_A 3V7S_A 3V7C_A 3RKW_A 3RIR_A 3RKX_A ....
Probab=33.10  E-value=12  Score=18.14  Aligned_cols=16  Identities=50%  Similarity=0.787  Sum_probs=11.7

Q ss_pred             HHHHHHHhCCCCCccc
Q psy8538          17 KAELANSLGLSERQVR   32 (64)
Q Consensus        17 r~~La~~l~l~~~qV~   32 (64)
                      ..+||..+++|.+.|.
T Consensus        18 ~~eLa~~l~vS~rTi~   33 (55)
T PF08279_consen   18 AKELAEELGVSRRTIR   33 (55)
T ss_dssp             HHHHHHHCTS-HHHHH
T ss_pred             HHHHHHHhCCCHHHHH
Confidence            3478999999987664


No 89 
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain.  For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization.  For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental
Probab=33.00  E-value=14  Score=17.43  Aligned_cols=20  Identities=35%  Similarity=0.579  Sum_probs=16.6

Q ss_pred             HHHHHHHhCCCCCccccccc
Q psy8538          17 KAELANSLGLSERQVRCPHH   36 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFq   36 (64)
                      ..++|..++++...|..|..
T Consensus        18 ~~eia~~l~~s~~tv~~~~~   37 (57)
T cd06170          18 NKEIADILGISEKTVKTHLR   37 (57)
T ss_pred             HHHHHHHHCCCHHHHHHHHH
Confidence            45789999999999988765


No 90 
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain  with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=32.93  E-value=15  Score=20.05  Aligned_cols=22  Identities=14%  Similarity=0.034  Sum_probs=18.4

Q ss_pred             HHHHHHHhCCCCCcccccccCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ..++|..+|++...|..|-+..
T Consensus         4 i~e~A~~~gvs~~tLr~ye~~G   25 (91)
T cd04766           4 ISVAAELSGMHPQTLRLYERLG   25 (91)
T ss_pred             HHHHHHHHCcCHHHHHHHHHCC
Confidence            3478999999999999997654


No 91 
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein. parkin_N  parkin protein is a RING-type E3 ubiquitin ligase with an amino-terminal ubiquitin-like (Ubl) domain and an RBR signature consisting of two RING finger domains separated by an IBR/DRIL domain.  Naturally occurring mutations in parkin are thought to cause the disease AR_JP (autosomal-recessive juvenile parkinsonism). Parkin binds the Rpn10 subunit of  26S proteasomes through its Ubl domain.
Probab=32.44  E-value=34  Score=17.48  Aligned_cols=28  Identities=21%  Similarity=0.178  Sum_probs=22.6

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCcccc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLTTVN   42 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR~~~   42 (64)
                      .-+..++.+.|++..+...+|.++.-.+
T Consensus        23 ~lK~~i~~~~gi~~~~q~Li~~G~~L~d   50 (70)
T cd01798          23 QLKEVVAKRQGVPPDQLRVIFAGKELRN   50 (70)
T ss_pred             HHHHHHHHHHCCCHHHeEEEECCeECCC
Confidence            3456799999999999999999876443


No 92 
>PRK05988 formate dehydrogenase subunit gamma; Validated
Probab=32.13  E-value=27  Score=21.35  Aligned_cols=25  Identities=24%  Similarity=0.280  Sum_probs=21.5

Q ss_pred             cCCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           8 YSRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         8 ~~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      ...|++......+|..+|+++.+|.
T Consensus        35 ~~G~Ip~e~~~~iA~~l~v~~~~V~   59 (156)
T PRK05988         35 EFGYVPEDAVPVIAEALNLSRAEVH   59 (156)
T ss_pred             HcCCCCHHHHHHHHHHhCCCHHHHH
Confidence            4568999999999999999988765


No 93 
>cd08313 Death_TNFR1 Death domain of Tumor Necrosis Factor Receptor 1. Death Domain (DD) found in tumor necrosis factor receptor-1 (TNFR-1). TNFR-1 has many names including TNFRSF1A, CD120a, p55, p60, and TNFR60. It activates two major intracellular signaling pathways that lead to the activation of the transcription factor NF-kB and the induction of cell death. Upon binding of its ligand TNF, TNFR-1 trimerizes which leads to the recruitment of an adaptor protein named TNFR-associated death domain protein (TRADD) through a DD/DD interaction. Mutations in the TNFRSF1A gene causes TNFR-associated periodic syndrome (TRAPS), a rare disorder characterized recurrent fever, myalgia, abdominal pain, conjunctivitis and skin eruptions. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation a
Probab=32.06  E-value=37  Score=18.61  Aligned_cols=19  Identities=37%  Similarity=0.592  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHhCCCCCccc
Q psy8538          14 IRRKAELANSLGLSERQVR   32 (64)
Q Consensus        14 ~~~r~~La~~l~l~~~qV~   32 (64)
                      ...=..+++++||++.+|.
T Consensus        11 ~~~wk~~~R~LGlse~~Id   29 (80)
T cd08313          11 PRRWKEFVRRLGLSDNEIE   29 (80)
T ss_pred             HHHHHHHHHHcCCCHHHHH
Confidence            3455679999999998875


No 94 
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain. DDI1_N   DDI1 (DNA damage inducible protein 1) has an amino-terminal ubiquitin-like domain, an retroviral protease-like (RVP-like) domain, and a UBA (ubiquitin-associated) domain.  This CD represents the amino-terminal ubiquitin-like domain of DDI1.
Probab=31.42  E-value=35  Score=17.68  Aligned_cols=26  Identities=15%  Similarity=-0.013  Sum_probs=21.0

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCcc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      .-+..++...|++..+.+.||..+--
T Consensus        24 ~lK~~I~~~~gip~~~q~Li~~Gk~L   49 (71)
T cd01796          24 NFKALCEAESGIPASQQQLIYNGREL   49 (71)
T ss_pred             HHHHHHHHHhCCCHHHeEEEECCeEc
Confidence            34567899999999999999987643


No 95 
>PF03584 Herpes_ICP4_N:  Herpesvirus ICP4-like protein N-terminal region;  InterPro: IPR005206 The immediate-early protein ICP4 (infected-cell polypeptide 4) is required for efficient transcription of early and late viral genes and is thus essential for productive infection. ICP4 is a large phosphoprotein that binds DNA in a sequence specific manner as a homodimer. ICP4 represses transcription from LAT, ICP4 and ORF-P that have high-affinity a ICP4 binding site that spans the transcription initiation site. ICP4 proteins have two highly conserved regions, this family contains the N-terminal region that contains sites for DNA binding and homodimerisation [].; GO: 0045893 positive regulation of transcription, DNA-dependent, 0042025 host cell nucleus
Probab=31.38  E-value=92  Score=19.75  Aligned_cols=46  Identities=15%  Similarity=0.226  Sum_probs=31.8

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCcccccchHHHHHHHHHhcCCCCC
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLTTVNNNTAIIVSFLEKVHGDGRN   61 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR~~~k~~~~~~~~~~~~~~~g~~   61 (64)
                      .+-..|.+.+-.+...+-.|.||-+--.... .+..++.+..+.+.+
T Consensus        61 kQy~aLv~~~~~~~~~~m~wlq~~Kls~~d~-~L~~~cqk~~~~~~~  106 (173)
T PF03584_consen   61 KQYEALVRLIYTPDRDAMAWLQNPKLSPADQ-ALNQFCQKFRGGGRS  106 (173)
T ss_pred             HHHHHHHHHHhcccHHHHHHhcCCCcCchHH-HHHHHHHHhccCCCC
Confidence            3445677777667888999999988655444 777777666555554


No 96 
>PTZ00044 ubiquitin; Provisional
Probab=31.28  E-value=34  Score=17.61  Aligned_cols=28  Identities=18%  Similarity=0.195  Sum_probs=22.1

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCcccc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLTTVN   42 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR~~~   42 (64)
                      .-+..++...|++..+.+.||..+--.+
T Consensus        25 ~lK~~i~~~~gi~~~~q~L~~~g~~L~d   52 (76)
T PTZ00044         25 QVKMALQEKEGIDVKQIRLIYSGKQMSD   52 (76)
T ss_pred             HHHHHHHHHHCCCHHHeEEEECCEEccC
Confidence            3456799999999999999998765443


No 97 
>PF08765 Mor:  Mor transcription activator family;  InterPro: IPR014875 Mor (Middle operon regulator) is a sequence specific DNA binding protein. It mediates transcription activation through its interactions with the C-terminal domains of the alpha and sigma subunits of bacterial RNA polymerase. The N-terminal region of Mor is the dimerisation region, and the C-terminal contains a helix-turn-helix motif which binds DNA []. ; PDB: 1RR7_A.
Probab=30.81  E-value=16  Score=20.79  Aligned_cols=17  Identities=53%  Similarity=0.657  Sum_probs=11.6

Q ss_pred             HHHHHHHHhCCCCCccc
Q psy8538          16 RKAELANSLGLSERQVR   32 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~   32 (64)
                      ...+||.++|||+++|.
T Consensus        74 n~~eLA~kyglS~r~I~   90 (108)
T PF08765_consen   74 NVRELARKYGLSERQIY   90 (108)
T ss_dssp             -HHHHHHHHT--HHHHH
T ss_pred             CHHHHHHHHCcCHHHHH
Confidence            35689999999998764


No 98 
>PF05269 Phage_CII:  Bacteriophage CII protein;  InterPro: IPR007933 The CII protein is a transcription activator, conserved in bacteriophage lambda and related phages, that plays a key role in the decision between lytic or lysogenic phage development. CII is regulated at multiple levels including transcription, translation initiation, mRNA stability, and proteolysis []. Conditions that stabilise cII favour lysogenic development. The lambda CII protein activates three specific promoters, binding to direct repeat sequences rather than the more usual inverted repeats. Structurally, CII is a homotetramer where each monomer is composed of four alpha helices and a disordered C terminus [, ]. The alpha helical region is responsible for DNA binding and multimerisation. The homotetramer has an unusual spatial arrangement that allows recognition of the direct repeat sequences.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1ZS4_C 1ZPQ_C 1XWR_A.
Probab=30.42  E-value=32  Score=19.50  Aligned_cols=19  Identities=16%  Similarity=0.345  Sum_probs=16.4

Q ss_pred             HHHHHHhCCCCCccccccc
Q psy8538          18 AELANSLGLSERQVRCPHH   36 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFq   36 (64)
                      ..+|..+|+++.+|-.|..
T Consensus        27 ~~vA~~~Gv~eStISR~k~   45 (91)
T PF05269_consen   27 KKVAEAMGVDESTISRWKN   45 (91)
T ss_dssp             HHHHHHHTSSTTTHHHHHH
T ss_pred             HHHHHHhCCCHHHHHHHHh
Confidence            4689999999999999954


No 99 
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=30.02  E-value=39  Score=17.52  Aligned_cols=28  Identities=14%  Similarity=0.058  Sum_probs=22.6

Q ss_pred             HHHHHHHHhCCCCCcccccccCCccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      -+..++...|++..+...+|.++.-.+-
T Consensus        24 lK~~i~~~~gip~~~q~Li~~Gk~L~D~   51 (74)
T cd01793          24 IKAHVAGLEGIDVEDQVLLLAGVPLEDD   51 (74)
T ss_pred             HHHHHHhhhCCCHHHEEEEECCeECCCC
Confidence            4567899999999999999998765444


No 100
>TIGR01958 nuoE_fam NADH-quinone oxidoreductase, E subunit. This model describes the E chain of complexes that resemble NADH-quinone oxidoreductases. The electron acceptor is a quinone, ubiquinone, in mitochondria and most bacteria, including Escherichia coli, where the recommended gene symbol is nuoB. This model does not identify proteins from chloroplast and cyanobacteria.
Probab=29.90  E-value=30  Score=20.71  Aligned_cols=24  Identities=25%  Similarity=0.282  Sum_probs=20.6

Q ss_pred             CCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           9 SRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         9 ~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      ..|++......+|..+|++..+|.
T Consensus        29 ~G~i~~~~~~~iA~~l~~~~~~v~   52 (148)
T TIGR01958        29 KGWVTPEAIAAVAEMLGIPPVWVY   52 (148)
T ss_pred             hCCCCHHHHHHHHHHhCcCHHHHH
Confidence            458999999999999999987765


No 101
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon
Probab=29.81  E-value=17  Score=16.98  Aligned_cols=21  Identities=33%  Similarity=0.555  Sum_probs=16.8

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|..+|++...|..|...
T Consensus        21 ~~eia~~l~is~~tv~~~~~~   41 (58)
T smart00421       21 NKEIAERLGISEKTVKTHLSN   41 (58)
T ss_pred             HHHHHHHHCCCHHHHHHHHHH
Confidence            457899999999998877553


No 102
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=29.80  E-value=17  Score=19.91  Aligned_cols=21  Identities=33%  Similarity=0.401  Sum_probs=17.5

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|..+|+++..|..|-+..
T Consensus         4 ~eva~~~gi~~~tlr~~~~~G   24 (100)
T cd00592           4 GEVAKLLGVSVRTLRYYEEKG   24 (100)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            468999999999999996554


No 103
>PF07471 Phage_Nu1:  Phage DNA packaging protein Nu1;  InterPro: IPR010906 This entry is represented by the Bacteriophage lambda, Nu1, terminase small subunit. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. Terminase, the DNA packaging enzyme of bacteriophage lambda, is a heteromultimer composed of subunits Nu1 and A. The smaller Nu1 terminase subunit has a low-affinity ATPase stimulated by non-specific DNA [].; PDB: 1J9I_A.
Probab=29.75  E-value=16  Score=22.63  Aligned_cols=21  Identities=43%  Similarity=0.514  Sum_probs=16.6

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      +.+||..+|+|+..|.-|-.+
T Consensus         5 k~~lA~i~gvS~~ti~~W~~~   25 (164)
T PF07471_consen    5 KKELAEIFGVSERTIDKWQRQ   25 (164)
T ss_dssp             HHHHHHHTT--HHHHHHHTTT
T ss_pred             HHHHHHHHCCCHHHHHHHHHC
Confidence            568999999999999999765


No 104
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator. Putative helix-turn-helix (HTH) MerR-like transcription regulator; the N-terminal domain of Cfa, a cyclopropane fatty acid synthase and other related methyltransferases. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=29.68  E-value=15  Score=20.58  Aligned_cols=22  Identities=23%  Similarity=0.178  Sum_probs=17.9

Q ss_pred             HHHHHHHhCCCCCcccccccCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ..++|+.+|++...|..|-+..
T Consensus         4 i~eva~~~gvs~~tlR~ye~~G   25 (102)
T cd04789           4 ISELAEKAGISRSTLLYYEKLG   25 (102)
T ss_pred             HHHHHHHHCcCHHHHHHHHHCC
Confidence            3478999999999999886653


No 105
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators. Putative helix-turn-helix (HTH) MerR-like transcription regulators; the HTH domain of Cfa, a cyclopropane fatty acid synthase, and other related methyltransferases, as well as, the N-terminal domain of a conserved, uncharacterized ~172 a.a. protein. Based on sequence similarity of the N-terminal domain, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimil
Probab=29.39  E-value=16  Score=20.52  Aligned_cols=21  Identities=10%  Similarity=0.184  Sum_probs=17.5

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|+.+|+|...+..|-+.
T Consensus         4 i~eva~~~gvs~~tLR~ye~~   24 (102)
T cd04775           4 IGQMSRKFGVSRSTLLYYESI   24 (102)
T ss_pred             HHHHHHHHCcCHHHHHHHHHC
Confidence            357899999999999988664


No 106
>cd04788 HTH_NolA-AlbR Helix-Turn-Helix DNA binding domain of the transcription regulators NolA and AlbR. Helix-turn-helix (HTH) transcription regulators NolA and AlbR, N-terminal domain. In Bradyrhizobium (Arachis) sp. NC92, NolA is required for efficient nodulation of host plants. In Xanthomonas albilineans, AlbR regulates the expression of the pathotoxin, albicidin. These proteins are putatively comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. They share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=29.19  E-value=16  Score=20.26  Aligned_cols=21  Identities=38%  Similarity=0.366  Sum_probs=17.9

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|-+..
T Consensus         4 ~eva~~~gvs~~tlR~ye~~G   24 (96)
T cd04788           4 GELARRTGLSVRTLHHYDHIG   24 (96)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999997654


No 107
>PF08280 HTH_Mga:  M protein trans-acting positive regulator (MGA) HTH domain;  InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [].; PDB: 2WTE_A 3SQN_A.
Probab=29.16  E-value=16  Score=18.48  Aligned_cols=16  Identities=44%  Similarity=0.671  Sum_probs=12.1

Q ss_pred             HHHHHHhCCCCCcccc
Q psy8538          18 AELANSLGLSERQVRC   33 (64)
Q Consensus        18 ~~La~~l~l~~~qV~v   33 (64)
                      .+||..+|+|++.|+.
T Consensus        23 ~ela~~l~~S~rti~~   38 (59)
T PF08280_consen   23 KELAKKLNISERTIKN   38 (59)
T ss_dssp             HHHHHHCTS-HHHHHH
T ss_pred             HHHHHHHCCCHHHHHH
Confidence            3789999999987754


No 108
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=28.87  E-value=49  Score=18.61  Aligned_cols=22  Identities=18%  Similarity=-0.004  Sum_probs=18.8

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .+||..+|++...|.-|-....
T Consensus        82 ~~lA~~lg~~~~tis~~e~g~~  103 (127)
T TIGR03830        82 REAAELLGGGVNAFSRYERGEV  103 (127)
T ss_pred             HHHHHHhCCCHHHHHHHHCCCC
Confidence            4789999999999999976665


No 109
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator. Helix-turn-helix (HTH) transcription regulator, YfmP, and related proteins; N-terminal domain. YfmP regulates the multidrug efflux protein, YfmO, and indirectly regulates the expression of the Bacillus subtilis copZA operon encoding a metallochaperone, CopZ, and a CPx-type ATPase efflux protein, CopA. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=28.86  E-value=19  Score=20.05  Aligned_cols=21  Identities=29%  Similarity=0.406  Sum_probs=17.9

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|....
T Consensus         4 ~e~a~~~gvs~~tLR~ye~~G   24 (96)
T cd04774           4 DEVAKRLGLTKRTLKYYEEIG   24 (96)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999997653


No 110
>cd01769 UBL Ubiquitin-like domain of UBL. UBLs function by remodeling the surface of their target proteins, changing their target's half-life, enzymatic activity, protein-protein interactions, subcellular localization or other properties. At least 10 different ubiquitin-like modifications exist in mammals, and attachment of different ubls to a target leads to different biological consequences. Ubl-conjugation cascades are initiated by activating enzymes, which also coordinate the ubls with their downstream pathways.
Probab=28.77  E-value=42  Score=16.38  Aligned_cols=25  Identities=24%  Similarity=0.149  Sum_probs=19.9

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .-+..++..++++...+..+|..+-
T Consensus        22 ~lK~~i~~~~~~~~~~~~l~~~g~~   46 (69)
T cd01769          22 ELKAKIAAKEGVPPEQQRLIYAGKI   46 (69)
T ss_pred             HHHHHHHHHHCcChHHEEEEECCcC
Confidence            3456789999999999999887643


No 111
>cd04779 HTH_MerR-like_sg4 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=28.68  E-value=14  Score=22.03  Aligned_cols=22  Identities=23%  Similarity=0.241  Sum_probs=19.0

Q ss_pred             HHHHHHhCCCCCcccccccCCc
Q psy8538          18 AELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++|+.+|++.+.|..|.+..-
T Consensus         4 ~e~a~~~gvs~~TLR~Ye~~GL   25 (134)
T cd04779           4 GQLAHLAGVSKRTIDYYTNLGL   25 (134)
T ss_pred             HHHHHHHCcCHHHHHHHHHCCC
Confidence            4789999999999999987653


No 112
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators. Helix-turn-helix (HTH) BmrR-like transcription regulators (TipAL, Mta, SkgA, BmrR, and BltR), N-terminal domain. These proteins have been shown to regulate expression of specific regulons in response to various toxic substances, antibiotics, or oxygen radicals in Bacillus subtilis, Streptomyces, and Caulobacter crescentus. They are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain  HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=28.44  E-value=18  Score=20.04  Aligned_cols=21  Identities=29%  Similarity=0.243  Sum_probs=18.3

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...+..|-+..
T Consensus         4 ~eva~~~gvs~~tLRyye~~G   24 (96)
T cd04768           4 GEFAKLAGVSIRTLRHYDDIG   24 (96)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999998764


No 113
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=28.01  E-value=18  Score=21.97  Aligned_cols=29  Identities=14%  Similarity=0.081  Sum_probs=23.7

Q ss_pred             HHHHHHHHhCCCCCcccccccCCcccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLTTVNNN   44 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR~~~k~   44 (64)
                      ...+++..+|+++.+|..|....|-.-..
T Consensus        48 ti~eV~e~tgVs~~~I~~~IreGRL~~~~   76 (137)
T TIGR03826        48 TVSEIVEETGVSEKLILKFIREGRLQLKH   76 (137)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHcCCeeccC
Confidence            35688999999999999999988854443


No 114
>PRK07539 NADH dehydrogenase subunit E; Validated
Probab=27.83  E-value=34  Score=20.64  Aligned_cols=25  Identities=16%  Similarity=0.254  Sum_probs=21.3

Q ss_pred             cCCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           8 YSRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         8 ~~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      .-.|++......+|..+|++..+|.
T Consensus        34 ~~g~ip~~~~~~iA~~l~v~~~~v~   58 (154)
T PRK07539         34 QRGWVPDEAIEAVADYLGMPAIDVE   58 (154)
T ss_pred             HhCCCCHHHHHHHHHHhCcCHHHHH
Confidence            3468999999999999999988765


No 115
>PF13560 HTH_31:  Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A.
Probab=27.65  E-value=19  Score=18.10  Aligned_cols=24  Identities=29%  Similarity=0.365  Sum_probs=20.4

Q ss_pred             HHHHHHHhCCCCCcccccccCCcc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      ..++|..+|++...|..|-..++.
T Consensus        17 ~~~lA~~~g~s~s~v~~iE~G~~~   40 (64)
T PF13560_consen   17 QAQLADRLGVSQSTVSRIERGRRP   40 (64)
T ss_dssp             HHHHHHHHTS-HHHHHHHHTTSSS
T ss_pred             HHHHHHHHCcCHHHHHHHHCCCCC
Confidence            457899999999999999998885


No 116
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE. Putative helix-turn-helix (HTH) regulatory protein, TioE, and related proteins. TioE is part of the thiocoraline gene cluster, which is involved in the biosynthesis of the antitumor thiocoraline from the marine actinomycete, Micromonospora. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Proteins in this family are unique within the MerR superfamily in that they are composed of just two adjacent MerR-like N-terminal domains; this CD mainly contains the C-terminal or second repeat (rpt2) of these tandem MerR-like domain proteins.
Probab=27.61  E-value=23  Score=20.09  Aligned_cols=21  Identities=29%  Similarity=0.322  Sum_probs=18.2

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|-+..
T Consensus         4 ~eva~~~gvs~~tlR~ye~~G   24 (108)
T cd04773           4 GELAHLLGVPPSTLRHWEKEG   24 (108)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999997764


No 117
>PF08452 DNAP_B_exo_N:  DNA polymerase family B exonuclease domain, N-terminal;  InterPro: IPR013660 This domain is found in viral DNA polymerases to the N terminus of DNA polymerase family B exonuclease domains (IPR006133 from INTERPRO). ; GO: 0003887 DNA-directed DNA polymerase activity
Probab=27.17  E-value=23  Score=14.95  Aligned_cols=7  Identities=0%  Similarity=-0.453  Sum_probs=5.9

Q ss_pred             ccccCCc
Q psy8538          33 CPHHQLT   39 (64)
Q Consensus        33 vWFqNrR   39 (64)
                      .||.++.
T Consensus         7 NWFE~~g   13 (22)
T PF08452_consen    7 NWFESRG   13 (22)
T ss_pred             ehhhhCC
Confidence            6999986


No 118
>cd04780 HTH_MerR-like_sg5 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 5), N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=27.02  E-value=18  Score=20.14  Aligned_cols=20  Identities=20%  Similarity=0.318  Sum_probs=16.4

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|++...|..|=..
T Consensus         4 ~eva~~~gvs~~tlR~Ye~~   23 (95)
T cd04780           4 SELSKRSGVSVATIKYYLRE   23 (95)
T ss_pred             HHHHHHHCcCHHHHHHHHHC
Confidence            47899999999999888554


No 119
>PRK11511 DNA-binding transcriptional activator MarA; Provisional
Probab=26.88  E-value=16  Score=21.10  Aligned_cols=23  Identities=9%  Similarity=0.117  Sum_probs=19.6

Q ss_pred             HHHHHHHHhCCCCCcccccccCC
Q psy8538          16 RKAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ...+||..+|++++.+..+|+.-
T Consensus        27 sl~~lA~~~g~S~~~l~r~Fk~~   49 (127)
T PRK11511         27 SLEKVSERSGYSKWHLQRMFKKE   49 (127)
T ss_pred             CHHHHHHHHCcCHHHHHHHHHHH
Confidence            45689999999999999998864


No 120
>PRK09726 antitoxin HipB; Provisional
Probab=26.82  E-value=27  Score=18.88  Aligned_cols=23  Identities=17%  Similarity=0.352  Sum_probs=19.7

Q ss_pred             HHHHHHHhCCCCCcccccccCCc
Q psy8538          17 KAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..+||..+|++...|..|..+.+
T Consensus        28 q~elA~~~gvs~~tis~~e~g~~   50 (88)
T PRK09726         28 QSELAKKIGIKQATISNFENNPD   50 (88)
T ss_pred             HHHHHHHHCcCHHHHHHHHCCCC
Confidence            45789999999999999988754


No 121
>cd01109 HTH_YyaN Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=26.67  E-value=20  Score=20.30  Aligned_cols=20  Identities=30%  Similarity=0.421  Sum_probs=16.8

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|++.+.|..|-+.
T Consensus         4 ~e~a~~~gvs~~tlr~ye~~   23 (113)
T cd01109           4 KEVAEKTGLSADTLRYYEKE   23 (113)
T ss_pred             HHHHHHHCcCHHHHHHHHHC
Confidence            47899999999999988554


No 122
>cd01111 HTH_MerD Helix-Turn-Helix DNA binding domain of the MerD transcription regulator. Helix-turn-helix (HTH) transcription regulator MerD. The putative secondary regulator of mercury resistance (mer) operons, MerD, has been shown to down-regulate the expression of this operon in gram-negative bacteria. It binds to the same operator DNA as MerR that activates transcription of the operon in the presence of mercury ions. The MerD protein shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily, which promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are conserved and contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules such as metal ions, drugs, 
Probab=26.12  E-value=19  Score=20.46  Aligned_cols=21  Identities=29%  Similarity=0.129  Sum_probs=17.7

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|+.|-...
T Consensus         4 ge~A~~~gvs~~tlR~ye~~G   24 (107)
T cd01111           4 SQLALDAGVSVHIVRDYLLRG   24 (107)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999996653


No 123
>cd04782 HTH_BltR Helix-Turn-Helix DNA binding domain of the BltR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BltR (BmrR-like transporter) of Bacillus subtilis, and related proteins; N-terminal domain. Blt, like Bmr, is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. These regulators are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the C-terminal domains are often unrelated and bind specific coactivator molecules. They share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=25.99  E-value=19  Score=19.92  Aligned_cols=21  Identities=19%  Similarity=0.143  Sum_probs=17.7

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...+..|-+..
T Consensus         4 ~eva~~~gvs~~tlR~ye~~G   24 (97)
T cd04782           4 GEFAKLCGISKQTLFHYDKIG   24 (97)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            478999999999999996654


No 124
>cd01107 HTH_BmrR Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif  that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.
Probab=25.72  E-value=22  Score=20.08  Aligned_cols=21  Identities=24%  Similarity=0.146  Sum_probs=17.8

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|-...
T Consensus         4 ~eva~~~gis~~tlR~ye~~G   24 (108)
T cd01107           4 GEFAKLSNLSIKALRYYDKIG   24 (108)
T ss_pred             HHHHHHHCcCHHHHHHHHHcC
Confidence            478999999999999997663


No 125
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=25.64  E-value=27  Score=19.12  Aligned_cols=21  Identities=33%  Similarity=0.433  Sum_probs=15.9

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      =..||+.||+++.+|..--.+
T Consensus        16 Wk~laR~LGlse~~Id~i~~~   36 (86)
T cd08306          16 WRKLARKLGLSETKIESIEEA   36 (86)
T ss_pred             HHHHHHHcCCCHHHHHHHHHH
Confidence            357899999999998754433


No 126
>cd01803 Ubiquitin Ubiquitin. Ubiquitin  (includes Ubq/RPL40e and Ubq/RPS27a fusions as well as homopolymeric multiubiquitin protein chains)
Probab=24.61  E-value=50  Score=16.73  Aligned_cols=26  Identities=19%  Similarity=0.147  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHhCCCCCcccccccCCc
Q psy8538          14 IRRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        14 ~~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      ..-+..++..++++...++.||.++-
T Consensus        24 ~~lK~~i~~~~g~~~~~q~L~~~g~~   49 (76)
T cd01803          24 ENVKAKIQDKEGIPPDQQRLIFAGKQ   49 (76)
T ss_pred             HHHHHHHHHHhCCCHHHeEEEECCEE
Confidence            34556789999999999999986553


No 127
>COG0789 SoxR Predicted transcriptional regulators [Transcription]
Probab=24.48  E-value=23  Score=19.96  Aligned_cols=18  Identities=33%  Similarity=0.410  Sum_probs=14.7

Q ss_pred             HHHHHHhCCCCCcccccc
Q psy8538          18 AELANSLGLSERQVRCPH   35 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWF   35 (64)
                      .++|+.+|++.+.++-|=
T Consensus         4 ~eva~~~gvs~~tLRyYE   21 (124)
T COG0789           4 GEVAKLTGVSVRTLRFYE   21 (124)
T ss_pred             HHHHHHhCCCHHHHHHHH
Confidence            468889999999888873


No 128
>TIGR02054 MerD mercuric resistence transcriptional repressor protein MerD. This model represents a transcriptional repressor protein of the MerR family (pfam00376) whose expression is regulated by the mercury-sensitive transcriptional activator, MerR. MerD has been shown to repress the transcription of the mer operon.
Probab=24.47  E-value=26  Score=20.52  Aligned_cols=21  Identities=29%  Similarity=0.213  Sum_probs=17.9

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|+.+|++...|+.|-+.
T Consensus         6 I~elA~~~gvs~~tlR~Ye~~   26 (120)
T TIGR02054         6 ISRLAEDAGVSVHVVRDYLLR   26 (120)
T ss_pred             HHHHHHHHCcCHHHHHHHHHC
Confidence            567999999999999998654


No 129
>PF04545 Sigma70_r4:  Sigma-70, region 4;  InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors is involved in binding to the -35 promoter element via a helix-turn-helix motif []. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_B 3IYD_F 1TLH_B 1KU7_A 1RIO_H 3N97_A 1KU3_A 1RP3_C 1SC5_A 1NR3_A ....
Probab=24.18  E-value=21  Score=17.07  Aligned_cols=18  Identities=39%  Similarity=0.492  Sum_probs=14.3

Q ss_pred             HHHHHHHhCCCCCccccc
Q psy8538          17 KAELANSLGLSERQVRCP   34 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vW   34 (64)
                      -.++|..+|+|...|..+
T Consensus        23 ~~eIa~~lg~s~~~V~~~   40 (50)
T PF04545_consen   23 LEEIAERLGISRSTVRRI   40 (50)
T ss_dssp             HHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHCCcHHHHHHH
Confidence            457899999999877654


No 130
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of  Np95 and NIRF. NIRF_N    This CD represents the amino-terminal ubiquitin-like domain of a family of nuclear proteins that includes Np95 and NIRF (Np95/ICBP90-like RING finger) protein.  Both Np95 and NIRF have a domain architecture consisting of a ubiquitin-like domain, a PHD finger, a YDG/SRA domain, Rb-binding motifs and a RING finger domain. Both Np95 and NIRF are ubiquitin ligases that ubiquitinate PCNP (PEST-containing nuclear proteins). While Np95 is capable of binding histones, NIRF is involved in cell cycle regulation.
Probab=23.97  E-value=55  Score=17.43  Aligned_cols=29  Identities=3%  Similarity=-0.012  Sum_probs=23.2

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCccccc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      .-+..++...|++..+.+.+|.++--.+-
T Consensus        27 ~lK~~i~~~~gi~~~~QrLi~~Gk~L~D~   55 (78)
T cd01797          27 ELREKIQELFNVEPECQRLFYRGKQMEDG   55 (78)
T ss_pred             HHHHHHHHHhCCCHHHeEEEeCCEECCCC
Confidence            44567889999999999999988765554


No 131
>PRK07571 bidirectional hydrogenase complex protein HoxE; Reviewed
Probab=23.74  E-value=47  Score=20.69  Aligned_cols=25  Identities=20%  Similarity=0.107  Sum_probs=21.3

Q ss_pred             cCCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           8 YSRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         8 ~~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      ...|++......+|..+|++..+|.
T Consensus        48 ~~GyIp~e~~~~iA~~l~v~~a~V~   72 (169)
T PRK07571         48 LFGYLERDLLLYVARQLKLPLSRVY   72 (169)
T ss_pred             HcCCCCHHHHHHHHHHhCcCHHHHH
Confidence            3468999999999999999988765


No 132
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators. Putative helix-turn-helix (HTH) MlrA-like transcription regulators (subgroup 2), N-terminal domain. The MlrA protein, also known as YehV, has been shown to control cell-cell aggregation by co-regulating the expression of curli and extracellular matrix production in Escherichia coli and Salmonella typhimurium. These proteins belong to the MerR superfamily of transcription regulators that promote expression of several stress regulon genes by reconfiguring the spacer between the -35 and -10 promoter elements. Their conserved N-terminal domains contain predicted HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=23.72  E-value=25  Score=19.75  Aligned_cols=20  Identities=30%  Similarity=0.398  Sum_probs=16.9

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|+.+|+++..+..|-++
T Consensus         4 ~EvA~~~gVs~~tLR~ye~~   23 (99)
T cd04765           4 GEVAEILGLPPHVLRYWETE   23 (99)
T ss_pred             HHHHHHHCcCHHHHHHHHHH
Confidence            47899999999999999654


No 133
>PF01257 2Fe-2S_thioredx:  Thioredoxin-like [2Fe-2S] ferredoxin;  InterPro: IPR002023  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 24 kDa (in mammals), which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 2Fe-2S iron-sulphur cluster. The 24 kDa subunit is nuclear encoded, as a precursor form with a transit peptide in mammals and in Neurospora crassa. There is a highly conserved region located in the central section of this subunit that contains two conserved cysteines, that are probably involved in the binding of the 2Fe-2S centre. The 24 kDa subunit is highly similar to [, ]:  Subunit E of Escherichia coli NADH-ubiquinone oxidoreductase (gene nuoE) Subunit NQO2 of Paracoccus denitrificans NADH-ubiquinone oxidoreductase  ; GO: 0016491 oxidoreductase activity, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 1M2D_A 1M2A_B 1F37_B 1M2B_B 2FUG_B 3M9S_B 3IAM_B 3IAS_K 2YBB_2 3I9V_B ....
Probab=23.72  E-value=24  Score=21.07  Aligned_cols=25  Identities=28%  Similarity=0.376  Sum_probs=18.5

Q ss_pred             cCCCCCHHHHHHHHHHhCCCCCccc
Q psy8538           8 YSRYITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus         8 ~~~~p~~~~r~~La~~l~l~~~qV~   32 (64)
                      .-.|++......+|..+|+++.+|.
T Consensus        25 ~~g~i~~~~~~~iA~~l~i~~~~v~   49 (145)
T PF01257_consen   25 EYGYIPEEALEEIAEALGIPPAEVY   49 (145)
T ss_dssp             HHSS--HHHHHHHHHHHTS-HHHHH
T ss_pred             HcCCCCHHHHHHHHHHHCCCHHHHH
Confidence            3458899999999999999998875


No 134
>PF13730 HTH_36:  Helix-turn-helix domain
Probab=23.30  E-value=13  Score=18.03  Aligned_cols=20  Identities=35%  Similarity=0.491  Sum_probs=15.3

Q ss_pred             HHHHHHHHhCCCCCcccccc
Q psy8538          16 RKAELANSLGLSERQVRCPH   35 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWF   35 (64)
                      -...||..+|++.+.|+.+.
T Consensus        27 S~~~la~~~g~s~~Tv~~~i   46 (55)
T PF13730_consen   27 SQETLAKDLGVSRRTVQRAI   46 (55)
T ss_pred             CHHHHHHHHCcCHHHHHHHH
Confidence            35678999999988776554


No 135
>cd04767 HTH_HspR-like_MBC Helix-Turn-Helix DNA binding domain of putative HspR-like transcription regulators. Putative helix-turn-helix (HTH) transcription regulator HspR-like proteins. Unlike the characterized HspR, these proteins have a C-terminal domain with putative metal binding cysteines (MBC). Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind spe
Probab=23.28  E-value=23  Score=20.89  Aligned_cols=22  Identities=14%  Similarity=0.072  Sum_probs=18.4

Q ss_pred             HHHHHHHhCCCCCcccccccCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ..++|..+|++...+..|-+..
T Consensus         4 I~eVA~~~GVs~~TLR~wE~~G   25 (120)
T cd04767           4 IGVVAELLNIHPETLRIWERHG   25 (120)
T ss_pred             HHHHHHHHCcCHHHHHHHHHCC
Confidence            3578999999999999997653


No 136
>PRK06759 RNA polymerase factor sigma-70; Validated
Probab=23.24  E-value=26  Score=20.15  Aligned_cols=21  Identities=29%  Similarity=0.178  Sum_probs=17.1

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|..+|++...|..+...
T Consensus       125 ~~EIA~~l~is~~tV~~~~~r  145 (154)
T PRK06759        125 MGEIALETEMTYYQVRWIYRQ  145 (154)
T ss_pred             HHHHHHHHCCCHHHHHHHHHH
Confidence            567899999999999887543


No 137
>PF09292 Neil1-DNA_bind:  Endonuclease VIII-like 1, DNA bind;  InterPro: IPR015371 This domain is predominantly found in Endonuclease VIII-like 1 proteins and adopts a glucocorticoid receptor-like fold. Structural analysis reveals a zincless finger motif that is required for glycosylase activity []. ; PDB: 1TDH_A.
Probab=23.21  E-value=29  Score=16.68  Aligned_cols=6  Identities=0%  Similarity=-0.341  Sum_probs=4.7

Q ss_pred             cccccC
Q psy8538          32 RCPHHQ   37 (64)
Q Consensus        32 ~vWFqN   37 (64)
                      .||||.
T Consensus        27 TiWFqG   32 (39)
T PF09292_consen   27 TIWFQG   32 (39)
T ss_dssp             EEEESS
T ss_pred             EEEeeC
Confidence            589985


No 138
>PRK12537 RNA polymerase sigma factor; Provisional
Probab=22.94  E-value=38  Score=20.31  Aligned_cols=20  Identities=30%  Similarity=0.307  Sum_probs=16.2

Q ss_pred             HHHHHHHhCCCCCccccccc
Q psy8538          17 KAELANSLGLSERQVRCPHH   36 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFq   36 (64)
                      -.++|..+|+|...|+++..
T Consensus       152 ~~eIA~~lgis~~tV~~~l~  171 (182)
T PRK12537        152 HAEIAQRLGAPLGTVKAWIK  171 (182)
T ss_pred             HHHHHHHHCCChhhHHHHHH
Confidence            45789999999999987643


No 139
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein. DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization.  DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis.
Probab=22.85  E-value=61  Score=16.88  Aligned_cols=28  Identities=14%  Similarity=0.042  Sum_probs=21.7

Q ss_pred             HHHHHHHHhCCCCCcccccccCCccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      -+..++...|++..+.+.||..+--.+-
T Consensus        24 lK~~I~~~~gi~~~~q~Li~~G~~L~D~   51 (70)
T cd01794          24 LKKQLQAAEGVDPCCQRWFFSGKLLTDK   51 (70)
T ss_pred             HHHHHHHHhCCCHHHeEEEECCeECCCC
Confidence            4456888899999999999987765443


No 140
>PF05848 CtsR:  Firmicute transcriptional repressor of class III stress genes (CtsR);  InterPro: IPR008463 This family consists of several Firmicute transcriptional repressor of class III stress gene (CtsR) proteins. CtsR of Listeria monocytogenes negatively regulates the clpC, clpP and clpE genes belonging to the CtsR regulon [].; PDB: 3H0D_A.
Probab=22.73  E-value=42  Score=20.75  Aligned_cols=18  Identities=22%  Similarity=0.361  Sum_probs=14.1

Q ss_pred             HHHHHHHHhCCCCCcccc
Q psy8538          16 RKAELANSLGLSERQVRC   33 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~v   33 (64)
                      +|.+||.++++-|.||..
T Consensus        27 qR~eLA~~F~CvPSQINY   44 (152)
T PF05848_consen   27 QRNELAERFNCVPSQINY   44 (152)
T ss_dssp             -HHHHHHHTTS-THHHHH
T ss_pred             eHHHHHHHhCCchhhhhe
Confidence            578999999999999864


No 141
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=22.72  E-value=32  Score=18.81  Aligned_cols=16  Identities=25%  Similarity=0.549  Sum_probs=13.3

Q ss_pred             HHHHHHhCCCCCcccc
Q psy8538          18 AELANSLGLSERQVRC   33 (64)
Q Consensus        18 ~~La~~l~l~~~qV~v   33 (64)
                      ..||..||+++..|..
T Consensus        22 k~Lar~LGls~~dI~~   37 (86)
T cd08318          22 KTLAPHLEMKDKEIRA   37 (86)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            4689999999988764


No 142
>PRK11924 RNA polymerase sigma factor; Provisional
Probab=22.62  E-value=26  Score=20.40  Aligned_cols=21  Identities=24%  Similarity=0.328  Sum_probs=17.1

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      -.++|..+|++...|..|...
T Consensus       144 ~~eIA~~lgis~~tv~~~~~r  164 (179)
T PRK11924        144 YREIAEILGVPVGTVKSRLRR  164 (179)
T ss_pred             HHHHHHHHCCCHHHHHHHHHH
Confidence            457899999999999887543


No 143
>PF12200 DUF3597:  Domain of unknown function (DUF3597);  InterPro: IPR022016  This family of proteins is found in bacteria, eukaryotes and viruses. Proteins in this family are typically between 126 and 281 amino acids in length. The function of this domain is unknown. The structure of this domain has been found to contain five helices with a long flexible loop between helices one and two. ; PDB: 2GQB_A.
Probab=22.62  E-value=83  Score=18.98  Aligned_cols=17  Identities=29%  Similarity=0.509  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHhCCCC
Q psy8538          12 ITIRRKAELANSLGLSE   28 (64)
Q Consensus        12 p~~~~r~~La~~l~l~~   28 (64)
                      .+...|.+||.++|++.
T Consensus        83 SSl~aRkeLA~eL~~~~   99 (127)
T PF12200_consen   83 SSLAARKELAKELGYTG   99 (127)
T ss_dssp             -SHHHHHHHHHHHT---
T ss_pred             CCHHHHHHHHHHhCCCC
Confidence            56788999999999887


No 144
>cd01807 GDX_N ubiquitin-like domain of GDX. GDX contains an N-terminal ubiquitin-like domain as well as an uncharacterized c-terminal domain.  The function of GDX is unknown.
Probab=22.41  E-value=59  Score=16.76  Aligned_cols=28  Identities=18%  Similarity=0.184  Sum_probs=22.1

Q ss_pred             HHHHHHHHhCCCCCcccccccCCccccc
Q psy8538          16 RKAELANSLGLSERQVRCPHHQLTTVNN   43 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWFqNrR~~~k   43 (64)
                      -+..++...|++..+.+.+|..+.-.+-
T Consensus        26 lK~~i~~~~gi~~~~q~L~~~G~~L~d~   53 (74)
T cd01807          26 LKKLVSEHLNVPEEQQRLLFKGKALADD   53 (74)
T ss_pred             HHHHHHHHHCCCHHHeEEEECCEECCCC
Confidence            4567899999999999998887765443


No 145
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 3). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.
Probab=22.22  E-value=26  Score=19.92  Aligned_cols=21  Identities=38%  Similarity=0.387  Sum_probs=17.5

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|+|...|..|-+..
T Consensus         4 ~eva~~~gvs~~tlR~Ye~~G   24 (112)
T cd01282           4 GELAARTGVSVRSLRYYEEQG   24 (112)
T ss_pred             HHHHHHHCCCHHHHHHHHHCC
Confidence            478999999999999986653


No 146
>PRK13182 racA polar chromosome segregation protein; Reviewed
Probab=21.66  E-value=32  Score=21.58  Aligned_cols=21  Identities=33%  Similarity=0.339  Sum_probs=17.9

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|....
T Consensus         4 ~evA~~lGVS~~TLRrw~k~g   24 (175)
T PRK13182          4 PFVAKKLGVSPKTVQRWVKQL   24 (175)
T ss_pred             HHHHHHHCcCHHHHHHHHHcC
Confidence            468999999999999997653


No 147
>PF07022 Phage_CI_repr:  Bacteriophage CI repressor helix-turn-helix domain;  InterPro: IPR010744 This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic [].; GO: 0003677 DNA binding, 0045892 negative regulation of transcription, DNA-dependent; PDB: 2FJR_B.
Probab=21.64  E-value=9.8  Score=19.70  Aligned_cols=21  Identities=29%  Similarity=0.396  Sum_probs=15.6

Q ss_pred             HHHHHHHhCCCCCccc-ccccC
Q psy8538          17 KAELANSLGLSERQVR-CPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~-vWFqN   37 (64)
                      ..+||..+|++...|. .|...
T Consensus        15 ~~~lA~~lgis~st~s~~~~~r   36 (66)
T PF07022_consen   15 DKELAERLGISKSTLSNNWKKR   36 (66)
T ss_dssp             CHHHHCCTT--HHHHH-HHHHS
T ss_pred             HHHHHHHhCcCHHHhhHHHHhC
Confidence            3578999999999999 88753


No 148
>TIGR02051 MerR Hg(II)-responsive transcriptional regulator. This model represents the mercury (II) responsive transcriptional activator of the mer organomercurial resistance operon. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(8)-Cys-Pro, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix.
Probab=21.57  E-value=26  Score=20.27  Aligned_cols=17  Identities=29%  Similarity=0.456  Sum_probs=14.8

Q ss_pred             HHHHHHhCCCCCccccc
Q psy8538          18 AELANSLGLSERQVRCP   34 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vW   34 (64)
                      .++|+.+|++...|..|
T Consensus         3 ~e~a~~~gvs~~tlR~Y   19 (124)
T TIGR02051         3 GELAKAAGVNVETIRYY   19 (124)
T ss_pred             HHHHHHHCcCHHHHHHH
Confidence            46899999999999888


No 149
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=21.46  E-value=65  Score=16.11  Aligned_cols=25  Identities=20%  Similarity=0.130  Sum_probs=20.0

Q ss_pred             HHHHHHHHHhCCCCCcccccccCCc
Q psy8538          15 RRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .-+..++..+|++....+.+|..+.
T Consensus        24 ~lK~~i~~~~gi~~~~q~L~~~g~~   48 (71)
T cd01812          24 DLKKMLAPVTGVEPRDQKLIFKGKE   48 (71)
T ss_pred             HHHHHHHHhhCCChHHeEEeeCCcc
Confidence            3456788999999999999987554


No 150
>smart00351 PAX Paired Box domain.
Probab=21.24  E-value=24  Score=20.52  Aligned_cols=21  Identities=14%  Similarity=0.098  Sum_probs=17.8

Q ss_pred             HHHHHHHhCCCCCcccccccC
Q psy8538          17 KAELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqN   37 (64)
                      ..++|+.+|++...|..|.+.
T Consensus        36 ~~~iA~~~gvs~~tV~kwi~r   56 (125)
T smart00351       36 PCDISRQLCVSHGCVSKILGR   56 (125)
T ss_pred             HHHHHHHHCcCHHHHHHHHHH
Confidence            347899999999999999764


No 151
>PF07037 DUF1323:  Putative transcription regulator (DUF1323);  InterPro: IPR010749 This family consists of several hypothetical Enterobacterial proteins of around 120 residues in length. The function of this family is unknown.
Probab=21.11  E-value=28  Score=20.83  Aligned_cols=20  Identities=25%  Similarity=0.243  Sum_probs=17.2

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      ++||..+|++...|.-|..-
T Consensus         4 eELA~~tG~srQTINrWvRk   23 (122)
T PF07037_consen    4 EELAELTGYSRQTINRWVRK   23 (122)
T ss_pred             HHHHHHhCccHHHHHHHHHh
Confidence            58999999999999999743


No 152
>PF06505 XylR_N:  Activator of aromatic catabolism;  InterPro: IPR010523 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators in several proteobacteria, including activators of phenol degradation such as XylR. It is found adjacent to IPR004096 from INTERPRO.
Probab=21.10  E-value=37  Score=19.48  Aligned_cols=21  Identities=19%  Similarity=0.025  Sum_probs=17.4

Q ss_pred             HHHHhCCCCCcccccccCCcc
Q psy8538          20 LANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        20 La~~l~l~~~qV~vWFqNrR~   40 (64)
                      |...+..++.+=.|||.+.|.
T Consensus         2 L~~~L~F~p~~G~Iwl~~~Rm   22 (103)
T PF06505_consen    2 LRELLRFSPEDGRIWLNGQRM   22 (103)
T ss_pred             hHHheeEeCCCCeEEECCEEE
Confidence            566778888899999999884


No 153
>KOG3755|consensus
Probab=21.05  E-value=13  Score=28.05  Aligned_cols=19  Identities=5%  Similarity=-0.029  Sum_probs=16.6

Q ss_pred             CCCcccccccCCcccccch
Q psy8538          27 SERQVRCPHHQLTTVNNNT   45 (64)
Q Consensus        27 ~~~qV~vWFqNrR~~~k~~   45 (64)
                      ..+.|+.||.|||..+++.
T Consensus       739 ~~kn~~~~fk~~~ee~~~~  757 (769)
T KOG3755|consen  739 ESKNVQFWFKVRREEEKRL  757 (769)
T ss_pred             hhcchHHHHHHHHHHHhhh
Confidence            5678999999999988876


No 154
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=20.95  E-value=47  Score=20.88  Aligned_cols=20  Identities=35%  Similarity=0.491  Sum_probs=15.8

Q ss_pred             HHHHHHhCCCCCcccccccC
Q psy8538          18 AELANSLGLSERQVRCPHHQ   37 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqN   37 (64)
                      .++|.+|+++++.|+.--.|
T Consensus       167 keIA~~L~iS~~TVk~h~~~  186 (211)
T COG2197         167 KEIAEELNLSEKTVKTHVSN  186 (211)
T ss_pred             HHHHHHHCCCHhHHHHHHHH
Confidence            35789999999999875544


No 155
>PF09581 Spore_III_AF:  Stage III sporulation protein AF (Spore_III_AF);  InterPro: IPR014245 This family represents the stage III sporulation protein AF (SpoIIIAF) of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of these proteins is poorly conserved. 
Probab=20.92  E-value=49  Score=20.16  Aligned_cols=19  Identities=32%  Similarity=0.363  Sum_probs=16.0

Q ss_pred             HHHHHHHHhCCCCCccccc
Q psy8538          16 RKAELANSLGLSERQVRCP   34 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vW   34 (64)
                      -+..||..+|+++.+|.|+
T Consensus       169 i~~~la~~~~i~~~~I~V~  187 (188)
T PF09581_consen  169 IKQYLADFYGISPEQIKVY  187 (188)
T ss_pred             HHHHHHHHhCCCHHHeEEe
Confidence            4557999999999999886


No 156
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator HspR and related proteins, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=20.89  E-value=28  Score=19.40  Aligned_cols=22  Identities=18%  Similarity=0.149  Sum_probs=18.2

Q ss_pred             HHHHHHHhCCCCCcccccccCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ..++|+.+|++...+..|-+..
T Consensus         4 i~eva~~~gVs~~tLR~ye~~G   25 (98)
T cd01279           4 ISVAAELLGIHPQTLRVYDRLG   25 (98)
T ss_pred             HHHHHHHHCcCHHHHHHHHHCC
Confidence            3478999999999999996654


No 157
>TIGR03629 arch_S13P archaeal ribosomal protein S13P. This model describes exclusively the archaeal ribosomal protein S13P. It excludes the homologous eukaryotic 40S ribosomal protein S18 and bacterial 30S ribosomal protein S13.
Probab=20.63  E-value=79  Score=19.23  Aligned_cols=29  Identities=10%  Similarity=0.019  Sum_probs=19.8

Q ss_pred             CCCHHHHHHHHHHhCCCCCcccccccCCc
Q psy8538          11 YITIRRKAELANSLGLSERQVRCPHHQLT   39 (64)
Q Consensus        11 ~p~~~~r~~La~~l~l~~~qV~vWFqNrR   39 (64)
                      .++..+...|...+.=..-.|..||=||+
T Consensus        51 ~Lt~~qi~~l~~~i~~~~~~iP~w~~Nr~   79 (144)
T TIGR03629        51 YLDDEEIEKLEEAVENYEYGIPSWLLNRR   79 (144)
T ss_pred             cCCHHHHHHHHHHHHhccccCCHHHhhcc
Confidence            36666677777666434455888999976


No 158
>cd01108 HTH_CueR Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements
Probab=20.63  E-value=31  Score=20.04  Aligned_cols=21  Identities=29%  Similarity=0.254  Sum_probs=17.1

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|-+..
T Consensus         4 ~e~a~~~gvs~~tlRyYe~~G   24 (127)
T cd01108           4 GEAAKLTGLSAKMIRYYEEIG   24 (127)
T ss_pred             HHHHHHHCcCHHHHHHHHHCC
Confidence            468999999999999886553


No 159
>cd04776 HTH_GnyR Helix-Turn-Helix DNA binding domain of the regulatory protein GnyR. Putative helix-turn-helix (HTH) regulatory protein, GnyR, and other related proteins. GnyR belongs to the gnyRDBHAL cluster, which is involved in acyclic isoprenoid degradation in Pseudomonas aeruginosa. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=20.60  E-value=29  Score=20.03  Aligned_cols=18  Identities=28%  Similarity=0.449  Sum_probs=14.8

Q ss_pred             HHHHHHhCCCCCcccccc
Q psy8538          18 AELANSLGLSERQVRCPH   35 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWF   35 (64)
                      .++|+.+|+|...|..|=
T Consensus         4 geva~~~gvs~~tlRyYe   21 (118)
T cd04776           4 SELAREFDVTPRTLRFYE   21 (118)
T ss_pred             HHHHHHHCcCHHHHHHHH
Confidence            468899999999888873


No 160
>cd08316 Death_FAS_TNFRSF6 Death domain of FAS or TNF receptor superfamily member 6. Death Domain (DD) found in the FS7-associated cell surface antigen (FAS). FAS, also known as TNFRSF6 (TNF receptor superfamily member 6), APT1, CD95, FAS1, or APO-1, together with FADD (Fas-associating via Death Domain) and caspase 8, is an integral part of the death inducing signalling complex (DISC), which plays an important role in the induction of apoptosis and is activated by binding of the ligand FasL to FAS. FAS also plays a critical role in self-tolerance by eliminating cell types (autoreactive T and B cells) that contribute to autoimmunity. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in sign
Probab=20.40  E-value=82  Score=17.82  Aligned_cols=21  Identities=24%  Similarity=0.469  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHhCCCCCccc
Q psy8538          12 ITIRRKAELANSLGLSERQVR   32 (64)
Q Consensus        12 p~~~~r~~La~~l~l~~~qV~   32 (64)
                      .+...-.++|+++||++..|.
T Consensus        18 ~~~~~wK~faR~lglse~~Id   38 (97)
T cd08316          18 MTLKDVKKFVRKSGLSEPKID   38 (97)
T ss_pred             cCHHHHHHHHHHcCCCHHHHH
Confidence            344555678999999988775


No 161
>PRK09514 zntR zinc-responsive transcriptional regulator; Provisional
Probab=20.35  E-value=29  Score=20.61  Aligned_cols=22  Identities=23%  Similarity=0.146  Sum_probs=18.2

Q ss_pred             HHHHHHHhCCCCCcccccccCC
Q psy8538          17 KAELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        17 r~~La~~l~l~~~qV~vWFqNr   38 (64)
                      ..++|+.+|++...|..|-...
T Consensus         4 I~e~a~~~gvs~~tlR~Ye~~G   25 (140)
T PRK09514          4 IGELAKLAEVTPDTLRFYEKQG   25 (140)
T ss_pred             HHHHHHHHCcCHHHHHHHHHCC
Confidence            4578999999999999997653


No 162
>cd01806 Nedd8 Nebb8-like  ubiquitin protein. Nedd8 (also known as Rub1) has a single conserved ubiquitin-like domain that is part of a protein modification pathway similar to that of ubiquitin.  Nedd8 modifies a family of molecular scaffold proteins called cullins that are responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis.
Probab=20.33  E-value=95  Score=15.62  Aligned_cols=27  Identities=19%  Similarity=0.122  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHhCCCCCcccccccCCcc
Q psy8538          14 IRRKAELANSLGLSERQVRCPHHQLTT   40 (64)
Q Consensus        14 ~~~r~~La~~l~l~~~qV~vWFqNrR~   40 (64)
                      ..-+..++...|++....+.+|..+.-
T Consensus        24 ~~lK~~i~~~~g~~~~~qrL~~~g~~L   50 (76)
T cd01806          24 ERIKERVEEKEGIPPQQQRLIYSGKQM   50 (76)
T ss_pred             HHHHHHHhHhhCCChhhEEEEECCeEc
Confidence            344567889999999999999886643


No 163
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=20.17  E-value=58  Score=16.56  Aligned_cols=18  Identities=28%  Similarity=0.390  Sum_probs=13.3

Q ss_pred             HHHHHHHHHhCCCCCccc
Q psy8538          15 RRKAELANSLGLSERQVR   32 (64)
Q Consensus        15 ~~r~~La~~l~l~~~qV~   32 (64)
                      .+..-+|+++|+|+.+++
T Consensus        21 ~ev~ywa~~~gvt~~~L~   38 (57)
T PF12244_consen   21 YEVRYWAKRFGVTEEQLR   38 (57)
T ss_pred             HHHHHHHHHHCcCHHHHH
Confidence            455678899998887654


No 164
>TIGR03209 P21_Cbot clostridium toxin-associated regulator BotR. Similarly, tetanus toxin production of Clostridium tetani is regulated by TetR which is a very close relative of BotR. Both BotR and TetR are members of the TIGR02937 subfamily of sigma-70 RNA polymerase sigma factors. Functional complementation experiments have been done for botR and tetR in highly transformable strain of Clostridium perfringens host cells to assess functional interchangeability of sigma factors and it has been confirmed that they are interchangeable in vivo.
Probab=20.05  E-value=55  Score=18.65  Aligned_cols=15  Identities=27%  Similarity=0.430  Sum_probs=10.7

Q ss_pred             HHHHHHhCCCCCccc
Q psy8538          18 AELANSLGLSERQVR   32 (64)
Q Consensus        18 ~~La~~l~l~~~qV~   32 (64)
                      .++|..+|+|+..|+
T Consensus       127 ~EIA~~l~is~~tV~  141 (142)
T TIGR03209       127 IDIAKKLHISRQSVY  141 (142)
T ss_pred             HHHHHHHCcCHHhhc
Confidence            467888888877664


No 165
>cd04772 HTH_TioE_rpt1 First Helix-Turn-Helix DNA binding domain of the regulatory protein TioE. Putative helix-turn-helix (HTH) regulatory protein, TioE, and related proteins. TioE is part of the thiocoraline gene cluster, which is involved in the biosynthesis of the antitumor thiocoraline from the marine actinomycete, Micromonospora. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Proteins in this family are unique within the MerR superfamily in that they are composed of just two adjacent MerR-like N-terminal domains; this CD contains the N-terminal or first repeat (rpt1) of these tandem MerR-like domain proteins.
Probab=20.04  E-value=30  Score=19.26  Aligned_cols=21  Identities=33%  Similarity=0.392  Sum_probs=17.2

Q ss_pred             HHHHHHhCCCCCcccccccCC
Q psy8538          18 AELANSLGLSERQVRCPHHQL   38 (64)
Q Consensus        18 ~~La~~l~l~~~qV~vWFqNr   38 (64)
                      .++|+.+|++...|..|-+..
T Consensus         4 ~e~A~~~gvs~~tlR~Ye~~G   24 (99)
T cd04772           4 VDLARAIGLSPQTVRNYESLG   24 (99)
T ss_pred             HHHHHHHCcCHHHHHHHHHcC
Confidence            478999999999999886553


No 166
>PF02796 HTH_7:  Helix-turn-helix domain of resolvase;  InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms. Two types of site-specific recombination are known to occur:  Recombination between inverted repeats resulting in the reversal of a DNA segment. Recombination between repeat sequences on two DNA molecules resulting in their cointegration, or between repeats on one DNA molecule resulting in the excision of a DNA fragment.  Site-specific recombination is characterised by a strand exchange mechanism that requires no DNA synthesis or high energy cofactor; the phosphodiester bond energy is conserved in a phospho-protein linkage during strand cleavage and re-ligation. Two unrelated families of recombinases are currently known []. The first, called the 'phage integrase' family, groups a number of bacterial phage and yeast plasmid enzymes. The second [], called the 'resolvase' family, groups enzymes which share the following structural characteristics: an N-terminal catalytic and dimerization domain that contains a conserved serine residue involved in the transient covalent attachment to DNA IPR006119 from INTERPRO, and a C-terminal helix-turn-helix DNA-binding domain. ; GO: 0000150 recombinase activity, 0003677 DNA binding, 0006310 DNA recombination; PDB: 1ZR2_A 2GM4_B 1RES_A 1ZR4_A 1RET_A 1GDT_B 2R0Q_C 1JKP_C 1IJW_C 1JJ6_C ....
Probab=20.02  E-value=25  Score=16.72  Aligned_cols=20  Identities=30%  Similarity=0.286  Sum_probs=13.5

Q ss_pred             HHHHHHHHhCCCCCcccccc
Q psy8538          16 RKAELANSLGLSERQVRCPH   35 (64)
Q Consensus        16 ~r~~La~~l~l~~~qV~vWF   35 (64)
                      ...++|+.+|++...|..++
T Consensus        23 si~~IA~~~gvsr~TvyR~l   42 (45)
T PF02796_consen   23 SIAEIAKQFGVSRSTVYRYL   42 (45)
T ss_dssp             -HHHHHHHTTS-HHHHHHHH
T ss_pred             CHHHHHHHHCcCHHHHHHHH
Confidence            35678999999888776543


No 167
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=20.00  E-value=42  Score=18.32  Aligned_cols=16  Identities=38%  Similarity=0.557  Sum_probs=13.0

Q ss_pred             HHHHHHhCCCCCcccc
Q psy8538          18 AELANSLGLSERQVRC   33 (64)
Q Consensus        18 ~~La~~l~l~~~qV~v   33 (64)
                      .+||.++|+++..|..
T Consensus        19 k~LAr~Lg~se~dI~~   34 (84)
T cd08804          19 TELARELDFTEEQIHQ   34 (84)
T ss_pred             HHHHHHcCCCHHHHHH
Confidence            5689999999887764


Done!