Diaphorina citri psyllid: psy8555


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
GKLVAFNTLCQQYQTSIKRDPAYSDYLNKIGHIFFGIQPARPAAPAGGLFGTEYDLNLSIDIDLNGSWTVVLQYLCLQNKVTANQTFENYTTRHPNIQTRGPPYYLPLLNFIWFLLKVIETYTVTLN
cccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccc
*KLVAFNTLCQQYQTSIKRDPAYSDYLNKIGHIFFGIQPARPAAPAGGLFGTEYDLNLSIDIDLNGSWTVVLQYLCLQNKVTANQTFENYTTRHPNIQTRGPPYYLPLLNFIWFLLKVIETYTVT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GKLVAFNTLCQQYQTSIKRDPAYSDYLNKIGHIFFGIQPARPAAPAGGLFGTEYDLNLSIDIDLNGSWTVVLQYLCLQNKVTANQTFENYTTRHPNIQTRGPPYYLPLLNFIWFLLKVIETYTVTLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi to ER traffic protein 4 homolog Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.confidentQ7L5D6
Golgi to ER traffic protein 4 homolog Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region.confidentA4QNE0
Golgi to ER traffic protein 4 homolog Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region.confidentQ5ZKG8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071818 [CC]BAT3 complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0072379, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LPZ, chain A
Confidence level:very confident
Coverage over the Query: 46-125
View the alignment between query and template
View the model in PyMOL
Template: 3LPZ, chain A
Confidence level:very confident
Coverage over the Query: 2-57
View the alignment between query and template
View the model in PyMOL