Diaphorina citri psyllid: psy8562


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MKIIAFERKKKGTSFSRNLRKIGKVPGIIYGGNKDPVKISMNHNMIYHALKKETFHSSILNLEIYGKVELVLLRNFQLHAYKKLVLHADFQRVDTEKKIHVKVPLHFINSEISPAVKLNSCIISNVISDLYISCLPKNLPKFIEINLEKMEVNTSIHLSDIKLPRGVSVIHSTEEDPTIATAIIPVNTLESDNNSSIEKEKNNNS
cEEEEEEccccccHHHHHHHHcccccEEEEccccccEEEEEcHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEEccccccccEEEEEEEEccccEEEEEEEEEEECccccccCECcccEEEEEEEEEEEEECccccccEEEEEccccccccEEEEcccccccccEEccccccccEEEEEEcccccccccccccccccccccc
MKIIAFE**********NLRKIGKVPGIIYGGNKDPVKISMNHNMIYHALKKETFHSSILNLEIYGKVELVLLRNFQLHAYKKLVLHADFQRVDTEKKIHVKVPLHFINSEISPAVKLNSCIISNVISDLYISCLPKNLPKFIEINLEKMEVNTSIHLSDIKLPRGVSVIHSTEEDPTIATAIIPV*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIIAFERKKKGTSFSRNLRKIGKVPGIIYGGNKDPVKISMNHNMIYHALKKETFHSSILNLEIYGKVELVLLRNFQLHAYKKLVLHADFQRVDTEKKIHVKVPLHFINSEISPAVKLNSCIISNVISDLYISCLPKNLPKFIEINLEKMEVNTSIHLSDIKLPRGVSVIHSTEEDPTIATAIIPVNTLESDNNSSIEKEKNNNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L25 This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance.very confidentA0KAM6
50S ribosomal protein L25 This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance.very confidentA6T2S2
50S ribosomal protein L25 This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance.very confidentQ476G0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0000315 [CC]organellar large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0015934, GO:0005840, GO:0043232, GO:0043229, GO:0044464, GO:0000313, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0030529, GO:0043226, GO:0044422
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0008097 [MF]5S rRNA bindingprobableGO:0097159, GO:0019843, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FEU, chain A
Confidence level:very confident
Coverage over the Query: 1-187
View the alignment between query and template
View the model in PyMOL