BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy8569
         (85 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2CJT|A Chain A, Structural Basis For A Munc13-1 Dimeric   - Munc13-1 -
          Rim Heterodimer Switch: C2-Domains As Versatile
          Protein- Protein Interaction Modules
 pdb|2CJT|B Chain B, Structural Basis For A Munc13-1 Dimeric   - Munc13-1 -
          Rim Heterodimer Switch: C2-Domains As Versatile
          Protein- Protein Interaction Modules
 pdb|2CJT|C Chain C, Structural Basis For A Munc13-1 Dimeric   - Munc13-1 -
          Rim Heterodimer Switch: C2-Domains As Versatile
          Protein- Protein Interaction Modules
 pdb|2CJT|D Chain D, Structural Basis For A Munc13-1 Dimeric   - Munc13-1 -
          Rim Heterodimer Switch: C2-Domains As Versatile
          Protein- Protein Interaction Modules
          Length = 131

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVG 68
          E N ++ GL +EVW+KG+IWD  +G  ++PL  +  SNE G
Sbjct: 55 EINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEG 95


>pdb|2CJS|A Chain A, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim
           Heterodimer Switch: C2-domains As Versatile Protein-
           Protein Interaction Modules
 pdb|2CJS|B Chain B, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim
           Heterodimer Switch: C2-domains As Versatile Protein-
           Protein Interaction Modules
          Length = 167

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 28  ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVG 68
           E N ++ GL +EVW+KG+IWD  +G  ++PL  +  SNE G
Sbjct: 64  EINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEG 104


>pdb|1TI2|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI2|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI2|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI2|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI2|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI2|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1TI4|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI4|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI4|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI4|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI4|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI4|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1TI6|A Chain A, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1TI6|C Chain C, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1TI6|E Chain E, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1TI6|G Chain G, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1TI6|I Chain I, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1TI6|K Chain K, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLD|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLD|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLD|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLD|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLD|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLD|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici
 pdb|1VLE|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLE|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLE|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLE|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLE|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLE|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Pyrogallol
 pdb|1VLF|M Chain M, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLF|O Chain O, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLF|Q Chain Q, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLF|S Chain S, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLF|U Chain U, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
 pdb|1VLF|W Chain W, Crystal Structure Of Pyrogallol-Phloroglucinol
           Transhydroxylase From Pelobacter Acidigallici Complexed
           With Inhibitor 1,2,4,5-Tetrahydroxy-Benzene
          Length = 875

 Score = 25.4 bits (54), Expect = 8.4,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 14/27 (51%)

Query: 4   ESNVIGSNFRWSVFSVKTRFEVPSETN 30
           E++  G  F W +F  KT F  PS  N
Sbjct: 414 ENSAAGFKFAWRMFDGKTTFPSPSNLN 440


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.137    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,691,263
Number of Sequences: 62578
Number of extensions: 104091
Number of successful extensions: 139
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 134
Number of HSP's gapped (non-prelim): 5
length of query: 85
length of database: 14,973,337
effective HSP length: 53
effective length of query: 32
effective length of database: 11,656,703
effective search space: 373014496
effective search space used: 373014496
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)