RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8569
         (85 letters)



>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian
          uncoordinated) proteins.  C2-like domains are thought
          to be involved in phospholipid binding in a Ca2+
          independent manner in both Unc13 and Munc13.
          Caenorabditis elegans Unc13 has a central domain with
          sequence similarity to PKC, which includes C1 and
          C2-related domains. Unc13 binds phorbol esters and DAG
          with high affinity in a phospholipid manner.  Mutations
          in Unc13 results in abnormal neuronal connections and
          impairment in cholinergic neurotransmission in the
          nematode.  Munc13 is the mammalian homolog which are
          expressed in the brain.  There are 3 isoforms
          (Munc13-1, -2, -3) and are thought to play a role in
          neurotransmitter release and are hypothesized to be
          high-affinity receptors for phorbol esters.  Unc13 and
          Munc13 contain both C1 and C2 domains.  There are two
          C2 related domains present, one central and one at the
          carboxyl end.  Munc13-1 contains a third C2-like
          domain.  Munc13 interacts with syntaxin, synaptobrevin,
          and synaptotagmin suggesting a role for these as
          scaffolding proteins. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 127

 Score = 56.3 bits (136), Expect = 7e-12
 Identities = 19/42 (45%), Positives = 29/42 (69%)

Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
          E N ++ GL+IE+W+KG+IWD  +G  ++PL  +  SNE G 
Sbjct: 52 EINRLDLGLVIELWNKGLIWDTLVGTVWIPLSTIRQSNEEGP 93


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in
          PKC. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 102

 Score = 27.4 bits (61), Expect = 0.47
 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 4/50 (8%)

Query: 23 FEVPSETNDVNQGLLIEVWDKGIIW-DRAIGYHYLPLPQVAFSNEVGSRK 71
          F V    +D    L +EVWDK     D  +G   +PL ++  S + G   
Sbjct: 53 FPVLDPESDT---LTVEVWDKDRFSKDDFLGEVEIPLSELLDSGKEGELW 99


>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
          alpha and gamma.  A single C2 domain is found in PKC
          alpha and gamma. The PKC family of serine/threonine
          kinases regulates apoptosis, proliferation, migration,
          motility, chemo-resistance, and differentiation.  There
          are 3 groups: group 1(alpha, betaI, beta II, gamma)
          which require phospholipids and calcium, group 2
          (delta, epsilon, theta, eta) which do not require
          calcium for activation, and group 3 (xi, iota/lambda)
          which are atypical and can be activated in the absence
          of diacylglycerol and calcium. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-I topology.
          Length = 131

 Score = 27.2 bits (61), Expect = 0.61
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 4/21 (19%)

Query: 30 NDVNQGLLIEVWDKGIIWDRA 50
           D ++ L IEVWD    WDR 
Sbjct: 76 ADKDRRLSIEVWD----WDRT 92


>gnl|CDD|220056 pfam08883, DOPA_dioxygen, Dopa 4,5-dioxygenase family.  This
          family of proteins are related to a DOPA
          4,5-dioxygenase that is involved in synthesis of
          betalain. DOPA-dioxygenase is the key enzyme involved
          in betalain biosynthesis. It converts
          3,4-dihydroxyphenylalanine to betalamic acid, a yellow
          chromophore.
          Length = 104

 Score = 24.8 bits (55), Expect = 4.1
 Identities = 7/24 (29%), Positives = 15/24 (62%)

Query: 44 GIIWDRAIGYHYLPLPQVAFSNEV 67
          G + ++ +G H +   Q+AF+ E+
Sbjct: 33 GRVHEKPVGPHPVWSFQLAFTPEL 56


>gnl|CDD|237545 PRK13888, PRK13888, conjugal transfer protein TrbN; Provisional.
          Length = 206

 Score = 24.8 bits (54), Expect = 5.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)

Query: 42  DKGIIWDRAIGYH 54
           DKG +W +A  YH
Sbjct: 101 DKGDLWTKAANYH 113


>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde
           dehydrogenase, PhdK-like.  Nocardioides sp. strain
           KP72-carboxybenzaldehyde dehydrogenase (PhdK), an enzyme
           involved in phenanthrene degradation, and other similar
           sequences, are present in this CD.
          Length = 456

 Score = 24.6 bits (54), Expect = 7.3
 Identities = 13/59 (22%), Positives = 21/59 (35%), Gaps = 14/59 (23%)

Query: 15  SVFSVKTRFEVPSETNDVNQGLLIEVW--------------DKGIIWDRAIGYHYLPLP 59
           SV   +   E+ ++ N V  GL   +W              + G +W      H+L  P
Sbjct: 367 SVLRWRDEAEMVAQANGVEYGLTAAIWTNDISQAHRTARRVEAGYVWINGSSRHFLGAP 425


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.319    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0790    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,266,767
Number of extensions: 334460
Number of successful extensions: 231
Number of sequences better than 10.0: 1
Number of HSP's gapped: 231
Number of HSP's successfully gapped: 8
Length of query: 85
Length of database: 10,937,602
Length adjustment: 53
Effective length of query: 32
Effective length of database: 8,586,840
Effective search space: 274778880
Effective search space used: 274778880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.1 bits)