Diaphorina citri psyllid: psy8577


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MRFDFTAVKVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQGIAGDVHIDANGDRLADYSLLDMDPDTSEFRRNENEELKSGVRGSIDEDLKGG
ccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcHHcccEEEEcccEEEEcccccECccEEEEEEccccccEEEEEccEEccccccccccccccc
MRFDFTAVKVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQGIAGDVHIDANGDRLADYSLLDMDPDTSEFRRNENEELKSGVRGSIDEDLKG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFDFTAVKVKKVAKEGYNFTFGNESVSTFVTAFYDAVILYSIALNETIAMGGSQSDGSAITRRMWNRTYQGIAGDVHIDANGDRLADYSLLDMDPDTSEFRRNENEELKSGVRGSIDEDLKGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0004383 [MF]guanylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0005488 [MF]bindingprobableGO:0003674
GO:0006182 [BP]cGMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0016941 [MF]natriuretic peptide receptor activityprobableGO:0038023, GO:0060089, GO:0001653, GO:0003674, GO:0004872, GO:0004871

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DP4, chain A
Confidence level:very confident
Coverage over the Query: 3-117
View the alignment between query and template
View the model in PyMOL