Diaphorina citri psyllid: psy8595


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MHFSIPDTQQLCDDSGKYTGYNLHLNGEYHCSVRYKQLHNFNEQLKKLYGPENVPSFPPKKLFPLSVIQIEERRTHLEKYMQSCKKLWNSLHRDIRDSQSLGAFKTSLVKYLKGTVKETFSGWVEELL
cCEECcccEEECcccccEEEEEEEEccCEEEEEEcHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHc
MHFSIPDTQ**CDDSGKYTGYNLHLNGEYHCSVRYKQLHNFNEQLKKLYGPENVPSFPPKKLFPLSVIQIEERRTHLEKYMQSCKKLWNSLHRDIRDSQSLGAFKTSLVKYLKGTVKETFSGWVEELL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFSIPDTQQLCDDSGKYTGYNLHLNGEYHCSVRYKQLHNFNEQLKKLYGPENVPSFPPKKLFPLSVIQIEERRTHLEKYMQSCKKLWNSLHRDIRDSQSLGAFKTSLVKYLKGTVKETFSGWVEELL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sorting nexin-17 May be involved in several stages of intracellular protein trafficking. Plays a role in the sorting of endocytosed LRP1 and APP, and prevents their degradation. Required for maintenance of normal cell surface levels of APP and LRP1. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)).confidentQ5EA77
Sorting nexin-17 May be involved in several stages of intracellular protein trafficking. Plays a role in the sorting of endocytosed LRP1 and APP, and prevents their degradation. Required for maintenance of normal cell surface levels of APP and LRP1. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)).confidentQ5R4A5
Sorting nexin-17 May be involved in several stages of intracellular protein trafficking. Plays a role in the sorting of endocytosed LRP1 and APP, and prevents their degradation. Required for maintenance of normal cell surface levels of APP and LRP1. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P)).confidentQ8BVL3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035091 [MF]phosphatidylinositol bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0050750 [MF]low-density lipoprotein particle receptor bindingprobableGO:0070325, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LUI, chain A
Confidence level:very confident
Coverage over the Query: 2-110
View the alignment between query and template
View the model in PyMOL