Query         psy8604
Match_columns 70
No_of_seqs    124 out of 1031
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 23:03:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8604.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8604hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5022 Myosin heavy chain [Cy  99.9 1.3E-24 2.9E-29  167.6   3.4   63    1-63    619-687 (1463)
  2 PTZ00014 myosin-A; Provisional  99.9 1.3E-23 2.8E-28  157.8   2.7   63    1-63    652-720 (821)
  3 cd01384 MYSc_type_XI Myosin mo  99.9 3.2E-23 6.9E-28  153.3   3.4   63    1-63    556-624 (674)
  4 cd01383 MYSc_type_VIII Myosin   99.9 2.6E-23 5.6E-28  153.8   2.9   63    1-63    562-630 (677)
  5 cd01378 MYSc_type_I Myosin mot  99.9 2.5E-23 5.5E-28  153.8   2.8   63    1-63    556-624 (674)
  6 cd01379 MYSc_type_III Myosin m  99.9 3.6E-23 7.8E-28  152.6   3.3   63    1-63    539-607 (653)
  7 cd01387 MYSc_type_XV Myosin mo  99.9 3.8E-23 8.3E-28  152.9   3.4   64    1-64    561-630 (677)
  8 cd01377 MYSc_type_II Myosin mo  99.9 3.9E-23 8.5E-28  153.1   3.3   64    1-64    576-645 (693)
  9 cd01385 MYSc_type_IX Myosin mo  99.9 4.4E-23 9.5E-28  152.9   3.4   63    1-63    575-643 (692)
 10 cd01381 MYSc_type_VII Myosin m  99.9 4.2E-23 9.2E-28  152.6   2.8   63    1-63    553-621 (671)
 11 cd01380 MYSc_type_V Myosin mot  99.9   7E-23 1.5E-27  151.7   3.5   64    1-64    575-644 (691)
 12 cd00124 MYSc Myosin motor doma  99.9 9.5E-23 2.1E-27  150.6   3.2   63    1-63    563-631 (679)
 13 cd01386 MYSc_type_XVIII Myosin  99.9   1E-22 2.2E-27  152.2   3.3   63    1-63    623-713 (767)
 14 cd01382 MYSc_type_VI Myosin mo  99.9 9.6E-23 2.1E-27  151.5   2.9   63    1-63    601-669 (717)
 15 smart00242 MYSc Myosin. Large   99.9 1.8E-22   4E-27  149.2   3.1   63    1-63    559-627 (677)
 16 PF00063 Myosin_head:  Myosin h  99.8 4.9E-21 1.1E-25  141.1   0.9   65    1-65    580-650 (689)
 17 KOG0161|consensus               99.8 2.5E-19 5.5E-24  142.1   3.6   62    1-62    651-718 (1930)
 18 KOG0160|consensus               99.7 8.1E-18 1.8E-22  126.8   0.5   63    1-63    556-624 (862)
 19 KOG0162|consensus               99.7 1.6E-17 3.5E-22  123.8   1.3   61    2-62    574-640 (1106)
 20 KOG0164|consensus               99.6 1.6E-16 3.5E-21  118.3   3.2   61    1-61    573-639 (1001)
 21 KOG0163|consensus               99.4 2.2E-13 4.7E-18  102.6   2.4   60    1-60    654-719 (1259)
 22 KOG4229|consensus               63.5     2.7 5.8E-05   34.0   0.3   60    3-62    658-724 (1062)
 23 cd01378 MYSc_type_I Myosin mot  61.7     2.5 5.5E-05   32.3  -0.1   25   45-69    577-601 (674)
 24 smart00751 BSD domain in trans  56.0      12 0.00025   19.0   1.9   17   45-61     30-46  (51)
 25 COG5022 Myosin heavy chain [Cy  54.9     8.6 0.00019   32.2   1.8   25   45-69    640-664 (1463)
 26 KOG4229|consensus               52.7     2.3   5E-05   34.4  -1.6   57    3-59    805-867 (1062)
 27 cd01377 MYSc_type_II Myosin mo  49.9      12 0.00027   28.8   1.9   25   45-69    597-621 (693)
 28 PF03909 BSD:  BSD domain  ;  I  47.2      18 0.00039   19.0   1.8   19   46-64     36-54  (62)
 29 cd01384 MYSc_type_XI Myosin mo  46.2      15 0.00033   28.2   1.9   25   45-69    577-601 (674)
 30 cd01379 MYSc_type_III Myosin m  44.3      17 0.00037   27.9   1.9   25   45-69    560-584 (653)
 31 PTZ00095 40S ribosomal protein  43.9      21 0.00045   23.1   2.0   29   16-44    110-138 (169)
 32 cd01382 MYSc_type_VI Myosin mo  42.7      18  0.0004   28.0   1.9   25   45-69    622-646 (717)
 33 cd01385 MYSc_type_IX Myosin mo  42.1      19 0.00042   27.8   1.9   25   45-69    596-620 (692)
 34 PF10140 YukC:  WXG100 protein   42.1      20 0.00044   25.6   1.9   19   45-63    108-126 (359)
 35 cd01380 MYSc_type_V Myosin mot  41.3      20 0.00044   27.6   1.9   25   45-69    596-620 (691)
 36 cd00124 MYSc Myosin motor doma  41.2      20 0.00044   27.5   1.9   25   45-69    584-608 (679)
 37 cd01383 MYSc_type_VIII Myosin   41.0      17 0.00037   28.0   1.4   25   45-69    583-607 (677)
 38 cd01387 MYSc_type_XV Myosin mo  40.7      21 0.00045   27.5   1.9   25   45-69    582-606 (677)
 39 cd01386 MYSc_type_XVIII Myosin  40.3      20 0.00044   28.1   1.8   21   49-69    670-690 (767)
 40 cd01381 MYSc_type_VII Myosin m  39.6      21 0.00045   27.5   1.7   25   45-69    574-598 (671)
 41 PTZ00014 myosin-A; Provisional  36.0      23 0.00049   28.1   1.5   25   45-69    673-697 (821)
 42 PF02296 Alpha_adaptin_C:  Alph  34.6      24 0.00052   21.0   1.2   18   46-63      4-21  (113)
 43 smart00242 MYSc Myosin. Large   34.0      28  0.0006   26.8   1.6   25   45-69    580-604 (677)
 44 COG4899 Uncharacterized protei  32.9      19 0.00042   23.0   0.6   14    8-21     48-61  (166)
 45 KOG4671|consensus               30.8      18 0.00039   24.0   0.2   28   10-38     51-78  (201)
 46 PRK09333 30S ribosomal protein  30.7      49  0.0011   21.0   2.1   28   17-44     87-114 (150)
 47 PF07962 Swi3:  Replication For  29.7      37 0.00081   19.1   1.4   25   45-70     50-74  (83)
 48 KOG2690|consensus               29.5      26 0.00056   25.0   0.8   17   44-60    200-216 (331)
 49 COG5425 Usg protein, probable   28.8      31 0.00067   19.9   0.9   24   45-69     46-69  (90)
 50 COG5132 BUD31 Cell cycle contr  27.5      20 0.00044   22.3  -0.0   15   10-24    101-115 (146)
 51 PF10260 SAYSvFN:  Uncharacteri  27.5      58  0.0013   18.1   1.9   21   16-36     51-71  (71)
 52 PF08120 Toxin_32:  Tamulustoxi  27.1      61  0.0013   15.3   1.6   19    9-27      2-20  (35)
 53 PF02960 K1:  K1 glycoprotein;   26.6      23  0.0005   21.7   0.1   21   11-38     92-112 (130)
 54 PF01090 Ribosomal_S19e:  Ribos  25.4      22 0.00047   22.3  -0.1   29   16-44     85-113 (139)
 55 PF05912 DUF870:  Caenorhabditi  23.6      21 0.00045   21.5  -0.5   13   11-23     76-88  (114)
 56 PRK10167 hypothetical protein;  21.9      42 0.00091   21.6   0.7   25   46-70     28-52  (169)
 57 KOG3030|consensus               21.5      31 0.00068   24.3   0.0   34    5-39    134-168 (317)

No 1  
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=99.90  E-value=1.3e-24  Score=167.65  Aligned_cols=63  Identities=41%  Similarity=0.663  Sum_probs=61.0

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||++|.|+.||..+|+.||||+||+|+|      ||.|++|++|++||++|.-
T Consensus       619 m~tl~sTqphyIRCIkPN~~K~p~~fD~~mVL~QLr~~GVlE~IRIsraGFP~R~~f~EFv~RY~IL~p  687 (1463)
T COG5022         619 MSTLNSTQPHYIRCIKPNEEKSPWTFDNQMVLSQLRCCGVLETIRISRAGFPSRWTFDEFVQRYRILSP  687 (1463)
T ss_pred             HHHHHhcCCceeEeeCCCcccCccccchHHHHHHHHhcchhhheeeccccCchhhhHHHHHHHHHHhcc
Confidence            67899999999999999999999999999999999999999997      9999999999999999876


No 2  
>PTZ00014 myosin-A; Provisional
Probab=99.88  E-value=1.3e-23  Score=157.78  Aligned_cols=63  Identities=30%  Similarity=0.504  Sum_probs=60.3

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.|.|+.||..+|++||+|+||+|++      ||+|++|.+|++||++|..
T Consensus       652 m~~L~~t~phfIRCIKPN~~k~p~~fd~~~V~~QLr~~GvLE~iri~r~Gyp~R~~f~~F~~rY~~L~~  720 (821)
T PTZ00014        652 MSLINSTEPHFIRCIKPNENKKPLDWNSSKVLIQLHSLSILEALQLRQLGFSYRRTFAEFLSQFKYLDL  720 (821)
T ss_pred             HHHHhccCCeEEEEeCcCcccCccccchHhHHHHhhhhhHHHHHHHHhcCCcccccHHHHHHHHHhcCc
Confidence            67899999999999999999999999999999999999999997      9999999999999999864


No 3  
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=99.87  E-value=3.2e-23  Score=153.30  Aligned_cols=63  Identities=33%  Similarity=0.568  Sum_probs=60.2

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.++|+.||...|.+||+|+||+|++      ||+|++|.+|+.||+.|.-
T Consensus       556 ~~~L~~t~~hfIRCIKPN~~k~p~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~r~~~~~F~~ry~~L~~  624 (674)
T cd01384         556 METLSTTEPHYIRCIKPNNVLKPGIFENENVLQQLRCGGVLEAIRISCAGYPTRRTFDEFLDRFGILAP  624 (674)
T ss_pred             HHHHhccCCeEEEEeCCCcccCCCccCHHHHHHHHHHcchHHHHHHHhcCCCccccHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999999864


No 4  
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=99.87  E-value=2.6e-23  Score=153.83  Aligned_cols=63  Identities=32%  Similarity=0.615  Sum_probs=60.1

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.|.|+.||..+|++||+|+|++|++      ||+|++|.+|++||+.+.-
T Consensus       562 ~~~L~~t~phfIRCIKPN~~k~p~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~R~~~~~F~~rY~~L~~  630 (677)
T cd01383         562 MQQLENTTPHFIRCIKPNNKQLPGIYEQGLVLQQLRCCGVLEVVRISRSGYPTRMTHQEFARRYGFLLL  630 (677)
T ss_pred             HHHHhCCCCeEEEEECcccccCcCccchhhhHHHhhhccHHHHHHHHhcCCCccccHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999999865


No 5  
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=99.87  E-value=2.5e-23  Score=153.76  Aligned_cols=63  Identities=33%  Similarity=0.610  Sum_probs=60.3

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.++|+.||..+|++||+|+||+|++      ||+|++|++|++||+.+.-
T Consensus       556 m~~L~~t~phfIRCIKPN~~k~p~~Fd~~~V~~QLr~~GvLE~iri~r~Gyp~R~~~~~F~~rY~~L~~  624 (674)
T cd01378         556 VETLMKCTPHYIRCIKPNETKSPNDFDESRVLHQVKYLGLLENVRVRRAGFAYRQTFDKFLQRYKLLSP  624 (674)
T ss_pred             HHHHHccCCeEEEEECCCccCCchhcCHHHHHHHHHhcChHHHHHHHhcCCCccccHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999999865


No 6  
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=99.87  E-value=3.6e-23  Score=152.60  Aligned_cols=63  Identities=32%  Similarity=0.626  Sum_probs=60.1

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|.+|+||||||||||+.+.|+.||...|.+||+|+|++|++      ||+|++|++|+.||+.|..
T Consensus       539 ~~~l~~t~~hfIRCIKPN~~k~~~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~r~~~~~F~~rY~~l~~  607 (653)
T cd01379         539 LSKMVVGQPHFVRCIKPNEDRQAKKFDAEKVLKQLRYTGILETARIRRQGFSHRILFANFIRRYCFLAY  607 (653)
T ss_pred             HHHHhccCCceEEeeCCCcccCccccCHHHHHHHHHHcchHHHHHHHHcCCCccccHHHHHHHHHHhcc
Confidence            56789999999999999999999999999999999999999997      9999999999999999864


No 7  
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=99.87  E-value=3.8e-23  Score=152.89  Aligned_cols=64  Identities=34%  Similarity=0.651  Sum_probs=60.7

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGML   64 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~~   64 (70)
                      |+.|++|+||||||||||+.+.|+.||..+|++||+|+|++|++      ||+|++|++|++||+.|...
T Consensus       561 ~~~l~~t~phfIRCIKPN~~k~~~~Fd~~~V~~QLr~~GvlE~vri~r~Gyp~r~~~~~F~~rY~~L~~~  630 (677)
T cd01387         561 VEKMERCNPLFVRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQHFIDRYRCLVAL  630 (677)
T ss_pred             HHHHhcCCCeEEEEECCCCcCCccccChHHHHHHHHHhchHHHHHHHHccCCccccHHHHHHHHHHhCcc
Confidence            56789999999999999999999999999999999999999997      99999999999999999654


No 8  
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=99.87  E-value=3.9e-23  Score=153.11  Aligned_cols=64  Identities=34%  Similarity=0.535  Sum_probs=60.6

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGML   64 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~~   64 (70)
                      |++|++|+||||||||||+.+.|+.||...|.+||+|+||+|++      ||.|++|++|++||+.|...
T Consensus       576 ~~~L~~t~~hfIRCIKPN~~k~p~~Fd~~~V~~QLr~~GvlEtvrirr~Gyp~R~~f~~F~~rY~~L~~~  645 (693)
T cd01377         576 MTTLRSTNPHFVRCIIPNEEKKPGKLDAHLVLDQLRCNGVLEGIRICRKGFPNRILYAEFRQRYEILAPN  645 (693)
T ss_pred             HHHHhccCCeEEEEeCcCccCCCCccCHHHHHHHHHhcchHHHHHHHHcCCCccccHHHHHHHHHHhCcc
Confidence            56789999999999999999999999999999999999999997      99999999999999998653


No 9  
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=99.87  E-value=4.4e-23  Score=152.88  Aligned_cols=63  Identities=52%  Similarity=0.748  Sum_probs=60.0

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |+.|++|+||||||||||+.+.|+.||..+|.+||+|+|++|++      ||.|++|++|++||+.+..
T Consensus       575 ~~~L~~t~~hfIRCIKPN~~k~p~~Fd~~~V~~QLr~~GvlE~irirr~Gyp~R~~~~~F~~rY~~L~~  643 (692)
T cd01385         575 METLGKAEPFFIRCIKSNAEKIENCFDDELVLRQLRYTGMLETVRIRRAGYSVRYTYQDFTQQYRILLP  643 (692)
T ss_pred             HHHHhccCCeEEEEeCCCCccCcCccCHHHHHHHHHhhchHHHHHHHhccCCccccHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999999863


No 10 
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=99.87  E-value=4.2e-23  Score=152.55  Aligned_cols=63  Identities=41%  Similarity=0.654  Sum_probs=60.3

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.+.|+.||..+|.+||+|+||+|++      ||+|++|.+|+.||+.+.-
T Consensus       553 ~~~L~~t~phfIRCIKPN~~k~~~~fd~~~V~~QLr~~Gvle~iri~r~Gyp~r~~~~~F~~rY~~L~~  621 (671)
T cd01381         553 MRTLSSCQPFFIRCIKPNEYKEPMVFDRELCVRQLRYSGMMETIRIRRAGYPIRHTFREFVERYRVLVP  621 (671)
T ss_pred             HHHHhcCCCeEEEEeCcchhhccCccChHHHHHHHHhcchHHHHHHHHcCcCceecHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999999875


No 11 
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=99.87  E-value=7e-23  Score=151.75  Aligned_cols=64  Identities=39%  Similarity=0.618  Sum_probs=60.7

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGML   64 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~~   64 (70)
                      |++|++|+||||||||||+.+.|+.||..+|++||+|+|++|++      ||+|++|++|+.||+.|.-.
T Consensus       575 ~~~L~~t~phfIRCIKPN~~k~~~~fd~~~V~~QLr~~GvlE~iri~r~Gyp~R~~~~~F~~ry~~L~~~  644 (691)
T cd01380         575 MSTLNSTNPHYIRCIKPNDEKKPFKFEPKRVLQQLRACGVLETIRISAAGFPSRWTYEEFAQRYRVLVPS  644 (691)
T ss_pred             HHHHhccCCeEEEEeCCCcccCcCccCHHHHHHHHHHhchHHHHHHHhccCCccccHHHHHHHHHHhCcc
Confidence            56789999999999999999999999999999999999999997      99999999999999998754


No 12 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=99.86  E-value=9.5e-23  Score=150.63  Aligned_cols=63  Identities=44%  Similarity=0.709  Sum_probs=60.0

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.+.|+.||...|.+||+|+|++|++      ||.|++|++|++||+.+.-
T Consensus       563 ~~~L~~t~~hfIRCIKPN~~k~p~~fd~~~V~~QLr~~GvlE~irirr~Gyp~R~~~~eF~~rY~~L~~  631 (679)
T cd00124         563 MATLNSTEPHFIRCIKPNEEKKPNAFDSGKVLQQLRYLGILETIRIRRLGFSVRIPFDEFLSRYRFLAP  631 (679)
T ss_pred             HHHHhcCCCeEEEEECCCcccCCCccChHHHHHHHHHhchHHHHHHHHccCCceeeHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999998864


No 13 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=99.86  E-value=1e-22  Score=152.19  Aligned_cols=63  Identities=21%  Similarity=0.344  Sum_probs=58.7

Q ss_pred             CCCCCCCCCceeeeecCCCCCC----------------------CCCccHHHHHHHHHHhCccccC------CCCCCCHH
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKI----------------------PNNFDIDTVLRQLRYTGMLKTD------IPNNFDID   52 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~----------------------p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~   52 (70)
                      |++|++|+||||||||||+.|.                      |+.||...|++||+|+||+|++      ||+|++|.
T Consensus       623 m~~L~~t~phfIRCIKPN~~k~~~~~~~~~~~~~~~~~~~~~~~p~~fd~~~V~~QLr~~GvlE~iri~r~Gfp~R~~~~  702 (767)
T cd01386         623 IDTLRRSGLHFVHCYLPQHNGGKAMARTASPSPQQSEDNGVAAEPLALDIPLLRSQLRGSQILEAARLHRLGFPISVPLG  702 (767)
T ss_pred             HHHHhccCCeeEEEeCccccccccccccccccccccccccccccccccCHHHHHHHHHhcccHHHHHHHhcCCcccccHH
Confidence            5679999999999999999874                      7899999999999999999997      99999999


Q ss_pred             HHHHHHhhhhh
Q psy8604          53 TVQRQLRYTGM   63 (70)
Q Consensus        53 ~F~~ry~~~~~   63 (70)
                      +|+.||+.|..
T Consensus       703 ~F~~RY~~L~~  713 (767)
T cd01386         703 EFVRRFGLLAE  713 (767)
T ss_pred             HHHHHHHhhCh
Confidence            99999998864


No 14 
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=99.86  E-value=9.6e-23  Score=151.50  Aligned_cols=63  Identities=24%  Similarity=0.414  Sum_probs=59.8

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||+.+.|+.||..+|++||+|+||+|++      ||+|++|.+|+.||+.+..
T Consensus       601 m~~L~~t~~hfIRCIKPN~~k~p~~fd~~~V~~QLr~~GvLE~vri~r~Gyp~R~~f~~F~~ry~~l~~  669 (717)
T cd01382         601 LEKLRSTGSSFIRCIKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMP  669 (717)
T ss_pred             HHHHhccCCeeeeeeCCCcccCCCCCChHHHHHHHHhcchHHHHHHHHccCchhhhHHHHHHHHHHhCC
Confidence            56799999999999999999999999999999999999999997      9999999999999997754


No 15 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=99.85  E-value=1.8e-22  Score=149.17  Aligned_cols=63  Identities=46%  Similarity=0.715  Sum_probs=60.1

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |+.|++|+||||||||||+.+.|+.||...|.+||+|+|++|++      ||+|++|++|+.||+.+.-
T Consensus       559 ~~~l~~t~~hfIRCIKPN~~k~~~~Fd~~~V~~QLr~~Gvle~iri~r~Gyp~r~~~~~F~~ry~~L~~  627 (677)
T smart00242      559 MDTLNSTNPHFIRCIKPNEEKKPGDFDSSLVLHQLRYLGVLETIRIRRAGFPYRLPFDEFLQRYRVLLP  627 (677)
T ss_pred             HHHHhccCCeEEEEeCCCcccCcccccHHHHHHHHHhcccHHHHHHHHccccceecHHHHHHHHHHhCc
Confidence            56789999999999999999999999999999999999999997      9999999999999998865


No 16 
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=99.80  E-value=4.9e-21  Score=141.13  Aligned_cols=65  Identities=45%  Similarity=0.709  Sum_probs=54.9

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGMLK   65 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~~~   65 (70)
                      |+.|++|+||||||||||+.+.|+.||..+|.+||+++|++|++      ||.|++|.+|++||+.|.-..
T Consensus       580 ~~~L~~t~~hfIrCIkPN~~~~~~~FD~~~V~~QLr~~gile~vri~~~Gyp~r~~~~eF~~RY~~L~~~~  650 (689)
T PF00063_consen  580 MDTLRSTQPHFIRCIKPNDQKKPNQFDSKLVLRQLRYSGILETVRIRRQGYPVRLTFDEFLRRYKCLLPSS  650 (689)
T ss_dssp             HHHHCTSEEEEEEEE-SSSS--TT---HHHHHHHHHHTTHHHHHHHHHCSSSEEEEHHHHHHHHGGGSTTC
T ss_pred             HhhhhhcccceEEEeccccccccccccchheehhhhhhhhhhhhhhhhcccceecchhhhhhhhceechhh
Confidence            45789999999999999999999999999999999999999996      999999999999999987643


No 17 
>KOG0161|consensus
Probab=99.76  E-value=2.5e-19  Score=142.14  Aligned_cols=62  Identities=34%  Similarity=0.605  Sum_probs=58.9

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTG   62 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~   62 (70)
                      |++|++|+|||||||.||..|.||.+|..+|+.||+|.||+|++      ||+|++|.+|.+||..+.
T Consensus       651 m~~l~~T~phFvRCiIPn~~K~~g~ld~~lvl~QLrcngVLEgIRicR~GfPnr~~~~eFrqRy~lla  718 (1930)
T KOG0161|consen  651 MTTLRSTHPHFVRCIIPNEEKKPGKLDAPLVLNQLRCNGVLEGIRICRQGFPNRMPFQEFRQRYELLA  718 (1930)
T ss_pred             HHHhccCCCceeEEeccCccccccccCHHHHHHHhhccCcHHHHHHHHhhCccccchHHHHHhHHhhh
Confidence            67899999999999999999999999999999999999999997      999999999999999443


No 18 
>KOG0160|consensus
Probab=99.67  E-value=8.1e-18  Score=126.79  Aligned_cols=63  Identities=37%  Similarity=0.559  Sum_probs=60.3

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~~   63 (70)
                      |++|++|+||||||||||..+.|..||..+|.+||+|+|+||++      ||.|.+|.+|+.||..+.-
T Consensus       556 m~~l~~t~phyircikPn~~~~p~~fe~~~v~~Qlr~~GvLetiRiS~~g~P~r~~~~Ef~~r~~~L~~  624 (862)
T KOG0160|consen  556 METLNSTPPHYIRCIKPNAEKKPQIFENNLVLQQLRCCGVLETIRISCAGFPTRWTFIEFVNRYGILMP  624 (862)
T ss_pred             HHHhcCCCCCCceeeCcchhcccccccccceeeeccccceehhheeccccCCccccHHHHHHHHhhcCc
Confidence            56899999999999999999999999999999999999999997      9999999999999998865


No 19 
>KOG0162|consensus
Probab=99.66  E-value=1.6e-17  Score=123.85  Aligned_cols=61  Identities=28%  Similarity=0.506  Sum_probs=57.7

Q ss_pred             CCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhh
Q psy8604           2 NTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTG   62 (70)
Q Consensus         2 ~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~   62 (70)
                      ++|.+|.||||||||||++|.|+.||...|++|+.|+|+-|++      |.+|..|+.|++||.+|.
T Consensus       574 eTLmKc~P~YIR~IKPNeTK~pnD~ee~~V~HQveYLGLqENiRvRRAGfAYRr~F~kF~qRyails  640 (1106)
T KOG0162|consen  574 ETLMKCQPHYIRCIKPNETKSPNDWEESRVKHQVEYLGLQENIRVRRAGFAYRRAFDKFAQRYAILS  640 (1106)
T ss_pred             HHHHhcCcceeEeeCCCCCCCCccHHHHHHHHHHHhcchhhheeehhhhhHHHHHHHHHHHHheecC
Confidence            4688999999999999999999999999999999999999997      999999999999998764


No 20 
>KOG0164|consensus
Probab=99.63  E-value=1.6e-16  Score=118.29  Aligned_cols=61  Identities=28%  Similarity=0.538  Sum_probs=57.9

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHhhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYT   61 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~   61 (70)
                      |++|.+.+|+||||||||+.|.|+.||..++..|.+++|++|++      |..|.+|+.|+.|||.+
T Consensus       573 v~nL~sKeP~YvRcikPNe~k~~~~fd~e~~~hqv~ylGLleNvrVrrAgfahRq~Y~~FL~RYKmi  639 (1001)
T KOG0164|consen  573 VKNLASKEPNYVRCIKPNEHKQPGQFDEERVRHQVRYLGLLENVRVRRAGFAHRQPYERFLLRYKMI  639 (1001)
T ss_pred             HHHHhhcCCCeEEeeccccccCccccchhhhHHHHHHHHHHhhhhhhhcccccccchHHHHHHHHhh
Confidence            45788999999999999999999999999999999999999997      99999999999999975


No 21 
>KOG0163|consensus
Probab=99.37  E-value=2.2e-13  Score=102.56  Aligned_cols=60  Identities=27%  Similarity=0.533  Sum_probs=54.1

Q ss_pred             CCCCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCcccc------CCCCCCCHHHHHHHHhh
Q psy8604           1 MNTLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKT------DIPNNFDIDTVQRQLRY   60 (70)
Q Consensus         1 m~~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~------~~p~r~~~~~F~~ry~~   60 (70)
                      |.+|++|..|||||||||....+..||...++.||+|+|+...      +||.|.+|.+...-|+-
T Consensus       654 ldKL~stGt~FiRCiKPN~kM~~~~FeGs~iLsQLqCsGm~SVL~LMq~GyPSR~~F~dLYamYkk  719 (1259)
T KOG0163|consen  654 LDKLESTGTHFIRCIKPNSKMIDRHFEGSAILSQLQCSGMISVLELMQHGYPSRTSFADLYAMYKK  719 (1259)
T ss_pred             HHHHHhcCCeeEEeecCccccccccccHHHHHHHhhhccHHHHHHHHhcCCCccccHHHHHHHHHh
Confidence            4578999999999999999999999999999999999997433      49999999999888864


No 22 
>KOG4229|consensus
Probab=63.55  E-value=2.7  Score=34.02  Aligned_cols=60  Identities=18%  Similarity=0.155  Sum_probs=46.2

Q ss_pred             CCCCCCCceeeeecCCCCCCCCCccHH-HHHHHHHHhCccccC------CCCCCCHHHHHHHHhhhh
Q psy8604           3 TLNQANPFFIRCIKSNTMKIPNNFDID-TVLRQLRYTGMLKTD------IPNNFDIDTVQRQLRYTG   62 (70)
Q Consensus         3 ~L~~t~~hfIrCIkPN~~k~p~~fd~~-~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~~~~   62 (70)
                      .|.....|+.|||++|+.-.+..++.. .+..++...|..++-      +..++.+.+++..++...
T Consensus       658 ~l~rg~~~~~~~i~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  724 (1062)
T KOG4229|consen  658 ALARGQDHFMRAISQNPRYALEQGSQERKGPRRLSSRGSTATPSHDRPGRKTNLLYSEVVNGRKNSE  724 (1062)
T ss_pred             hcCCCccchhhhhhcCchhhhhhcCcccCchhhhhhcccccCCCCCCccccccccchhhhccccccc
Confidence            466677999999999999999888877 788888888877764      455677777666655443


No 23 
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=61.70  E-value=2.5  Score=32.32  Aligned_cols=25  Identities=44%  Similarity=0.790  Sum_probs=22.7

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       577 ~p~~Fd~~~V~~QLr~~GvLE~iri  601 (674)
T cd01378         577 SPNDFDESRVLHQVKYLGLLENVRV  601 (674)
T ss_pred             CchhcCHHHHHHHHHhcChHHHHHH
Confidence            4677999999999999999999997


No 24 
>smart00751 BSD domain in transcription factors and synapse-associated proteins.
Probab=56.03  E-value=12  Score=19.04  Aligned_cols=17  Identities=12%  Similarity=0.262  Sum_probs=14.4

Q ss_pred             CCCCCCHHHHHHHHhhh
Q psy8604          45 IPNNFDIDTVQRQLRYT   61 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~   61 (70)
                      =|..++.++|+.||=+.
T Consensus        30 VP~~~se~~FW~ryF~~   46 (51)
T smart00751       30 VPKVLSEEEFWARYFYL   46 (51)
T ss_pred             CCCCCCHHHHHHHHHHH
Confidence            58999999999998554


No 25 
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=54.92  E-value=8.6  Score=32.22  Aligned_cols=25  Identities=44%  Similarity=0.626  Sum_probs=23.0

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|+.++-...+.+.|++|++||+||
T Consensus       640 ~p~~fD~~mVL~QLr~~GVlE~IRI  664 (1463)
T COG5022         640 SPWTFDNQMVLSQLRCCGVLETIRI  664 (1463)
T ss_pred             CccccchHHHHHHHHhcchhhheee
Confidence            5778889999999999999999998


No 26 
>KOG4229|consensus
Probab=52.67  E-value=2.3  Score=34.35  Aligned_cols=57  Identities=32%  Similarity=0.374  Sum_probs=44.1

Q ss_pred             CCCCCCCceeeeecCCCCCCCCCccHHHHHHHHHHhCccccC------CCCCCCHHHHHHHHh
Q psy8604           3 TLNQANPFFIRCIKSNTMKIPNNFDIDTVLRQLRYTGMLKTD------IPNNFDIDTVQRQLR   59 (70)
Q Consensus         3 ~L~~t~~hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~g~le~~------~p~r~~~~~F~~ry~   59 (70)
                      .+....+.|++|++-|..+....|+...|..|+.+.|+.+..      +...++..++...++
T Consensus       805 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~v~~~~~~t~~~~~~~v~~~~~~~~i~~~~~~~~~~  867 (1062)
T KOG4229|consen  805 YLAIAKELFVRRFLENQKKIGLRFPDNVVLRQVSYTGELDQEQVRRSLYFAEISPQDSVNQSR  867 (1062)
T ss_pred             hhhhhhHHHHHHHHHhhhhhccCCChHHHHHhhhchhhhccchheeccccccccchhcccccc
Confidence            345567889999999988888899999999999999976664      555566655555444


No 27 
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=49.89  E-value=12  Score=28.79  Aligned_cols=25  Identities=36%  Similarity=0.587  Sum_probs=23.0

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-+...++.|++|++|++||
T Consensus       597 ~p~~Fd~~~V~~QLr~~GvlEtvri  621 (693)
T cd01377         597 KPGKLDAHLVLDQLRCNGVLEGIRI  621 (693)
T ss_pred             CCCccCHHHHHHHHHhcchHHHHHH
Confidence            4778999999999999999999997


No 28 
>PF03909 BSD:  BSD domain  ;  InterPro: IPR005607 The BSD domain is an about 60-residue long domain named after the BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins in which it is found. Additionally, it is also found in several hypothetical proteins. The BSD domain occurs in one or two copies in a variety of species ranging from primal protozoan to human. It can be found associated with other domains such as the BTB domain (see PDOC50097 from PROSITEDOC) or the U-box in multidomain proteins. The function of the BSD domain is yet unknown []. Secondary structure prediction indicates the presence of three predicted alpha helices, which probably form a three-helical bundle in small domains. The third predicted helix contains neighbouring phenylalanine and tryptophan residues - less common amino acids that are invariant in all the BSD domains identified and that are the most striking sequence features of the domain [].  Some proteins known to contain one or two BSD domains are listed below:  Mammalian TFIIH basal transcription factor complex p62 subunit (GTF2H1).  Yeast RNA polymerase II transcription factor B 73 kDa subunit (TFB1), the homologue of BTF2.  Yeast DOS2 protein. It is involved in single-copy DNA replication and ubiquitination.  Drosophila synapse-associated protein SAP47.  Mammalian SYAP1.  Various Arabidopsis thaliana (Mouse-ear cress) hypothetical proteins.; PDB: 1X3A_A 1PFJ_A 2RNR_B 2DII_A.
Probab=47.15  E-value=18  Score=19.00  Aligned_cols=19  Identities=11%  Similarity=0.169  Sum_probs=15.0

Q ss_pred             CCCCCHHHHHHHHhhhhhh
Q psy8604          46 PNNFDIDTVQRQLRYTGML   64 (70)
Q Consensus        46 p~r~~~~~F~~ry~~~~~~   64 (70)
                      |..++.++|+.||-+....
T Consensus        36 P~~~~e~~FW~rYf~~~~~   54 (62)
T PF03909_consen   36 PSKMSEEEFWKRYFYRLHK   54 (62)
T ss_dssp             TTTS-HHHHHHHHHCHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHH
Confidence            9999999999999766543


No 29 
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=46.20  E-value=15  Score=28.23  Aligned_cols=25  Identities=36%  Similarity=0.632  Sum_probs=23.0

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       577 ~p~~fd~~~V~~QLr~~GvlE~iri  601 (674)
T cd01384         577 KPGIFENENVLQQLRCGGVLEAIRI  601 (674)
T ss_pred             CCCccCHHHHHHHHHHcchHHHHHH
Confidence            4678999999999999999999997


No 30 
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=44.33  E-value=17  Score=27.91  Aligned_cols=25  Identities=48%  Similarity=0.810  Sum_probs=22.9

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       560 ~~~~fd~~~V~~QLr~~GvlE~iri  584 (653)
T cd01379         560 QAKKFDAEKVLKQLRYTGILETARI  584 (653)
T ss_pred             CccccCHHHHHHHHHHcchHHHHHH
Confidence            4778999999999999999999987


No 31 
>PTZ00095 40S ribosomal protein S19; Provisional
Probab=43.90  E-value=21  Score=23.14  Aligned_cols=29  Identities=14%  Similarity=0.135  Sum_probs=20.7

Q ss_pred             cCCCCCCCCCccHHHHHHHHHHhCccccC
Q psy8604          16 KSNTMKIPNNFDIDTVLRQLRYTGMLKTD   44 (70)
Q Consensus        16 kPN~~k~p~~fd~~~v~~Ql~~~g~le~~   44 (70)
                      +|+.....+---...+++||...|++|..
T Consensus       110 ~P~h~~~aSg~iiR~~LQqLE~~glVek~  138 (169)
T PTZ00095        110 APNHTVRASGKILRWICQQLEKLGLVEQG  138 (169)
T ss_pred             CCCcccCCchHHHHHHHHHHHHCCCEEec
Confidence            45554445545567799999999999854


No 32 
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=42.72  E-value=18  Score=27.99  Aligned_cols=25  Identities=20%  Similarity=0.469  Sum_probs=23.0

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       622 ~p~~fd~~~V~~QLr~~GvLE~vri  646 (717)
T cd01382         622 VSHQFEGAQILSQLQCSGMVSVLDL  646 (717)
T ss_pred             CCCCCChHHHHHHHHhcchHHHHHH
Confidence            4678999999999999999999997


No 33 
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=42.11  E-value=19  Score=27.75  Aligned_cols=25  Identities=68%  Similarity=0.919  Sum_probs=22.9

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       596 ~p~~Fd~~~V~~QLr~~GvlE~iri  620 (692)
T cd01385         596 IENCFDDELVLRQLRYTGMLETVRI  620 (692)
T ss_pred             CcCccCHHHHHHHHHhhchHHHHHH
Confidence            4678999999999999999999987


No 34 
>PF10140 YukC:  WXG100 protein secretion system (Wss), protein YukC;  InterPro: IPR018778  Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This protein is designated YukC in Bacillus subtilis and EssB is Staphylococcus aureus. ; PDB: 4ANN_A.
Probab=42.09  E-value=20  Score=25.65  Aligned_cols=19  Identities=16%  Similarity=0.218  Sum_probs=12.3

Q ss_pred             CCCCCCHHHHHHHHhhhhh
Q psy8604          45 IPNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~   63 (70)
                      -|..++-++|+.+||.+.+
T Consensus       108 ~P~~~~ee~fl~qyKali~  126 (359)
T PF10140_consen  108 PPYELDEEDFLKQYKALII  126 (359)
T ss_dssp             S-----HHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHH
Confidence            4677899999999999876


No 35 
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=41.28  E-value=20  Score=27.61  Aligned_cols=25  Identities=40%  Similarity=0.608  Sum_probs=22.7

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       596 ~~~~fd~~~V~~QLr~~GvlE~iri  620 (691)
T cd01380         596 KPFKFEPKRVLQQLRACGVLETIRI  620 (691)
T ss_pred             CcCccCHHHHHHHHHHhchHHHHHH
Confidence            4667999999999999999999997


No 36 
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=41.24  E-value=20  Score=27.46  Aligned_cols=25  Identities=52%  Similarity=0.856  Sum_probs=22.7

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       584 ~p~~fd~~~V~~QLr~~GvlE~iri  608 (679)
T cd00124         584 KPNAFDSGKVLQQLRYLGILETIRI  608 (679)
T ss_pred             CCCccChHHHHHHHHHhchHHHHHH
Confidence            4677999999999999999999987


No 37 
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=40.96  E-value=17  Score=28.03  Aligned_cols=25  Identities=36%  Similarity=0.630  Sum_probs=22.8

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       583 ~p~~fd~~~V~~QLr~~GvlE~iri  607 (677)
T cd01383         583 LPGIYEQGLVLQQLRCCGVLEVVRI  607 (677)
T ss_pred             CcCccchhhhHHHhhhccHHHHHHH
Confidence            4678999999999999999999997


No 38 
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=40.70  E-value=21  Score=27.54  Aligned_cols=25  Identities=52%  Similarity=0.798  Sum_probs=22.7

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       582 ~~~~Fd~~~V~~QLr~~GvlE~vri  606 (677)
T cd01387         582 EPGLFEPDVVMAQLRYSGVLETVRI  606 (677)
T ss_pred             CccccChHHHHHHHHHhchHHHHHH
Confidence            4677999999999999999999997


No 39 
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=40.27  E-value=20  Score=28.08  Aligned_cols=21  Identities=33%  Similarity=0.521  Sum_probs=17.7

Q ss_pred             CCHHHHHHHHhhhhhhhhhcc
Q psy8604          49 FDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        49 ~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      ++-...+++.|++|++|++||
T Consensus       670 fd~~~V~~QLr~~GvlE~iri  690 (767)
T cd01386         670 LDIPLLRSQLRGSQILEAARL  690 (767)
T ss_pred             cCHHHHHHHHHhcccHHHHHH
Confidence            444568899999999999997


No 40 
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=39.55  E-value=21  Score=27.53  Aligned_cols=25  Identities=48%  Similarity=0.794  Sum_probs=22.6

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       574 ~~~~fd~~~V~~QLr~~Gvle~iri  598 (671)
T cd01381         574 EPMVFDRELCVRQLRYSGMMETIRI  598 (671)
T ss_pred             ccCccChHHHHHHHHhcchHHHHHH
Confidence            3667999999999999999999997


No 41 
>PTZ00014 myosin-A; Provisional
Probab=36.03  E-value=23  Score=28.06  Aligned_cols=25  Identities=20%  Similarity=0.332  Sum_probs=22.7

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-...+++.|++|++|++||
T Consensus       673 ~p~~fd~~~V~~QLr~~GvLE~iri  697 (821)
T PTZ00014        673 KPLDWNSSKVLIQLHSLSILEALQL  697 (821)
T ss_pred             CccccchHhHHHHhhhhhHHHHHHH
Confidence            4677999999999999999999997


No 42 
>PF02296 Alpha_adaptin_C:  Alpha adaptin AP2, C-terminal domain;  InterPro: IPR003164 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ]. AP (adaptor protein) complexes are found in coated vesicles and clathrin-coated pits. AP complexes connect cargo proteins and lipids to clathrin at vesicle budding sites, as well as binding accessory proteins that regulate coat assembly and disassembly (such as AP180, epsins and auxilin). There are different AP complexes in mammals. AP1 is responsible for the transport of lysosomal hydrolases between the TGN and endosomes []. AP2 associates with the plasma membrane and is responsible for endocytosis []. AP3 is responsible for protein trafficking to lysosomes and other related organelles []. AP4 is less well characterised. AP complexes are heterotetramers composed of two large subunits (adaptins), a medium subunit (mu) and a small subunit (sigma). For example, in AP1 these subunits are gamma-1-adaptin, beta-1-adaptin, mu-1 and sigma-1, while in AP2 they are alpha-adaptin, beta-2-adaptin, mu-2 and sigma-2. Each subunit has a specific function. Adaptins recognise and bind to clathrin through their hinge region (clathrin box), and recruit accessory proteins that modulate AP function through their C-terminal ear (appendage) domains. Mu recognises tyrosine-based sorting signals within the cytoplasmic domains of transmembrane cargo proteins []. One function of clathrin and AP2 complex-mediated endocytosis is to regulate the number of GABA(A) receptors available at the cell surface [].  AP adaptor alpha-adaptin can be divided into a trunk domain and the C-terminal appendage domain (or ear domain), separated by a linker region. The C-terminal appendage domain regulates translocation of endocytic accessory proteins to the bud site [].  This entry represents a subdomain of the appendage (ear) domain of alpha-adaptin from AP clathrin adaptor complexes. This domain has a three-layer arrangement, alpha-beta-alpha, with a bifurcated antiparallel beta-sheet [].  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030131 clathrin adaptor complex; PDB: 1KYF_A 1B9K_A 1QTS_A 1KYU_A 2VJ0_A 1KY6_A 1W80_A 3HS8_A 1KYD_A 1QTP_A ....
Probab=34.57  E-value=24  Score=21.00  Aligned_cols=18  Identities=11%  Similarity=0.272  Sum_probs=11.6

Q ss_pred             CCCCCHHHHHHHHhhhhh
Q psy8604          46 PNNFDIDTVQRQLRYTGM   63 (70)
Q Consensus        46 p~r~~~~~F~~ry~~~~~   63 (70)
                      |..++-++|++|.|.+|-
T Consensus         4 p~~l~~~~Ff~RWkql~~   21 (113)
T PF02296_consen    4 PTTLSSEDFFQRWKQLGG   21 (113)
T ss_dssp             E----HHHHHHHHTTT-S
T ss_pred             CccCCHHHHHHHHHhccC
Confidence            567888999999999973


No 43 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=34.01  E-value=28  Score=26.78  Aligned_cols=25  Identities=48%  Similarity=0.806  Sum_probs=22.5

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      -|..+.-....++.|++|++|++||
T Consensus       580 ~~~~Fd~~~V~~QLr~~Gvle~iri  604 (677)
T smart00242      580 KPGDFDSSLVLHQLRYLGVLETIRI  604 (677)
T ss_pred             CcccccHHHHHHHHHhcccHHHHHH
Confidence            3677999999999999999999987


No 44 
>COG4899 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.91  E-value=19  Score=22.98  Aligned_cols=14  Identities=21%  Similarity=0.273  Sum_probs=10.6

Q ss_pred             CCceeeeecCCCCC
Q psy8604           8 NPFFIRCIKSNTMK   21 (70)
Q Consensus         8 ~~hfIrCIkPN~~k   21 (70)
                      .-|||||+-|=.-+
T Consensus        48 ~r~FIr~~lpIPi~   61 (166)
T COG4899          48 KRHFIRSNLPIPID   61 (166)
T ss_pred             cceeeeecccceec
Confidence            45999999986533


No 45 
>KOG4671|consensus
Probab=30.83  E-value=18  Score=23.96  Aligned_cols=28  Identities=18%  Similarity=0.288  Sum_probs=17.7

Q ss_pred             ceeeeecCCCCCCCCCccHHHHHHHHHHh
Q psy8604          10 FFIRCIKSNTMKIPNNFDIDTVLRQLRYT   38 (70)
Q Consensus        10 hfIrCIkPN~~k~p~~fd~~~v~~Ql~~~   38 (70)
                      =|.+|.+||+ ..|..||.....+-++..
T Consensus        51 Lw~~C~~~~~-~~~~pfd~~~C~s~~~~~   78 (201)
T KOG4671|consen   51 LWWSCRKPAS-THAAPFDPGGCQSTLEVD   78 (201)
T ss_pred             eeeeecCcCC-cCCCCcCCccCcChhhcc
Confidence            5789999999 555566655444443333


No 46 
>PRK09333 30S ribosomal protein S19e; Provisional
Probab=30.66  E-value=49  Score=21.02  Aligned_cols=28  Identities=18%  Similarity=0.268  Sum_probs=18.9

Q ss_pred             CCCCCCCCCccHHHHHHHHHHhCccccC
Q psy8604          17 SNTMKIPNNFDIDTVLRQLRYTGMLKTD   44 (70)
Q Consensus        17 PN~~k~p~~fd~~~v~~Ql~~~g~le~~   44 (70)
                      |+.....+----..+++||...|++|..
T Consensus        87 P~h~~~~sg~iiR~~LqqLE~~glVek~  114 (150)
T PRK09333         87 PEHFVKGSGSIIRKILQQLEKAGLVEKT  114 (150)
T ss_pred             CCccccCccHHHHHHHHHHHHCCCeeeC
Confidence            4443333333456789999999999854


No 47 
>PF07962 Swi3:  Replication Fork Protection Component Swi3;  InterPro: IPR012923 Replication fork pausing is required to initiate recombination events. More specifically, Swi1 is required for recombination near the mat1 locus. Swi3 has been found to co-purify with Swi1. Together they define a fork protection complex that coordinates leading- and lagging-strand synthesis and stabilises stalled replication forks []. This complex is required for accurate replication, fork protection and replication checkpoint signalling [, ].; GO: 0006974 response to DNA damage stimulus, 0007049 cell cycle, 0048478 replication fork protection, 0005634 nucleus
Probab=29.75  E-value=37  Score=19.12  Aligned_cols=25  Identities=24%  Similarity=0.412  Sum_probs=20.2

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhccC
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRYY   70 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~~   70 (70)
                      || ..+|++|+++-+-+|=...|+.|
T Consensus        50 fP-k~~F~d~i~~vE~LG~~k~v~~~   74 (83)
T PF07962_consen   50 FP-KASFEDFIERVEKLGKKKRVRNY   74 (83)
T ss_pred             CC-CCCHHHHHHHHHHHcCCHHHHHH
Confidence            45 57899999999999987777654


No 48 
>KOG2690|consensus
Probab=29.50  E-value=26  Score=25.00  Aligned_cols=17  Identities=18%  Similarity=0.319  Sum_probs=14.7

Q ss_pred             CCCCCCCHHHHHHHHhh
Q psy8604          44 DIPNNFDIDTVQRQLRY   60 (70)
Q Consensus        44 ~~p~r~~~~~F~~ry~~   60 (70)
                      +-|..++|.+|+.||=|
T Consensus       200 lVP~~VshetFW~RYFy  216 (331)
T KOG2690|consen  200 LVPSEVSHETFWHRYFY  216 (331)
T ss_pred             hCcccccHHHHHHHHHH
Confidence            46999999999999854


No 49 
>COG5425 Usg protein, probable subunit of phosphoribosylanthranilate isomerase [Amino acid transport and metabolism]
Probab=28.79  E-value=31  Score=19.92  Aligned_cols=24  Identities=25%  Similarity=0.337  Sum_probs=19.2

Q ss_pred             CCCCCCHHHHHHHHhhhhhhhhhcc
Q psy8604          45 IPNNFDIDTVQRQLRYTGMLKTVRY   69 (70)
Q Consensus        45 ~p~r~~~~~F~~ry~~~~~~~~~~~   69 (70)
                      ||.-..|-+|+++ +.=|.+++||+
T Consensus        46 FP~l~~Fl~fWq~-~ldGpLHsVry   69 (90)
T COG5425          46 FPVLKGFLDFWQR-ELDGPLHSVRY   69 (90)
T ss_pred             cHHHHHHHHHHHH-hccCCceeeeh
Confidence            7788888888876 77788888874


No 50 
>COG5132 BUD31 Cell cycle control protein, G10 family [Transcription / Cell division and chromosome partitioning]
Probab=27.53  E-value=20  Score=22.27  Aligned_cols=15  Identities=27%  Similarity=0.430  Sum_probs=12.0

Q ss_pred             ceeeeecCCCCCCCC
Q psy8604          10 FFIRCIKSNTMKIPN   24 (70)
Q Consensus        10 hfIrCIkPN~~k~p~   24 (70)
                      ..+|||-|++++-.+
T Consensus       101 CCLRCIQ~~esk~Gs  115 (146)
T COG5132         101 CCLRCIQPIESKHGS  115 (146)
T ss_pred             hhHhhcCcccccCCC
Confidence            357999999998654


No 51 
>PF10260 SAYSvFN:  Uncharacterized conserved domain (SAYSvFN);  InterPro: IPR019387  This domain of approximately 75 residues contains a highly conserved SATSv/iFN motif. The function is unknown but the domain is conserved from plants to humans. 
Probab=27.51  E-value=58  Score=18.10  Aligned_cols=21  Identities=19%  Similarity=0.463  Sum_probs=17.4

Q ss_pred             cCCCCCCCCCccHHHHHHHHH
Q psy8604          16 KSNTMKIPNNFDIDTVLRQLR   36 (70)
Q Consensus        16 kPN~~k~p~~fd~~~v~~Ql~   36 (70)
                      +||-+..||.++.+.+.+|+|
T Consensus        51 N~~~~~i~Gtl~aE~~ereir   71 (71)
T PF10260_consen   51 NKGCERIPGTLTAEQFEREIR   71 (71)
T ss_pred             CCCccccCCCCCHHHHHHhhC
Confidence            677788889999888888875


No 52 
>PF08120 Toxin_32:  Tamulustoxin family;  InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=27.13  E-value=61  Score=15.27  Aligned_cols=19  Identities=16%  Similarity=0.440  Sum_probs=13.8

Q ss_pred             CceeeeecCCCCCCCCCcc
Q psy8604           9 PFFIRCIKSNTMKIPNNFD   27 (70)
Q Consensus         9 ~hfIrCIkPN~~k~p~~fd   27 (70)
                      +|||-|---.....|+.+.
T Consensus         2 chfvicttdcrrnspgtyg   20 (35)
T PF08120_consen    2 CHFVICTTDCRRNSPGTYG   20 (35)
T ss_pred             ceEEEeccccccCCCCchh
Confidence            6888887766667777654


No 53 
>PF02960 K1:  K1 glycoprotein;  InterPro: IPR004121 Current genotyping systems for Human herpesvirus 8 (HHV-8) are based on the highly variable gene encoding the K1 glycoprotein []. This entry represents the C-terminal region of the K1 glycoprotein.
Probab=26.56  E-value=23  Score=21.71  Aligned_cols=21  Identities=38%  Similarity=0.506  Sum_probs=15.6

Q ss_pred             eeeeecCCCCCCCCCccHHHHHHHHHHh
Q psy8604          11 FIRCIKSNTMKIPNNFDIDTVLRQLRYT   38 (70)
Q Consensus        11 fIrCIkPN~~k~p~~fd~~~v~~Ql~~~   38 (70)
                      |-.|.|+.++.       +.|.+||+-.
T Consensus        92 fahcqkq~dSn-------kTvpqql~dy  112 (130)
T PF02960_consen   92 FAHCQKQRDSN-------KTVPQQLRDY  112 (130)
T ss_pred             HHHhccccccc-------ccchHHHHhh
Confidence            44799998875       6688888753


No 54 
>PF01090 Ribosomal_S19e:  Ribosomal protein S19e;  InterPro: IPR001266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family includes a number of eukaryotic and archaebacterial ribosomal proteins; mammalian S19, Drosophila S19, Ascaris lumbricoides S19g (ALEP-1) and S19s, yeast YS16 (RP55A and RP55B), Aspergillus S16 and Haloarcula marismortui HS12.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_S 3U5G_T 3U5C_T 3O30_M 3O2Z_M 3IZB_S 2XZN_T 2XZM_T 2V7F_A.
Probab=25.42  E-value=22  Score=22.30  Aligned_cols=29  Identities=21%  Similarity=0.366  Sum_probs=17.7

Q ss_pred             cCCCCCCCCCccHHHHHHHHHHhCccccC
Q psy8604          16 KSNTMKIPNNFDIDTVLRQLRYTGMLKTD   44 (70)
Q Consensus        16 kPN~~k~p~~fd~~~v~~Ql~~~g~le~~   44 (70)
                      +|+.....+----..+++||...|++|..
T Consensus        85 ~p~h~~~asg~iiR~~LqqLE~~glv~k~  113 (139)
T PF01090_consen   85 RPSHFVKASGSIIRKILQQLEKAGLVEKD  113 (139)
T ss_dssp             SCCEE--CHHHHHHHHHHHHHHTTSEEEE
T ss_pred             CCCCCCCCCcHHHHHHHHHHHHCCCEEec
Confidence            34333333333345688999999998865


No 55 
>PF05912 DUF870:  Caenorhabditis elegans protein of unknown function (DUF870);  InterPro: IPR008588 This family consists of proteins of unknown function found in Caenorhabditis species.
Probab=23.62  E-value=21  Score=21.46  Aligned_cols=13  Identities=23%  Similarity=0.281  Sum_probs=9.6

Q ss_pred             eeeeecCCCCCCC
Q psy8604          11 FIRCIKSNTMKIP   23 (70)
Q Consensus        11 fIrCIkPN~~k~p   23 (70)
                      =+|||+|+.+..-
T Consensus        76 ~~~c~~p~~~~~v   88 (114)
T PF05912_consen   76 ETRCLKPKETVDV   88 (114)
T ss_pred             CEEEecCCCcEEC
Confidence            4699999975543


No 56 
>PRK10167 hypothetical protein; Provisional
Probab=21.88  E-value=42  Score=21.55  Aligned_cols=25  Identities=4%  Similarity=-0.036  Sum_probs=17.9

Q ss_pred             CCCCCHHHHHHHHhhhhhhhhhccC
Q psy8604          46 PNNFDIDTVQRQLRYTGMLKTVRYY   70 (70)
Q Consensus        46 p~r~~~~~F~~ry~~~~~~~~~~~~   70 (70)
                      +.+-...+|.+|+|++-|+++-.+|
T Consensus        28 ~t~~~Lv~Fhsr~KyllMaHsq~~y   52 (169)
T PRK10167         28 LTRGALLDYHSRYKLVFLAHSQPEY   52 (169)
T ss_pred             CCHHHHHHHHHhhhHHHHhCCHHHH
Confidence            3344466899999999998765443


No 57 
>KOG3030|consensus
Probab=21.46  E-value=31  Score=24.32  Aligned_cols=34  Identities=18%  Similarity=0.369  Sum_probs=23.4

Q ss_pred             CCCCCcee-eeecCCCCCCCCCccHHHHHHHHHHhC
Q psy8604           5 NQANPFFI-RCIKSNTMKIPNNFDIDTVLRQLRYTG   39 (70)
Q Consensus         5 ~~t~~hfI-rCIkPN~~k~p~~fd~~~v~~Ql~~~g   39 (70)
                      ..-.|||. +| +||-++.-..-|.....++..|.|
T Consensus       134 GRlRP~Fl~vC-~P~~~~~~~~~~~~~yi~~~~Ctg  168 (317)
T KOG3030|consen  134 GRLRPHFLDVC-QPDGTDGSTCSDSNLYIEDFICTG  168 (317)
T ss_pred             cCCCCCeeccc-cCCccCCCCCcccccccccceeCC
Confidence            34568887 66 888876444445566777888888


Done!