Diaphorina citri psyllid: psy8614


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MVVLVLSWVDFGYPQDNSHCGFSLGAHVAGYAGRGVQNKGFKIGRILGLDPASPLFRQLLATSLVSLNSGDAHYVDVIHSDGARHWSEGLGLFEAIGHSDYFPNGGLDQPGCEHKKNAVLVSHLEGTMNSSVVCNHIRAWKLFYESLKMSKREDGCKFFAFHCPGGLKNGSCGMMGYGSEESKARGALYLVTRDTAPYC
cHHHHHHHHHcccccccEEEEEccHHHHHHHHHccccccccEEccEECcccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccCEECcccccccccccccccccccccccEEEEEEcccccccc
MVVLVLSWVDFGYPQDNSHCGFSLGAHVAGYAGRGVQNKGFKIGRILGLDPASPLFRQLLATSLVSLNSGDAHYVDVIHSDGARHWSEGLGLFEAIGHSDYFPNGGLDQPGCEHKKNAVLVSHLEGTMNSSVVCNHIRAWKLFYESLKMSKREDGCKFFAFHCPGGLKNGSCGMMGYGSEESKARGALYLVTRDTAPYC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVLVLSWVDFGYPQDNSHCGFSLGAHVAGYAGRGVQNKGFKIGRILGLDPASPLFRQLLATSLVSLNSGDAHYVDVIHSDGARHWSEGLGLFEAIGHSDYFPNGGLDQPGCEHKKNAVLVSHLEGTMNSSVVCNHIRAWKLFYESLKMSKREDGCKFFAFHCPGGLKNGSCGMMGYGSEESKARGALYLVTRDTAPYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046503 [BP]glycerolipid catabolic processprobableGO:0044238, GO:1901575, GO:0006629, GO:0044242, GO:0009987, GO:0044710, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0008150, GO:0008152, GO:0046486, GO:0009056, GO:0044255
GO:0004620 [MF]phospholipase activityprobableGO:0016787, GO:0003674, GO:0016298, GO:0016788, GO:0003824
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0006631 [BP]fatty acid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0034370 [BP]triglyceride-rich lipoprotein particle remodelingprobableGO:0071825, GO:0071827, GO:0044707, GO:0034367, GO:0034368, GO:0034369, GO:0016043, GO:0008150, GO:0043933, GO:0032501, GO:0097006, GO:0071840, GO:0065007, GO:0050789, GO:0044699
GO:0006644 [BP]phospholipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255
GO:0006641 [BP]triglyceride metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:0006629, GO:0006639, GO:0006638, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255, GO:0046486
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0046461 [BP]neutral lipid catabolic processprobableGO:0044238, GO:1901575, GO:0009987, GO:0006629, GO:0006638, GO:0044710, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0008150, GO:0008152, GO:0044242, GO:0009056, GO:0044255
GO:0004806 [MF]triglyceride lipase activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0016298
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BU8, chain A
Confidence level:very confident
Coverage over the Query: 4-199
View the alignment between query and template
View the model in PyMOL