Query         psy8696
Match_columns 212
No_of_seqs    322 out of 1791
Neff          7.1 
Searched_HMMs 46136
Date          Fri Aug 16 16:53:50 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8696.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8696hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.6 2.8E-16 6.1E-21  133.6   0.1   75  137-211   188-262 (279)
  2 KOG2462|consensus               99.5 3.1E-15 6.7E-20  127.3   1.6   77  134-212   159-235 (279)
  3 KOG3623|consensus               99.3 1.2E-13 2.5E-18  130.0  -1.8   79  134-212   892-970 (1007)
  4 KOG3576|consensus               99.3 1.8E-13 3.9E-18  112.2  -2.1   79  133-211   114-192 (267)
  5 KOG3623|consensus               99.1 5.6E-12 1.2E-16  118.8  -0.4   79  134-212   238-329 (1007)
  6 PHA02768 hypothetical protein;  98.9 2.5E-10 5.3E-15   75.3   0.5   44  165-210     6-49  (55)
  7 KOG1074|consensus               98.8 1.4E-09   3E-14  104.2   1.1   48  164-211   353-400 (958)
  8 KOG1074|consensus               98.8   2E-09 4.2E-14  103.2   1.1   50  163-212   604-653 (958)
  9 PF13465 zf-H2C2_2:  Zinc-finge  98.6   7E-09 1.5E-13   58.5   0.0   26  179-204     1-26  (26)
 10 PHA00733 hypothetical protein   98.5 3.6E-08 7.8E-13   76.4   0.5   50  161-212    70-119 (128)
 11 KOG3576|consensus               98.2 6.1E-07 1.3E-11   74.1   2.8   52  161-212   114-165 (267)
 12 PHA00616 hypothetical protein   98.1 2.8E-07 6.1E-12   58.1  -0.9   39  164-202     1-39  (44)
 13 PHA00732 hypothetical protein   97.9 3.3E-06 7.2E-11   60.1   1.2   38  164-204     1-39  (79)
 14 KOG3608|consensus               97.9 4.4E-07 9.5E-12   80.3  -4.8   48  164-211   263-311 (467)
 15 KOG3993|consensus               97.9   1E-06 2.3E-11   79.4  -3.2   71  142-212   273-376 (500)
 16 COG5189 SFP1 Putative transcri  97.8 9.2E-06   2E-10   71.1   1.8   51  162-212   347-418 (423)
 17 KOG3608|consensus               97.6 1.8E-06 3.9E-11   76.5  -5.6   74  138-211   181-256 (467)
 18 PLN03086 PRLI-interacting fact  97.5   4E-05 8.7E-10   72.5   1.8   60  138-202   455-514 (567)
 19 PF13465 zf-H2C2_2:  Zinc-finge  97.4 8.7E-06 1.9E-10   45.7  -2.2   25  152-176     2-26  (26)
 20 PLN03086 PRLI-interacting fact  97.4 5.1E-05 1.1E-09   71.8   0.4   67  137-206   479-555 (567)
 21 PHA00733 hypothetical protein   97.3 5.3E-05 1.2E-09   58.7  -0.1   53  160-212    36-93  (128)
 22 PF00096 zf-C2H2:  Zinc finger,  97.3 3.7E-05 8.1E-10   41.4  -0.9   23  165-187     1-23  (23)
 23 PRK04860 hypothetical protein;  97.1 0.00017 3.6E-09   58.0   0.7   41  163-207   118-158 (160)
 24 PHA02768 hypothetical protein;  96.9 0.00018   4E-09   47.5  -0.4   44  136-181     5-48  (55)
 25 PF05605 zf-Di19:  Drought indu  96.8 0.00029 6.2E-09   46.3  -0.3   45  164-211     2-48  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  96.6 0.00027 5.9E-09   37.9  -1.0   20  193-212     1-20  (23)
 27 PF13912 zf-C2H2_6:  C2H2-type   96.6 0.00051 1.1E-08   38.3   0.0   25  164-188     1-25  (27)
 28 PF13894 zf-C2H2_4:  C2H2-type   96.5 0.00041 8.9E-09   37.0  -0.7   23  165-187     1-23  (24)
 29 PF12756 zf-C2H2_2:  C2H2 type   96.4 0.00074 1.6E-08   48.6  -0.5   21  192-212    50-70  (100)
 30 PF13912 zf-C2H2_6:  C2H2-type   95.9  0.0013 2.9E-08   36.6  -0.9   21  192-212     1-21  (27)
 31 PF13894 zf-C2H2_4:  C2H2-type   95.8  0.0015 3.2E-08   34.7  -0.8   20  193-212     1-20  (24)
 32 smart00355 ZnF_C2H2 zinc finge  95.8  0.0022 4.9E-08   34.4  -0.2   24  165-188     1-24  (26)
 33 PF09237 GAGA:  GAGA factor;  I  95.5  0.0044 9.5E-08   40.3   0.4   33  160-192    20-52  (54)
 34 PHA00616 hypothetical protein   95.2   0.003 6.5E-08   39.9  -1.2   21  192-212     1-21  (44)
 35 COG5048 FOG: Zn-finger [Genera  94.6   0.024 5.2E-07   50.0   2.6   49  163-211   288-342 (467)
 36 KOG3993|consensus               94.5  0.0076 1.6E-07   54.9  -0.8   49  164-212   267-315 (500)
 37 smart00355 ZnF_C2H2 zinc finge  94.1    0.01 2.2E-07   31.7  -0.5   20  193-212     1-20  (26)
 38 PF12874 zf-met:  Zinc-finger o  94.1   0.011 2.3E-07   32.2  -0.5   23  165-187     1-23  (25)
 39 PF12171 zf-C2H2_jaz:  Zinc-fin  93.9   0.028   6E-07   31.3   1.0   20  193-212     2-21  (27)
 40 PHA00732 hypothetical protein   93.8   0.032   7E-07   39.6   1.3   47  137-189     2-49  (79)
 41 PF12171 zf-C2H2_jaz:  Zinc-fin  93.7   0.024 5.2E-07   31.6   0.5   22  165-186     2-23  (27)
 42 PF12874 zf-met:  Zinc-finger o  92.7   0.025 5.4E-07   30.7  -0.4   19  193-211     1-19  (25)
 43 KOG2461|consensus               92.1    0.15 3.2E-06   46.7   3.4   29   41-69    127-155 (396)
 44 PF09237 GAGA:  GAGA factor;  I  92.0   0.042 9.1E-07   35.7  -0.1   25  188-212    20-44  (54)
 45 PF13909 zf-H2C2_5:  C2H2-type   91.4   0.029 6.2E-07   30.2  -1.2   23  165-188     1-23  (24)
 46 PF05605 zf-Di19:  Drought indu  91.1   0.042 9.2E-07   35.8  -0.8   50  136-188     2-53  (54)
 47 COG5048 FOG: Zn-finger [Genera  88.9    0.55 1.2E-05   41.3   4.2   67  136-202   289-363 (467)
 48 KOG1146|consensus               88.7    0.55 1.2E-05   48.5   4.4   53  160-212   461-538 (1406)
 49 smart00451 ZnF_U1 U1-like zinc  88.5    0.13 2.9E-06   29.9  -0.0   20  192-211     3-22  (35)
 50 cd00350 rubredoxin_like Rubred  88.0    0.29 6.4E-06   28.7   1.2   24  165-200     2-25  (33)
 51 COG5189 SFP1 Putative transcri  87.8    0.28   6E-06   43.6   1.5   25  161-185   395-419 (423)
 52 PF13913 zf-C2HC_2:  zinc-finge  87.3    0.15 3.2E-06   28.1  -0.3   21  165-186     3-23  (25)
 53 KOG4124|consensus               84.9     1.5 3.2E-05   39.6   4.5   52  161-212   346-418 (442)
 54 smart00451 ZnF_U1 U1-like zinc  83.0    0.36 7.9E-06   28.0  -0.1   23  164-186     3-25  (35)
 55 PF09538 FYDLN_acid:  Protein o  82.4    0.83 1.8E-05   34.4   1.6   30  165-205    10-39  (108)
 56 TIGR02605 CxxC_CxxC_SSSS putat  77.5     1.2 2.7E-05   28.4   1.1   30  164-200     5-34  (52)
 57 cd00729 rubredoxin_SM Rubredox  76.9     1.5 3.2E-05   25.9   1.2   25  164-200     2-26  (34)
 58 COG1997 RPL43A Ribosomal prote  76.8     1.7 3.6E-05   31.4   1.6   32  163-204    34-65  (89)
 59 PRK04860 hypothetical protein;  76.6    0.51 1.1E-05   37.9  -1.1   40  135-178   118-157 (160)
 60 PF12756 zf-C2H2_2:  C2H2 type   76.4    0.69 1.5E-05   32.8  -0.4   24  164-187    50-73  (100)
 61 smart00531 TFIIE Transcription  76.0     1.4   3E-05   34.6   1.2   41  160-204    95-135 (147)
 62 PF14353 CpXC:  CpXC protein     76.0    0.93   2E-05   34.6   0.2   14  192-205    38-51  (128)
 63 smart00834 CxxC_CXXC_SSSS Puta  75.5     1.6 3.4E-05   26.2   1.1   32  164-202     5-36  (41)
 64 TIGR02300 FYDLN_acid conserved  75.4     2.2 4.7E-05   33.0   2.1   30  165-205    10-39  (129)
 65 TIGR02098 MJ0042_CXXC MJ0042 f  75.2     1.8 3.9E-05   25.8   1.3   34  165-203     3-36  (38)
 66 COG4049 Uncharacterized protei  74.9    0.75 1.6E-05   30.5  -0.5   31  157-187    10-40  (65)
 67 COG1592 Rubrerythrin [Energy p  74.3     1.8 3.9E-05   35.0   1.5   23  164-199   134-156 (166)
 68 PRK09678 DNA-binding transcrip  74.2     1.3 2.8E-05   30.9   0.5   19  162-180    25-45  (72)
 69 PF13717 zinc_ribbon_4:  zinc-r  72.8     2.5 5.5E-05   25.2   1.5   34  165-203     3-36  (36)
 70 PRK00398 rpoP DNA-directed RNA  72.7     2.1 4.6E-05   26.8   1.2   30  164-203     3-32  (46)
 71 COG2888 Predicted Zn-ribbon RN  70.2     2.4 5.1E-05   28.5   1.0   32  164-200    27-58  (61)
 72 PF13719 zinc_ribbon_5:  zinc-r  69.5     3.1 6.8E-05   24.9   1.4   34  165-203     3-36  (37)
 73 PF05191 ADK_lid:  Adenylate ki  69.5     2.6 5.7E-05   25.3   1.1   33  165-205     2-34  (36)
 74 PRK09979 putative rho operon l  67.8       3 6.6E-05   23.7   1.0   26   24-49      2-27  (33)
 75 PF09723 Zn-ribbon_8:  Zinc rib  67.4     3.3 7.2E-05   25.5   1.3   30  164-200     5-34  (42)
 76 COG4049 Uncharacterized protei  66.7     1.2 2.6E-05   29.6  -0.9   27  185-211    10-36  (65)
 77 smart00659 RPOLCX RNA polymera  66.5     4.2 9.2E-05   25.5   1.6   26  165-201     3-28  (44)
 78 PRK06266 transcription initiat  65.8       3 6.5E-05   34.0   1.1   36  160-204   113-148 (178)
 79 TIGR00373 conserved hypothetic  64.4       3 6.4E-05   33.3   0.8   36  160-204   105-140 (158)
 80 PHA00626 hypothetical protein   61.9     6.8 0.00015   26.0   1.9   14  163-176    22-35  (59)
 81 PF02892 zf-BED:  BED zinc fing  60.1     2.9 6.2E-05   25.7  -0.0   24  161-184    13-40  (45)
 82 COG1996 RPC10 DNA-directed RNA  59.7     5.4 0.00012   25.7   1.2   29  163-201     5-33  (49)
 83 COG1655 Uncharacterized protei  59.3     4.3 9.3E-05   34.6   0.9   39  162-200    17-70  (267)
 84 smart00440 ZnF_C2C2 C2C2 Zinc   59.3     6.1 0.00013   24.1   1.3   12  192-203    28-39  (40)
 85 PF05443 ROS_MUCR:  ROS/MUCR tr  58.0     3.5 7.5E-05   32.1   0.1   28  162-192    70-97  (132)
 86 smart00614 ZnF_BED BED zinc fi  56.5     3.7 8.1E-05   26.1   0.0   25  163-187    17-47  (50)
 87 PTZ00255 60S ribosomal protein  56.0     6.1 0.00013   28.7   1.1   32  163-204    35-66  (90)
 88 COG4530 Uncharacterized protei  55.7     5.7 0.00012   30.0   0.9   28  166-204    11-38  (129)
 89 TIGR00280 L37a ribosomal prote  55.5     5.6 0.00012   29.0   0.8   32  163-204    34-65  (91)
 90 PRK14890 putative Zn-ribbon RN  54.0     7.6 0.00016   26.0   1.2   32  164-200    25-56  (59)
 91 PF01096 TFIIS_C:  Transcriptio  53.6     4.9 0.00011   24.4   0.2   10  193-202    29-38  (39)
 92 KOG2593|consensus               53.3     3.9 8.5E-05   37.8  -0.4   44  155-201   119-162 (436)
 93 COG4888 Uncharacterized Zn rib  52.8      12 0.00026   27.8   2.2   39  161-203    19-57  (104)
 94 PF01780 Ribosomal_L37ae:  Ribo  52.4     6.3 0.00014   28.7   0.7   31  163-203    34-64  (90)
 95 PF03604 DNA_RNApol_7kD:  DNA d  52.1      10 0.00023   22.1   1.5   27  165-202     1-27  (32)
 96 PRK03824 hypA hydrogenase nick  52.1     8.3 0.00018   29.9   1.4   39  163-201    69-116 (135)
 97 PRK03976 rpl37ae 50S ribosomal  51.1     8.5 0.00018   28.0   1.2   32  163-204    35-66  (90)
 98 PF10263 SprT-like:  SprT-like   51.0     7.2 0.00016   30.3   0.9   34  162-203   121-154 (157)
 99 COG1198 PriA Primosomal protei  51.0      13 0.00028   36.9   2.8   22  180-201   463-484 (730)
100 PF01363 FYVE:  FYVE zinc finge  50.3     8.8 0.00019   25.7   1.1   27  165-203    10-36  (69)
101 KOG2785|consensus               49.3     4.4 9.6E-05   36.8  -0.6   51  162-212   164-240 (390)
102 PF04959 ARS2:  Arsenite-resist  48.4     2.4 5.1E-05   35.7  -2.4   28  162-189    75-102 (214)
103 PRK00464 nrdR transcriptional   46.5      15 0.00032   29.3   2.0   16  165-180    29-44  (154)
104 PF12760 Zn_Tnp_IS1595:  Transp  46.0      15 0.00032   22.9   1.6   27  165-200    19-45  (46)
105 PF05129 Elf1:  Transcription e  45.7     9.1  0.0002   27.2   0.6   40  162-205    20-59  (81)
106 COG4957 Predicted transcriptio  44.8      11 0.00024   29.5   1.0   25  165-192    77-101 (148)
107 cd00730 rubredoxin Rubredoxin;  44.2      15 0.00032   23.7   1.4   35  165-200     2-42  (50)
108 PF11494 Ta0938:  Ta0938;  Inte  43.5      17 0.00036   26.8   1.7   39  161-205    11-50  (105)
109 COG1571 Predicted DNA-binding   43.3      14 0.00031   34.1   1.7   31  165-206   351-381 (421)
110 PF08790 zf-LYAR:  LYAR-type C2  42.8      12 0.00026   21.3   0.7   20  165-185     1-20  (28)
111 PF00301 Rubredoxin:  Rubredoxi  42.3      21 0.00046   22.7   1.9   36  165-201     2-43  (47)
112 KOG1146|consensus               42.2     8.1 0.00018   40.4  -0.1   73  135-212  1259-1348(1406)
113 PRK12496 hypothetical protein;  41.5      14  0.0003   29.7   1.1   31  163-205   126-156 (164)
114 TIGR01206 lysW lysine biosynth  41.4      16 0.00035   23.9   1.3   31  165-203     3-33  (54)
115 PF03811 Zn_Tnp_IS1:  InsA N-te  41.0      21 0.00045   21.4   1.6   30  165-198     6-35  (36)
116 PF11672 DUF3268:  Protein of u  40.7      22 0.00048   26.4   2.1   12  163-174     1-12  (102)
117 cd00065 FYVE FYVE domain; Zinc  40.1      19 0.00041   22.9   1.5   10  165-174    19-28  (57)
118 COG3091 SprT Zn-dependent meta  39.5      17 0.00038   29.0   1.4   36  162-202   115-150 (156)
119 COG3677 Transposase and inacti  39.5      18 0.00039   27.9   1.5   17  162-178    51-67  (129)
120 smart00731 SprT SprT homologue  39.2      18 0.00038   28.2   1.4   34  163-203   111-144 (146)
121 smart00064 FYVE Protein presen  38.6      19 0.00042   23.9   1.4    9  167-175    13-21  (68)
122 PF07941 K_channel_TID:  Potass  38.5     9.5 0.00021   26.0  -0.2   11   49-59     12-22  (75)
123 PF01927 Mut7-C:  Mut7-C RNAse   38.4      20 0.00043   28.0   1.6   19  191-209   123-141 (147)
124 PHA02998 RNA polymerase subuni  38.2      21 0.00045   29.3   1.7   37  164-204   143-183 (195)
125 COG3364 Zn-ribbon containing p  38.0      15 0.00032   27.4   0.7   15  164-178     2-16  (112)
126 KOG4167|consensus               37.9     5.5 0.00012   39.2  -1.9   27  162-188   790-816 (907)
127 smart00734 ZnF_Rad18 Rad18-lik  37.1      11 0.00024   20.8  -0.0    9  194-202     3-11  (26)
128 TIGR00100 hypA hydrogenase nic  34.8      19 0.00042   27.1   1.0   27  163-201    69-95  (115)
129 PF02176 zf-TRAF:  TRAF-type zi  34.3      14 0.00029   23.9   0.0   43  162-205     7-55  (60)
130 cd00924 Cyt_c_Oxidase_Vb Cytoc  34.2      21 0.00046   26.3   1.0   21  183-204    71-91  (97)
131 PF01286 XPA_N:  XPA protein N-  34.1      19  0.0004   21.4   0.6   16  165-180     4-19  (34)
132 PF09332 Mcm10:  Mcm10 replicat  33.8      10 0.00022   34.3  -0.9   42  163-204   251-297 (344)
133 PRK12380 hydrogenase nickel in  33.8      21 0.00045   26.8   1.0   26  163-200    69-94  (113)
134 PF07282 OrfB_Zn_ribbon:  Putat  33.8      28 0.00061   23.2   1.6   14  190-203    44-57  (69)
135 KOG3214|consensus               33.5      24 0.00052   26.2   1.2   41  161-205    20-60  (109)
136 PRK05978 hypothetical protein;  33.4      26 0.00056   27.8   1.5   32  165-205    34-65  (148)
137 PF10013 DUF2256:  Uncharacteri  33.3      20 0.00044   22.3   0.7   16  166-181    10-25  (42)
138 COG3357 Predicted transcriptio  33.2      24 0.00052   25.8   1.1   29  162-200    56-84  (97)
139 PF04959 ARS2:  Arsenite-resist  32.3      16 0.00034   30.8   0.1   24  188-211    73-96  (214)
140 PRK04351 hypothetical protein;  32.2      25 0.00054   27.8   1.2   35  163-205   111-145 (149)
141 smart00154 ZnF_AN1 AN1-like Zi  30.8      27 0.00059   21.1   1.0   14  192-205    12-25  (39)
142 PF08274 PhnA_Zn_Ribbon:  PhnA   30.8      25 0.00055   20.2   0.8   25  166-201     4-28  (30)
143 PRK03681 hypA hydrogenase nick  29.4      26 0.00056   26.3   0.9   28  163-201    69-96  (114)
144 PF12013 DUF3505:  Protein of u  29.2      16 0.00035   26.9  -0.3   25  165-189    81-109 (109)
145 COG1327 Predicted transcriptio  29.0      35 0.00077   27.2   1.6   19  163-181    27-45  (156)
146 COG5236 Uncharacterized conser  28.9      13 0.00027   33.7  -1.0   22  166-187   222-243 (493)
147 PRK00564 hypA hydrogenase nick  28.5      28  0.0006   26.3   0.9   28  163-201    70-97  (117)
148 PF14446 Prok-RING_1:  Prokaryo  28.5      39 0.00085   22.2   1.5   15  165-179     6-20  (54)
149 PF04810 zf-Sec23_Sec24:  Sec23  28.2      37  0.0008   20.5   1.3   32  165-202     3-34  (40)
150 KOG4173|consensus               28.0     6.1 0.00013   33.2  -3.0   46  166-211   108-165 (253)
151 PF13240 zinc_ribbon_2:  zinc-r  27.7      34 0.00074   18.2   0.9    6  195-200    16-21  (23)
152 PF09082 DUF1922:  Domain of un  27.4      27 0.00059   24.0   0.6   15  186-201    14-28  (68)
153 PTZ00303 phosphatidylinositol   27.1      41 0.00089   33.9   1.9   12  165-176   461-472 (1374)
154 PF15135 UPF0515:  Uncharacteri  26.8      42 0.00091   29.0   1.8   14  191-204   154-167 (278)
155 smart00661 RPOL9 RNA polymeras  26.6      50  0.0011   20.5   1.7   12  164-175    20-31  (52)
156 COG1594 RPB9 DNA-directed RNA   26.2      36 0.00078   25.6   1.2   39  165-203    73-111 (113)
157 smart00132 LIM Zinc-binding do  26.2      53  0.0011   18.5   1.7   11  192-202    27-37  (39)
158 PLN02294 cytochrome c oxidase   25.9      42 0.00091   27.3   1.5   22  183-205   133-154 (174)
159 COG1656 Uncharacterized conser  25.7      38 0.00083   27.4   1.3   17  192-208   130-146 (165)
160 TIGR00244 transcriptional regu  25.0      52  0.0011   26.1   1.9   19  164-182    28-46  (147)
161 PF01155 HypA:  Hydrogenase exp  24.9      28 0.00061   26.0   0.4   26  164-201    70-95  (113)
162 KOG0978|consensus               24.5      23 0.00049   35.0  -0.3   21  191-211   677-697 (698)
163 PF01428 zf-AN1:  AN1-like Zinc  24.5      29 0.00062   21.3   0.3   15  191-205    12-26  (43)
164 PF08271 TF_Zn_Ribbon:  TFIIB z  23.9      47   0.001   20.2   1.2   28  165-201     1-28  (43)
165 KOG0402|consensus               23.8      32 0.00068   24.7   0.4   29  165-203    37-65  (92)
166 KOG4173|consensus               23.8      15 0.00033   30.9  -1.4   46  163-211    78-125 (253)
167 PF10571 UPF0547:  Uncharacteri  23.6      43 0.00093   18.5   0.8   10  194-203    16-25  (26)
168 KOG1280|consensus               23.5      46 0.00099   30.1   1.4   39  161-199    76-116 (381)
169 PF07754 DUF1610:  Domain of un  23.4      42 0.00092   18.3   0.8    8  192-199    16-23  (24)
170 COG4391 Uncharacterized protei  23.2      58  0.0013   22.0   1.6   42  158-203    18-59  (62)
171 PRK05452 anaerobic nitric oxid  22.9      56  0.0012   30.7   2.0   40  161-201   422-467 (479)
172 KOG4167|consensus               22.8 1.5E+02  0.0033   29.6   4.9   73  133-205   285-361 (907)
173 PF13451 zf-trcl:  Probable zin  22.6      40 0.00088   21.7   0.7   15  190-204     2-16  (49)
174 PF10083 DUF2321:  Uncharacteri  22.5      49  0.0011   26.5   1.3   17  189-205    65-81  (158)
175 KOG2482|consensus               21.8      28  0.0006   31.5  -0.2   23  164-186   195-217 (423)
176 PF04606 Ogr_Delta:  Ogr/Delta-  21.7      35 0.00077   21.3   0.3   37  167-205     2-40  (47)
177 PF08394 Arc_trans_TRASH:  Arch  21.6      18 0.00038   21.9  -1.1   35  167-204     1-35  (37)
178 PRK00762 hypA hydrogenase nick  21.6      49  0.0011   25.2   1.1   32  163-200    69-100 (124)
179 PRK00432 30S ribosomal protein  21.4      64  0.0014   20.6   1.5   27  166-203    22-48  (50)
180 PF10276 zf-CHCC:  Zinc-finger   21.4      44 0.00096   20.5   0.7   12  191-202    28-39  (40)
181 COG1779 C4-type Zn-finger prot  21.3      54  0.0012   27.3   1.4   37  165-203    15-54  (201)
182 TIGR01385 TFSII transcription   21.2      56  0.0012   28.9   1.6   39  163-203   257-297 (299)
183 TIGR03831 YgiT_finger YgiT-typ  20.8      71  0.0015   19.0   1.6   13  191-203    31-43  (46)
184 PRK14873 primosome assembly pr  20.6      63  0.0014   31.8   1.9   11  191-201   421-431 (665)
185 KOG2071|consensus               20.5      40 0.00087   32.5   0.5   28  161-188   415-442 (579)
186 PF15269 zf-C2H2_7:  Zinc-finge  20.4      44 0.00096   21.2   0.5   23  164-186    20-42  (54)
187 TIGR01384 TFS_arch transcripti  20.4      57  0.0012   23.6   1.2   41  164-204    62-102 (104)
188 PRK14892 putative transcriptio  20.4      80  0.0017   23.3   2.0   36  162-204    19-54  (99)
189 COG1773 Rubredoxin [Energy pro  20.1      45 0.00098   22.0   0.5   11  192-202     3-13  (55)

No 1  
>KOG2462|consensus
Probab=99.57  E-value=2.8e-16  Score=133.64  Aligned_cols=75  Identities=28%  Similarity=0.475  Sum_probs=57.1

Q ss_pred             CCCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccC
Q psy8696         137 FPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       137 ~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      +.|..|.+.|.+...|+.|.|+|+++|||.|..|+|.|..+++|+.|+++|.+.|+|+|..|+|+|.+++.|.+|
T Consensus       188 c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             cccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHh
Confidence            345555556666667777788888888888888888888888888888888888888888888888888877777


No 2  
>KOG2462|consensus
Probab=99.51  E-value=3.1e-15  Score=127.33  Aligned_cols=77  Identities=31%  Similarity=0.555  Sum_probs=70.9

Q ss_pred             CCCCCCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         134 SSLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       134 s~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      .+.+.|..|...+...-.++.|.|+|+  -+++|.+|||.|.+.+-|+.|+|+|||||||.|..|+|.|..++||+-|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHH
Confidence            567888888888888888899999886  57999999999999999999999999999999999999999999999885


No 3  
>KOG3623|consensus
Probab=99.32  E-value=1.2e-13  Score=129.97  Aligned_cols=79  Identities=20%  Similarity=0.494  Sum_probs=74.7

Q ss_pred             CCCCCCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         134 SSLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       134 s~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ...|.|..|.+.|.....|.+|..-|++++||+|.+|.|.|+.+.+|..|+|.|.|||||+|+.|+|.|.+...+..||
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            4468888999999999999999999999999999999999999999999999999999999999999999999888876


No 4  
>KOG3576|consensus
Probab=99.29  E-value=1.8e-13  Score=112.23  Aligned_cols=79  Identities=30%  Similarity=0.617  Sum_probs=74.3

Q ss_pred             CCCCCCCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccC
Q psy8696         133 SSSLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       133 ~s~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      ...+|.|..|...|.-++.+.+|.+.|...|.|-|..|||.|.....|++|+|+|+|.+||+|..|+|.|+++..|..|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            3567899999999999999999999999999999999999999999999999999999999999999999999888655


No 5  
>KOG3623|consensus
Probab=99.14  E-value=5.6e-12  Score=118.80  Aligned_cols=79  Identities=23%  Similarity=0.415  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCccccccccccCCCCCCC-------------CCCccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         134 SSLFPGTSSTHSHLDRRLLRAPGRASR-------------PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       134 s~~~~~~~~~~~~~~~~~l~~h~~~h~-------------~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      ...|+|..|...|..+..|.+|+..|.             ..+.|+|..|+|.|+.+.+|+.|+|||.|||||.|+.|+|
T Consensus       238 e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkK  317 (1007)
T KOG3623|consen  238 EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKK  317 (1007)
T ss_pred             CCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCccccc
Confidence            345788889888888888777765552             2356999999999999999999999999999999999999


Q ss_pred             cccCcchhccCC
Q psy8696         201 AFRRQDHLRDHR  212 (212)
Q Consensus       201 ~F~~~~~L~~Hr  212 (212)
                      .|.+...+..|+
T Consensus       318 RFSHSGSySSHm  329 (1007)
T KOG3623|consen  318 RFSHSGSYSSHM  329 (1007)
T ss_pred             ccccCCcccccc
Confidence            999999888775


No 6  
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=2.5e-10  Score=75.35  Aligned_cols=44  Identities=18%  Similarity=0.444  Sum_probs=41.3

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCcchhcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRD  210 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~  210 (212)
                      |+|+.||+.|....+|.+|+++|+  ++|+|..|+|.|.+.+.|..
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~~   49 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYIE   49 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeEE
Confidence            899999999999999999999998  79999999999999888753


No 7  
>KOG1074|consensus
Probab=98.79  E-value=1.4e-09  Score=104.16  Aligned_cols=48  Identities=40%  Similarity=0.951  Sum_probs=46.3

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCccccCcchhccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      .++|.+|.|.|...+.|++|+|.||||+||+|.+||..|.++.+|+.|
T Consensus       353 khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH  400 (958)
T KOG1074|consen  353 KHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVH  400 (958)
T ss_pred             cchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeee
Confidence            478999999999999999999999999999999999999999999987


No 8  
>KOG1074|consensus
Probab=98.76  E-value=2e-09  Score=103.19  Aligned_cols=50  Identities=40%  Similarity=0.804  Sum_probs=46.9

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      .+.+|-+|-++...++.|+.|.|+|+|||||+|++||+.|.++.+|+.|+
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~  653 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM  653 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc
Confidence            45789999999999999999999999999999999999999999999985


No 9  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.61  E-value=7e-09  Score=58.46  Aligned_cols=26  Identities=58%  Similarity=1.081  Sum_probs=23.8

Q ss_pred             cccccccccCCCcceeCCccCccccC
Q psy8696         179 NLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       179 ~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      +|.+|+++|+|+|||.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999999974


No 10 
>PHA00733 hypothetical protein
Probab=98.47  E-value=3.6e-08  Score=76.43  Aligned_cols=50  Identities=34%  Similarity=0.674  Sum_probs=45.6

Q ss_pred             CCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ..++|.|..|++.|.....|..|++.|  +++|.|.+|++.|.+...|.+|+
T Consensus        70 ~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~  119 (128)
T PHA00733         70 AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHV  119 (128)
T ss_pred             CCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHH
Confidence            478899999999999999999999987  46799999999999999998874


No 11 
>KOG3576|consensus
Probab=98.25  E-value=6.1e-07  Score=74.09  Aligned_cols=52  Identities=29%  Similarity=0.638  Sum_probs=48.6

Q ss_pred             CCCccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      +...|.|.+|+|.|.....|.+|++.|...|.|-|..|||.|...-+|++|.
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~  165 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHT  165 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhh
Confidence            4566999999999999999999999999999999999999999999999984


No 12 
>PHA00616 hypothetical protein
Probab=98.14  E-value=2.8e-07  Score=58.09  Aligned_cols=39  Identities=15%  Similarity=0.260  Sum_probs=34.5

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      +|+|..||+.|.++..|.+|++.|+|++++.|+.---.|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeEEEEEE
Confidence            589999999999999999999999999999998643333


No 13 
>PHA00732 hypothetical protein
Probab=97.93  E-value=3.3e-06  Score=60.09  Aligned_cols=38  Identities=34%  Similarity=0.727  Sum_probs=33.3

Q ss_pred             ccccccccccccccccccccccc-cCCCcceeCCccCccccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT-HTDERPYSCDICGKAFRR  204 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~-Htgekpf~C~~Cgk~F~~  204 (212)
                      +|.|..|++.|.....|++|++. |.+   +.|+.|++.|.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC
Confidence            48899999999999999999984 653   589999999984


No 14 
>KOG3608|consensus
Probab=97.89  E-value=4.4e-07  Score=80.26  Aligned_cols=48  Identities=27%  Similarity=0.693  Sum_probs=36.7

Q ss_pred             ccccccccccccccccccccccc-cCCCcceeCCccCccccCcchhccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT-HTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~-Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      .|+|+.|..+....+.|.+|++. |...|||+|+.|++.|.+..+|.+|
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHH
Confidence            35666666666666666667654 6678999999999999999999887


No 15 
>KOG3993|consensus
Probab=97.85  E-value=1e-06  Score=79.37  Aligned_cols=71  Identities=31%  Similarity=0.505  Sum_probs=53.3

Q ss_pred             CCccccccccccCCCCCCCCCCccccccccccccccccccccccccC--------CC-----------------------
Q psy8696         142 STHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHT--------DE-----------------------  190 (212)
Q Consensus       142 ~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Ht--------ge-----------------------  190 (212)
                      |-..+.+.-.|..|.-...-..-|+|..|+|.|....+|..|.|+|.        +.                       
T Consensus       273 CK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~ds  352 (500)
T KOG3993|consen  273 CKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDS  352 (500)
T ss_pred             HHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcc
Confidence            33333344445555544444456999999999999999999999994        11                       


Q ss_pred             --cceeCCccCccccCcchhccCC
Q psy8696         191 --RPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       191 --kpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                        ..|.|.+|+|.|++...|++|+
T Consensus       353 s~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  353 SSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             cCceeecHHhhhhhHHHHHHHHhH
Confidence              2488999999999999999984


No 16 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.79  E-value=9.2e-06  Score=71.10  Aligned_cols=51  Identities=29%  Similarity=0.813  Sum_probs=43.8

Q ss_pred             CCcccccc--ccccccccccccccccc-c------------------CCCcceeCCccCccccCcchhccCC
Q psy8696         162 KKQFICKF--CNRQFTKSYNLLIHERT-H------------------TDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       162 ~k~~~C~~--C~k~F~~~~~L~~H~r~-H------------------tgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      +|+|+|++  |.|.|+....|+-|+.- |                  ...|||+|++|+|.++....|+-||
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            59999987  99999999999988642 2                  1349999999999999999999886


No 17 
>KOG3608|consensus
Probab=97.59  E-value=1.8e-06  Score=76.47  Aligned_cols=74  Identities=24%  Similarity=0.401  Sum_probs=63.7

Q ss_pred             CCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccC--CCcceeCCccCccccCcchhccC
Q psy8696         138 PGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHT--DERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       138 ~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Ht--gekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      ....|....-++..|++|.++|.++|...|+.||..|.++..|..|.+..+  ...+|.|..|.|.|.+...|+.|
T Consensus       181 ~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~H  256 (467)
T KOG3608|consen  181 NWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSH  256 (467)
T ss_pred             cchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHH
Confidence            345678888899999999999999999999999999999999999987654  34589999999999888777766


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.51  E-value=4e-05  Score=72.45  Aligned_cols=60  Identities=12%  Similarity=0.308  Sum_probs=31.4

Q ss_pred             CCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         138 PGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       138 ~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      .|..|...+. ...+..|.+.++  +++.|. |++.+ .+..|..|+++|..+|++.|.+|++.|
T Consensus       455 ~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v  514 (567)
T PLN03086        455 HCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMV  514 (567)
T ss_pred             cCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCcc
Confidence            4555555443 233444444432  455565 65433 345555666556666666666666555


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=97.44  E-value=8.7e-06  Score=45.67  Aligned_cols=25  Identities=28%  Similarity=0.721  Sum_probs=21.3

Q ss_pred             ccCCCCCCCCCCccccccccccccc
Q psy8696         152 LRAPGRASRPKKQFICKFCNRQFTK  176 (212)
Q Consensus       152 l~~h~~~h~~~k~~~C~~C~k~F~~  176 (212)
                      +..|.++|+++++|.|++|++.|.+
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            4457788999999999999999963


No 20 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=97.35  E-value=5.1e-05  Score=71.76  Aligned_cols=67  Identities=18%  Similarity=0.409  Sum_probs=48.7

Q ss_pred             CCCCCCCccccccccccCCCCCCCCCCccccccccccccc----------cccccccccccCCCcceeCCccCccccCcc
Q psy8696         137 FPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTK----------SYNLLIHERTHTDERPYSCDICGKAFRRQD  206 (212)
Q Consensus       137 ~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~----------~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~  206 (212)
                      +.|. |.. ...+..+..|.+.|.+++++.|.+|++.|..          ...|..|+.++ |.+++.|..|++.|..++
T Consensus       479 v~Cp-Cg~-~~~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlrd  555 (567)
T PLN03086        479 LQCP-CGV-VLEKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLKE  555 (567)
T ss_pred             ccCC-CCC-CcchhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeehh
Confidence            3565 664 3455677778777888888888888888742          34678887775 888888888888887654


No 21 
>PHA00733 hypothetical protein
Probab=97.30  E-value=5.3e-05  Score=58.70  Aligned_cols=53  Identities=21%  Similarity=0.278  Sum_probs=41.6

Q ss_pred             CCCCcccccccccccccccccccc--c---cccCCCcceeCCccCccccCcchhccCC
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIH--E---RTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H--~---r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ...+++.|.+|.+.|.....|..+  +   ..+.+++||.|+.|++.|.....|..|+
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~   93 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHI   93 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHH
Confidence            346789999999988877666554  1   1234588999999999999999998774


No 22 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.27  E-value=3.7e-05  Score=41.40  Aligned_cols=23  Identities=35%  Similarity=0.787  Sum_probs=17.5

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      |+|..|++.|..+..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56888888888888888887654


No 23 
>PRK04860 hypothetical protein; Provisional
Probab=97.09  E-value=0.00017  Score=58.05  Aligned_cols=41  Identities=24%  Similarity=0.576  Sum_probs=36.1

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccCcch
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDH  207 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~  207 (212)
                      -+|.|. |++   ....+.+|.++|+++++|.|..|++.|.....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~~  158 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEecc
Confidence            469998 997   77789999999999999999999999986654


No 24 
>PHA02768 hypothetical protein; Provisional
Probab=96.91  E-value=0.00018  Score=47.50  Aligned_cols=44  Identities=9%  Similarity=0.089  Sum_probs=39.8

Q ss_pred             CCCCCCCCccccccccccCCCCCCCCCCcccccccccccccccccc
Q psy8696         136 LFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLL  181 (212)
Q Consensus       136 ~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~  181 (212)
                      .|.|..|...+.....+..|.++|.  ++|+|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            3789999999999999999999998  6899999999999888775


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=96.78  E-value=0.00029  Score=46.30  Aligned_cols=45  Identities=27%  Similarity=0.620  Sum_probs=33.6

Q ss_pred             ccccccccccccccccccccccc-cCCC-cceeCCccCccccCcchhccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT-HTDE-RPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~-Htge-kpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      .|.|++|++. .....|..|... |..+ +.+.|++|...+..  +|.+|
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~H   48 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRH   48 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHH
Confidence            4899999994 556789999655 5544 57999999986553  66655


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=96.63  E-value=0.00027  Score=37.93  Aligned_cols=20  Identities=45%  Similarity=1.092  Sum_probs=18.6

Q ss_pred             eeCCccCccccCcchhccCC
Q psy8696         193 YSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       193 f~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      |+|+.|++.|.++..|++|+
T Consensus         1 y~C~~C~~~f~~~~~l~~H~   20 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHM   20 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHH
Confidence            78999999999999999884


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.61  E-value=0.00051  Score=38.31  Aligned_cols=25  Identities=32%  Similarity=0.655  Sum_probs=21.6

Q ss_pred             ccccccccccccccccccccccccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      +|+|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4789999999999999999988774


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.53  E-value=0.00041  Score=36.98  Aligned_cols=23  Identities=39%  Similarity=0.795  Sum_probs=15.6

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      |.|++|++.|.....|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777888888877777777654


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.36  E-value=0.00074  Score=48.56  Aligned_cols=21  Identities=33%  Similarity=0.928  Sum_probs=17.6

Q ss_pred             ceeCCccCccccCcchhccCC
Q psy8696         192 PYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       192 pf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      .+.|.+|++.|.....|..|+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm   70 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHM   70 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHH
T ss_pred             CCCCCccCCCCcCHHHHHHHH
Confidence            589999999999999888874


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=95.85  E-value=0.0013  Score=36.57  Aligned_cols=21  Identities=48%  Similarity=1.159  Sum_probs=19.1

Q ss_pred             ceeCCccCccccCcchhccCC
Q psy8696         192 PYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       192 pf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      +|+|+.|++.|.....|..|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~   21 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK   21 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH
T ss_pred             CCCCCccCCccCChhHHHHHh
Confidence            689999999999999998874


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=95.84  E-value=0.0015  Score=34.73  Aligned_cols=20  Identities=50%  Similarity=1.170  Sum_probs=16.3

Q ss_pred             eeCCccCccccCcchhccCC
Q psy8696         193 YSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       193 f~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      |.|++|++.|.+...|+.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            78999999999999998874


No 32 
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.78  E-value=0.0022  Score=34.39  Aligned_cols=24  Identities=33%  Similarity=0.566  Sum_probs=19.9

Q ss_pred             cccccccccccccccccccccccC
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      |.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            578889999999888988887664


No 33 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=95.51  E-value=0.0044  Score=40.26  Aligned_cols=33  Identities=21%  Similarity=0.399  Sum_probs=23.9

Q ss_pred             CCCCccccccccccccccccccccccccCCCcc
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIHERTHTDERP  192 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekp  192 (212)
                      ..+.+..|++|+..+....+|++|+.++++.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            457789999999999999999999988888776


No 34 
>PHA00616 hypothetical protein
Probab=95.17  E-value=0.003  Score=39.87  Aligned_cols=21  Identities=33%  Similarity=0.787  Sum_probs=19.2

Q ss_pred             ceeCCccCccccCcchhccCC
Q psy8696         192 PYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       192 pf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ||+|..||+.|.++.+|++|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~   21 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL   21 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH
Confidence            689999999999999999883


No 35 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.61  E-value=0.024  Score=50.01  Aligned_cols=49  Identities=43%  Similarity=0.821  Sum_probs=44.2

Q ss_pred             Ccccccccccccccccccccccc--ccCCC--cceeCC--ccCccccCcchhccC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHER--THTDE--RPYSCD--ICGKAFRRQDHLRDH  211 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r--~Htge--kpf~C~--~Cgk~F~~~~~L~~H  211 (212)
                      .++.|..|...|.....|.+|.+  .|+++  +++.|.  .|++.|.+.+.+..|
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~  342 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRH  342 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCC
Confidence            46889999999999999999999  89999  999999  799999999988776


No 36 
>KOG3993|consensus
Probab=94.54  E-value=0.0076  Score=54.94  Aligned_cols=49  Identities=27%  Similarity=0.689  Sum_probs=41.5

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCccccCcchhccCC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      .|.|..|...|.....|.+|.-...-..-|+|..|+|.|.-..||..||
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHR  315 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHR  315 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhh
Confidence            4999999999999999999964333334599999999999999998886


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=94.13  E-value=0.01  Score=31.68  Aligned_cols=20  Identities=40%  Similarity=1.024  Sum_probs=17.8

Q ss_pred             eeCCccCccccCcchhccCC
Q psy8696         193 YSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       193 f~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      |.|..|++.|.....|..|+
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHH
Confidence            57999999999999998874


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=94.09  E-value=0.011  Score=32.17  Aligned_cols=23  Identities=35%  Similarity=0.807  Sum_probs=17.1

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      |.|.+|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56788888888888887777643


No 39 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=93.93  E-value=0.028  Score=31.34  Aligned_cols=20  Identities=35%  Similarity=0.913  Sum_probs=12.1

Q ss_pred             eeCCccCccccCcchhccCC
Q psy8696         193 YSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       193 f~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      |.|++|++.|.....|..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            45666666666666665553


No 40 
>PHA00732 hypothetical protein
Probab=93.77  E-value=0.032  Score=39.61  Aligned_cols=47  Identities=19%  Similarity=0.287  Sum_probs=37.6

Q ss_pred             CCCCCCCccccccccccCCCCC-CCCCCccccccccccccccccccccccccCC
Q psy8696         137 FPGTSSTHSHLDRRLLRAPGRA-SRPKKQFICKFCNRQFTKSYNLLIHERTHTD  189 (212)
Q Consensus       137 ~~~~~~~~~~~~~~~l~~h~~~-h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htg  189 (212)
                      |.|..|...+.....+..|.+. |.+   +.|..|++.|.   .+..|.+++.+
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            5688899999999989999874 543   58999999997   58888876543


No 41 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=93.74  E-value=0.024  Score=31.59  Aligned_cols=22  Identities=27%  Similarity=0.712  Sum_probs=20.5

Q ss_pred             cccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERT  186 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~  186 (212)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=92.74  E-value=0.025  Score=30.66  Aligned_cols=19  Identities=47%  Similarity=1.148  Sum_probs=17.4

Q ss_pred             eeCCccCccccCcchhccC
Q psy8696         193 YSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       193 f~C~~Cgk~F~~~~~L~~H  211 (212)
                      |.|++|++.|.....|+.|
T Consensus         1 ~~C~~C~~~f~s~~~~~~H   19 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQH   19 (25)
T ss_dssp             EEETTTTEEESSHHHHHHH
T ss_pred             CCCCCCCCCcCCHHHHHHH
Confidence            6899999999999998877


No 43 
>KOG2461|consensus
Probab=92.05  E-value=0.15  Score=46.73  Aligned_cols=29  Identities=14%  Similarity=0.257  Sum_probs=25.2

Q ss_pred             ccceeeccCCcccccchHHHHHHHHHHHH
Q psy8696          41 SAFVPVVPTRSIHMYQGDELMAMMADKRK   69 (212)
Q Consensus        41 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   69 (212)
                      -+.++|.|+.+|+|||..++++.+...-.
T Consensus       127 rt~r~I~p~eELlVWY~~e~~~~L~~~~~  155 (396)
T KOG2461|consen  127 RTIRDIRPNEELLVWYGSEYAEELAYGHG  155 (396)
T ss_pred             EecccCCCCCeEEEEeccchHhHhcccCC
Confidence            46799999999999999999999886544


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=92.00  E-value=0.042  Score=35.74  Aligned_cols=25  Identities=40%  Similarity=0.874  Sum_probs=17.6

Q ss_pred             CCCcceeCCccCccccCcchhccCC
Q psy8696         188 TDERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       188 tgekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ..+.|-.|++|+..+.+..+|++|+
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHl   44 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHL   44 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHH
T ss_pred             ccCCCCCCCcchhhccchhhHHHHH
Confidence            4567999999999999999999984


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=91.43  E-value=0.029  Score=30.25  Aligned_cols=23  Identities=26%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             cccccccccccccccccccccccC
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      |+|..|+.... +..|.+|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67889988877 778888887753


No 46 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=91.12  E-value=0.042  Score=35.84  Aligned_cols=50  Identities=20%  Similarity=0.363  Sum_probs=34.7

Q ss_pred             CCCCCCCCccccccccccCCCC-CCCC-CCccccccccccccccccccccccccC
Q psy8696         136 LFPGTSSTHSHLDRRLLRAPGR-ASRP-KKQFICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       136 ~~~~~~~~~~~~~~~~l~~h~~-~h~~-~k~~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      .|.|+.|.. ..+...|..|.. .|.. .+.+.|++|...+..  +|.+|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHHHHhc
Confidence            478888988 566666665543 2332 457999999987553  8888987654


No 47 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=88.87  E-value=0.55  Score=41.28  Aligned_cols=67  Identities=21%  Similarity=0.285  Sum_probs=56.7

Q ss_pred             CCCCCCCCccccccccccCCCC--CCCCC--Cccccc--cccccccccccccccccccCCCcceeCCc--cCccc
Q psy8696         136 LFPGTSSTHSHLDRRLLRAPGR--ASRPK--KQFICK--FCNRQFTKSYNLLIHERTHTDERPYSCDI--CGKAF  202 (212)
Q Consensus       136 ~~~~~~~~~~~~~~~~l~~h~~--~h~~~--k~~~C~--~C~k~F~~~~~L~~H~r~Htgekpf~C~~--Cgk~F  202 (212)
                      .+.+..|...+.....+..|.+  .|..+  +++.|.  .|++.|.+...+.+|..+|++.+++.|..  |.+.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  363 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKF  363 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccc
Confidence            4667777777888888888988  79999  999999  79999999999999999999999888865  44443


No 48 
>KOG1146|consensus
Probab=88.74  E-value=0.55  Score=48.55  Aligned_cols=53  Identities=25%  Similarity=0.479  Sum_probs=44.9

Q ss_pred             CCCCccccccccccccccccccccccccC-------------------------CCcceeCCccCccccCcchhccCC
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIHERTHT-------------------------DERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H~r~Ht-------------------------gekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      .-.|.|+|+.|+..|+....|-.|+|..+                         +.++|.|..|...+..+.+|.+|+
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHH
Confidence            34588999999999999999999999821                         237899999999999999888773


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=88.52  E-value=0.13  Score=29.91  Aligned_cols=20  Identities=20%  Similarity=0.655  Sum_probs=11.7

Q ss_pred             ceeCCccCccccCcchhccC
Q psy8696         192 PYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       192 pf~C~~Cgk~F~~~~~L~~H  211 (212)
                      +|.|++|++.|.....+..|
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H   22 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAH   22 (35)
T ss_pred             CeEccccCCccCCHHHHHHH
Confidence            35566666666655555544


No 50 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.96  E-value=0.29  Score=28.67  Aligned_cols=24  Identities=29%  Similarity=1.067  Sum_probs=18.2

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      |.|..||..+.-.            +.++.|++|+.
T Consensus         2 ~~C~~CGy~y~~~------------~~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGE------------EAPWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCC------------cCCCcCcCCCC
Confidence            7899999765432            26889999985


No 51 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=87.79  E-value=0.28  Score=43.58  Aligned_cols=25  Identities=20%  Similarity=0.660  Sum_probs=22.2

Q ss_pred             CCCcccccccccccccccccccccc
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHER  185 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r  185 (212)
                      ..|||.|++|+|.|++...|+-|+.
T Consensus       395 ~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         395 KDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             cCCceeccccchhhccCccceeccc
Confidence            4599999999999999999998853


No 52 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=87.31  E-value=0.15  Score=28.13  Aligned_cols=21  Identities=33%  Similarity=0.698  Sum_probs=15.5

Q ss_pred             cccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERT  186 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~  186 (212)
                      ..|..||+.| ....|.+|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4688888888 56677777653


No 53 
>KOG4124|consensus
Probab=84.93  E-value=1.5  Score=39.56  Aligned_cols=52  Identities=27%  Similarity=0.796  Sum_probs=40.1

Q ss_pred             CCCcccccc--ccccccccccccccccc---------------cC----CCcceeCCccCccccCcchhccCC
Q psy8696         161 PKKQFICKF--CNRQFTKSYNLLIHERT---------------HT----DERPYSCDICGKAFRRQDHLRDHR  212 (212)
Q Consensus       161 ~~k~~~C~~--C~k~F~~~~~L~~H~r~---------------Ht----gekpf~C~~Cgk~F~~~~~L~~Hr  212 (212)
                      ..++|+|.+  |.+.++....|+.|...               |+    ..|+|+|++|.+.++....|+-|+
T Consensus       346 ~~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  346 VDKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             ecCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            367899976  99999888888777532               22    358999999999998888777664


No 54 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=82.97  E-value=0.36  Score=27.99  Aligned_cols=23  Identities=35%  Similarity=0.706  Sum_probs=20.0

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT  186 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~  186 (212)
                      .|.|.+|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            48899999999998889888764


No 55 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.37  E-value=0.83  Score=34.36  Aligned_cols=30  Identities=30%  Similarity=0.791  Sum_probs=21.8

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      ..|..||+.|-   .|        +..|..|+.||..|.-.
T Consensus        10 R~Cp~CG~kFY---DL--------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFY---DL--------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhc---cC--------CCCCccCCCCCCccCcc
Confidence            46889998883   33        23588899999888654


No 56 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=77.54  E-value=1.2  Score=28.37  Aligned_cols=30  Identities=20%  Similarity=0.606  Sum_probs=20.4

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      .|+|..|+..|.....+.      . ...-.|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~~------~-~~~~~CP~Cg~   34 (52)
T TIGR02605         5 EYRCTACGHRFEVLQKMS------D-DPLATCPECGG   34 (52)
T ss_pred             EEEeCCCCCEeEEEEecC------C-CCCCCCCCCCC
Confidence            488999999887542221      1 34567999986


No 57 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=76.95  E-value=1.5  Score=25.91  Aligned_cols=25  Identities=32%  Similarity=0.850  Sum_probs=17.9

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      .|.|..||..+...            +.|..|++|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            48899999764321            25679999986


No 58 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=76.83  E-value=1.7  Score=31.44  Aligned_cols=32  Identities=28%  Similarity=0.758  Sum_probs=23.1

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ..|.|+.|++.        .+.|+-  ..-+.|..|+..|.-
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a--~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIA--TGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCc--------ceeeec--cCeEEcCCCCCeecc
Confidence            45899999975        233433  346999999999864


No 59 
>PRK04860 hypothetical protein; Provisional
Probab=76.62  E-value=0.51  Score=37.93  Aligned_cols=40  Identities=13%  Similarity=0.238  Sum_probs=30.4

Q ss_pred             CCCCCCCCCccccccccccCCCCCCCCCCccccccccccccccc
Q psy8696         135 SLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSY  178 (212)
Q Consensus       135 ~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~  178 (212)
                      -.|.|. |..   ....++.|.++++++++|.|..|++.|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            356676 654   4445677889999999999999999887543


No 60 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=76.36  E-value=0.69  Score=32.76  Aligned_cols=24  Identities=33%  Similarity=0.736  Sum_probs=21.2

Q ss_pred             cccccccccccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      .+.|.+|++.|.....|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            589999999999999999999864


No 61 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=76.04  E-value=1.4  Score=34.65  Aligned_cols=41  Identities=15%  Similarity=0.457  Sum_probs=28.0

Q ss_pred             CCCCccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ....-|.|+.|++.|.....+..-   .. ...|.|+.||.....
T Consensus        95 ~~~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l~~  135 (147)
T smart00531       95 TNNAYYKCPNCQSKYTFLEANQLL---DM-DGTFTCPRCGEELEE  135 (147)
T ss_pred             cCCcEEECcCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEEEE
Confidence            345679999999999865544321   11 334999999987543


No 62 
>PF14353 CpXC:  CpXC protein
Probab=75.95  E-value=0.93  Score=34.58  Aligned_cols=14  Identities=36%  Similarity=1.082  Sum_probs=7.8

Q ss_pred             ceeCCccCccccCc
Q psy8696         192 PYSCDICGKAFRRQ  205 (212)
Q Consensus       192 pf~C~~Cgk~F~~~  205 (212)
                      -|.|+.||+.|.-.
T Consensus        38 ~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   38 SFTCPSCGHKFRLE   51 (128)
T ss_pred             EEECCCCCCceecC
Confidence            35566666655433


No 63 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.53  E-value=1.6  Score=26.20  Aligned_cols=32  Identities=22%  Similarity=0.588  Sum_probs=21.8

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      .|+|..||+.|.......       ......|+.||...
T Consensus         5 ~y~C~~Cg~~fe~~~~~~-------~~~~~~CP~Cg~~~   36 (41)
T smart00834        5 EYRCEDCGHTFEVLQKIS-------DDPLATCPECGGDV   36 (41)
T ss_pred             EEEcCCCCCEEEEEEecC-------CCCCCCCCCCCCcc
Confidence            488999999886543321       13456799998743


No 64 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=75.43  E-value=2.2  Score=32.99  Aligned_cols=30  Identities=27%  Similarity=0.488  Sum_probs=20.4

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      ..|+.||+.|-.   |        +..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD---L--------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD---L--------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc---c--------CCCCccCCCcCCccCcc
Confidence            468888887733   2        23577888888877544


No 65 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=75.20  E-value=1.8  Score=25.78  Aligned_cols=34  Identities=21%  Similarity=0.476  Sum_probs=22.8

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      +.|+.|+..|.-......     .....+.|..|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~~-----~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLG-----ANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHcC-----CCCCEEECCCCCCEEE
Confidence            679999988766543321     1223588999998875


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=74.89  E-value=0.75  Score=30.52  Aligned_cols=31  Identities=16%  Similarity=0.341  Sum_probs=24.8

Q ss_pred             CCCCCCCcccccccccccccccccccccccc
Q psy8696         157 RASRPKKQFICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       157 ~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      +...++.-+.|+.|+..|.......+|...-
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKa   40 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRHVNKA   40 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHHhhHH
Confidence            3456777889999999999998898888653


No 67 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=74.34  E-value=1.8  Score=35.00  Aligned_cols=23  Identities=39%  Similarity=1.044  Sum_probs=19.4

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICG  199 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cg  199 (212)
                      .|.|.+||..             |.|+-|-+|++||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            6999999854             4567899999998


No 68 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=74.18  E-value=1.3  Score=30.88  Aligned_cols=19  Identities=16%  Similarity=0.466  Sum_probs=10.5

Q ss_pred             CCccccc--cccccccccccc
Q psy8696         162 KKQFICK--FCNRQFTKSYNL  180 (212)
Q Consensus       162 ~k~~~C~--~C~k~F~~~~~L  180 (212)
                      +..++|.  .||.+|.....+
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEEE
Confidence            4445665  566666555444


No 69 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=72.79  E-value=2.5  Score=25.21  Aligned_cols=34  Identities=21%  Similarity=0.550  Sum_probs=23.6

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      ..|+.|+..|.-......     ...+..+|..|+..|.
T Consensus         3 i~Cp~C~~~y~i~d~~ip-----~~g~~v~C~~C~~~f~   36 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEKIP-----PKGRKVRCSKCGHVFF   36 (36)
T ss_pred             EECCCCCCEEeCCHHHCC-----CCCcEEECCCCCCEeC
Confidence            468899988876654321     2344688999998874


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=72.74  E-value=2.1  Score=26.76  Aligned_cols=30  Identities=20%  Similarity=0.468  Sum_probs=20.6

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      .|.|..||..|......          ..+.|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~~----------~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEYG----------TGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCCC----------CceECCCCCCeEE
Confidence            48899999877553211          1678999987654


No 71 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=70.21  E-value=2.4  Score=28.46  Aligned_cols=32  Identities=25%  Similarity=0.535  Sum_probs=19.3

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      .|.|+.||+.--.     +-.+-.....+|+|+.||-
T Consensus        27 ~F~CPnCGe~~I~-----Rc~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIY-----RCAKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeee-----hhhhHHHcCCceECCCcCc
Confidence            3788888865322     2222223346899999974


No 72 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=69.54  E-value=3.1  Score=24.91  Aligned_cols=34  Identities=26%  Similarity=0.628  Sum_probs=23.4

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      ..|+.|+..|.-...-     +-.+.+..+|..|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCCcEEECCCCCcEee
Confidence            4688998888665432     123445789999998875


No 73 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=69.53  E-value=2.6  Score=25.26  Aligned_cols=33  Identities=24%  Similarity=0.521  Sum_probs=20.3

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      ..|..||+.|...        ...-...-.|+.||-.+.++
T Consensus         2 r~C~~Cg~~Yh~~--------~~pP~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen    2 RICPKCGRIYHIE--------FNPPKVEGVCDNCGGELVQR   34 (36)
T ss_dssp             EEETTTTEEEETT--------TB--SSTTBCTTTTEBEBEE
T ss_pred             cCcCCCCCccccc--------cCCCCCCCccCCCCCeeEeC
Confidence            4688898887432        22234456799998765543


No 74 
>PRK09979 putative rho operon leader peptide; Provisional
Probab=67.77  E-value=3  Score=23.71  Aligned_cols=26  Identities=42%  Similarity=0.409  Sum_probs=22.3

Q ss_pred             cccccCCCCCCccccccccceeeccC
Q psy8696          24 RSLQMSNSPYHLLHRESSAFVPVVPT   49 (212)
Q Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~   49 (212)
                      ++.|++|+.....-|-||||-||.-.
T Consensus         2 rseqisgsslnpscrfssayspvtrq   27 (33)
T PRK09979          2 RSEQISGSSLNPSCRFSSAYSPVTRQ   27 (33)
T ss_pred             ccccccCCcCCcccccccccChHhhh
Confidence            56789999999999999999998643


No 75 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=67.45  E-value=3.3  Score=25.48  Aligned_cols=30  Identities=23%  Similarity=0.753  Sum_probs=21.5

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      .|.|..||..|.....+      .. .....|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQSI------SE-DDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEEc------CC-CCCCcCCCCCC
Confidence            48899999988664332      22 45678999987


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=66.74  E-value=1.2  Score=29.59  Aligned_cols=27  Identities=33%  Similarity=0.651  Sum_probs=22.6

Q ss_pred             cccCCCcceeCCccCccccCcchhccC
Q psy8696         185 RTHTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       185 r~Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      ++..||.-+.|+-|+..|+...++.+|
T Consensus        10 ~~RDGE~~lrCPRC~~~FR~~K~Y~RH   36 (65)
T COG4049          10 RDRDGEEFLRCPRCGMVFRRRKDYIRH   36 (65)
T ss_pred             eccCCceeeeCCchhHHHHHhHHHHHH
Confidence            445688889999999999988877776


No 77 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=66.50  E-value=4.2  Score=25.46  Aligned_cols=26  Identities=27%  Similarity=0.653  Sum_probs=18.8

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      |.|..||..|...           ...+.+|..||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            8899999877643           2346789999854


No 78 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=65.80  E-value=3  Score=34.00  Aligned_cols=36  Identities=22%  Similarity=0.551  Sum_probs=27.4

Q ss_pred             CCCCccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ....-|.|+.|+..|+....+.         .-|.|+.||.....
T Consensus       113 ~~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             cCCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            3456699999999998877653         36999999976543


No 79 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=64.41  E-value=3  Score=33.31  Aligned_cols=36  Identities=22%  Similarity=0.410  Sum_probs=28.0

Q ss_pred             CCCCccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         160 RPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       160 ~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ....-|.|+.|+..|+....+.         .-|.|+.||.....
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLDY  140 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEeee
Confidence            3456699999999998877774         26999999976543


No 80 
>PHA00626 hypothetical protein
Probab=61.92  E-value=6.8  Score=25.99  Aligned_cols=14  Identities=21%  Similarity=0.591  Sum_probs=7.4

Q ss_pred             Cccccccccccccc
Q psy8696         163 KQFICKFCNRQFTK  176 (212)
Q Consensus       163 k~~~C~~C~k~F~~  176 (212)
                      ..|+|..||..|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            34556666555543


No 81 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=60.08  E-value=2.9  Score=25.67  Aligned_cols=24  Identities=38%  Similarity=0.577  Sum_probs=14.6

Q ss_pred             CCCcccccccccccccc----ccccccc
Q psy8696         161 PKKQFICKFCNRQFTKS----YNLLIHE  184 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~----~~L~~H~  184 (212)
                      .++..+|.+|++.+...    .+|.+|+
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            35567899999988774    5677777


No 82 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=59.65  E-value=5.4  Score=25.72  Aligned_cols=29  Identities=24%  Similarity=0.643  Sum_probs=19.8

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      ..|.|..||+.|..   +       .......|+.||..
T Consensus         5 ~~Y~C~~Cg~~~~~---~-------~~~~~irCp~Cg~r   33 (49)
T COG1996           5 MEYKCARCGREVEL---D-------QETRGIRCPYCGSR   33 (49)
T ss_pred             EEEEhhhcCCeeeh---h-------hccCceeCCCCCcE
Confidence            45899999998821   1       12346789999854


No 83 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.31  E-value=4.3  Score=34.63  Aligned_cols=39  Identities=31%  Similarity=0.479  Sum_probs=29.3

Q ss_pred             CCccccccccccccccccccccccccCCCc----------c-----eeCCccCc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDER----------P-----YSCDICGK  200 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgek----------p-----f~C~~Cgk  200 (212)
                      ++.+.|++|+..|..+..+..-.|+-.|+-          |     +.|++|.-
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRiiagDld~~lkygninP~fY~VvvCP~C~y   70 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRIIAGDLDFFLKYGNINPYFYDVVVCPICYY   70 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEecccccceeeccccCCceeEEEEcchhhH
Confidence            566899999999999888777777655542          2     35999973


No 84 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=59.28  E-value=6.1  Score=24.09  Aligned_cols=12  Identities=42%  Similarity=1.077  Sum_probs=8.8

Q ss_pred             ceeCCccCcccc
Q psy8696         192 PYSCDICGKAFR  203 (212)
Q Consensus       192 pf~C~~Cgk~F~  203 (212)
                      -|.|..|+..|+
T Consensus        28 fy~C~~C~~~w~   39 (40)
T smart00440       28 FYVCTKCGHRWR   39 (40)
T ss_pred             EEEeCCCCCEeC
Confidence            478888887664


No 85 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=57.97  E-value=3.5  Score=32.13  Aligned_cols=28  Identities=36%  Similarity=0.623  Sum_probs=17.3

Q ss_pred             CCccccccccccccccccccccccccCCCcc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERP  192 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekp  192 (212)
                      +....|-+||+.|+.   |++|++.|+|..|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCH
Confidence            344789999999875   5999999977643


No 86 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=56.47  E-value=3.7  Score=26.06  Aligned_cols=25  Identities=36%  Similarity=0.776  Sum_probs=18.9

Q ss_pred             Ccccccccccccccc-----cccccccc-cc
Q psy8696         163 KQFICKFCNRQFTKS-----YNLLIHER-TH  187 (212)
Q Consensus       163 k~~~C~~C~k~F~~~-----~~L~~H~r-~H  187 (212)
                      ..-.|.+|++.+...     ++|.+|++ .|
T Consensus        17 ~~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       17 QRAKCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             eEEEecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            346799999998766     47888877 44


No 87 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=56.02  E-value=6.1  Score=28.73  Aligned_cols=32  Identities=19%  Similarity=0.565  Sum_probs=21.8

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ..|.|++|++.-     +.+     .....+.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~-----vkR-----~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHA-----VKR-----QAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCc-----eee-----eeeEEEEcCCCCCEEeC
Confidence            459999998642     211     13356899999998863


No 88 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.69  E-value=5.7  Score=30.02  Aligned_cols=28  Identities=25%  Similarity=0.432  Sum_probs=19.3

Q ss_pred             ccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         166 ICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      .|+.|++.|-.   |        ...|..|++||++|.+
T Consensus        11 idPetg~KFYD---L--------NrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYD---L--------NRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhc---c--------CCCccccCcccccchH
Confidence            57788877733   2        3457888888888843


No 89 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=55.45  E-value=5.6  Score=28.98  Aligned_cols=32  Identities=28%  Similarity=0.855  Sum_probs=21.6

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ..|.|++|++.-..        |  .....+.|..|++.|.-
T Consensus        34 a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        34 AKYVCPFCGKKTVK--------R--GSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             cCccCCCCCCCceE--------E--EeeEEEEcCCCCCEEeC
Confidence            45999999864211        1  13346899999998863


No 90 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=54.02  E-value=7.6  Score=26.00  Aligned_cols=32  Identities=28%  Similarity=0.780  Sum_probs=19.1

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      .|.|+.||+..-     .|-.+-.....+|+|+.||-
T Consensus        25 ~F~CPnCG~~~I-----~RC~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVII-----YRCEKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeE-----eechhHHhcCCceECCCCCC
Confidence            488888887521     12222222346899999974


No 91 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=53.61  E-value=4.9  Score=24.38  Aligned_cols=10  Identities=40%  Similarity=1.132  Sum_probs=7.5

Q ss_pred             eeCCccCccc
Q psy8696         193 YSCDICGKAF  202 (212)
Q Consensus       193 f~C~~Cgk~F  202 (212)
                      |.|..|++.|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            7788887765


No 92 
>KOG2593|consensus
Probab=53.28  E-value=3.9  Score=37.76  Aligned_cols=44  Identities=18%  Similarity=0.523  Sum_probs=30.5

Q ss_pred             CCCCCCCCCccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         155 PGRASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       155 h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      -.+..+...-|.|+.|.+.|.....++.-   -...--|.|..|+-.
T Consensus       119 ~~~d~t~~~~Y~Cp~C~kkyt~Lea~~L~---~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  119 RLRDDTNVAGYVCPNCQKKYTSLEALQLL---DNETGEFHCENCGGE  162 (436)
T ss_pred             HhhhccccccccCCccccchhhhHHHHhh---cccCceEEEecCCCc
Confidence            33445667779999999999887666432   122346999999743


No 93 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=52.82  E-value=12  Score=27.79  Aligned_cols=39  Identities=23%  Similarity=0.459  Sum_probs=23.5

Q ss_pred             CCCccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      -++.|.|++||..-...-.++.-    .+.-...|.+||..|.
T Consensus        19 L~k~FtCp~Cghe~vs~ctvkk~----~~~g~~~Cg~CGls~e   57 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVKKT----VNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CCceEecCccCCeeeeEEEEEec----CceeEEEcccCcceEE
Confidence            36779999999654332222211    1222467999998875


No 94 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=52.38  E-value=6.3  Score=28.66  Aligned_cols=31  Identities=32%  Similarity=0.863  Sum_probs=20.9

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      ..|.|++|++.-     +.   |.-+|  -|.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~-----vk---R~a~G--IW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTS-----VK---RVATG--IWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSE-----EE---EEETT--EEEETTTTEEEE
T ss_pred             CCCcCCCCCCce-----eE---EeeeE--EeecCCCCCEEe
Confidence            459999999753     21   22223  589999999885


No 95 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=52.10  E-value=10  Score=22.08  Aligned_cols=27  Identities=26%  Similarity=0.725  Sum_probs=16.3

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      |.|..|+..+..+           ...+.+|..||..-
T Consensus         1 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~RI   27 (32)
T PF03604_consen    1 YICGECGAEVELK-----------PGDPIRCPECGHRI   27 (32)
T ss_dssp             EBESSSSSSE-BS-----------TSSTSSBSSSS-SE
T ss_pred             CCCCcCCCeeEcC-----------CCCcEECCcCCCeE
Confidence            5788888776522           12356888888643


No 96 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=52.09  E-value=8.3  Score=29.95  Aligned_cols=39  Identities=21%  Similarity=0.435  Sum_probs=21.9

Q ss_pred             Cccccccccccccccc---cc------cccccccCCCcceeCCccCcc
Q psy8696         163 KQFICKFCNRQFTKSY---NL------LIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~---~L------~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      ..+.|..||..|....   .|      ..|..--+...-+.|+.||..
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC
Confidence            4588999998876541   11      111111112345779999854


No 97 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=51.12  E-value=8.5  Score=27.99  Aligned_cols=32  Identities=28%  Similarity=0.715  Sum_probs=21.4

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ..|.|++|++.-..        |  ...-.+.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~vk--------R--~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         35 AKHVCPVCGRPKVK--------R--VGTGIWECRKCGAKFAG   66 (90)
T ss_pred             cCccCCCCCCCceE--------E--EEEEEEEcCCCCCEEeC
Confidence            34999999764221        1  12346899999998863


No 98 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=51.00  E-value=7.2  Score=30.33  Aligned_cols=34  Identities=29%  Similarity=0.793  Sum_probs=23.3

Q ss_pred             CCccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      .-.|.|..|+..+.      +|.+.  ..+.|.|..|+..|.
T Consensus       121 ~~~~~C~~C~~~~~------r~~~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  121 KYVYRCPSCGREYK------RHRRS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             ceEEEcCCCCCEee------eeccc--chhhEECCCCCCEEE
Confidence            34589999997763      34444  334599999987665


No 99 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=50.96  E-value=13  Score=36.87  Aligned_cols=22  Identities=32%  Similarity=0.496  Sum_probs=14.3

Q ss_pred             ccccccccCCCcceeCCccCcc
Q psy8696         180 LLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       180 L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      |.-|.--|....|..|+.||..
T Consensus       463 L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         463 LRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             eEeCCCCCCCCCCCCCCCCCCC
Confidence            4444444556678899999854


No 100
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=50.34  E-value=8.8  Score=25.69  Aligned_cols=27  Identities=26%  Similarity=0.648  Sum_probs=10.8

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      -.|..|++.|..            ..+.+.|..||+.|-
T Consensus        10 ~~C~~C~~~F~~------------~~rrhhCr~CG~~vC   36 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRRHHCRNCGRVVC   36 (69)
T ss_dssp             SB-TTT--B-BS------------SS-EEE-TTT--EEE
T ss_pred             CcCcCcCCcCCC------------ceeeEccCCCCCEEC
Confidence            457778887742            134456777776654


No 101
>KOG2785|consensus
Probab=49.32  E-value=4.4  Score=36.81  Aligned_cols=51  Identities=20%  Similarity=0.352  Sum_probs=40.3

Q ss_pred             CCccccccccccccccccccccccccCCC-----------------------cceeCCccC---ccccCcchhccCC
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDE-----------------------RPYSCDICG---KAFRRQDHLRDHR  212 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htge-----------------------kpf~C~~Cg---k~F~~~~~L~~Hr  212 (212)
                      ..|-.|-+|++.+..-.....||..++|-                       +-|.|-.|.   +.|......+.||
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM  240 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHM  240 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHH
Confidence            44567999999999988888999877652                       347799998   8888877777775


No 102
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=48.44  E-value=2.4  Score=35.75  Aligned_cols=28  Identities=14%  Similarity=0.342  Sum_probs=20.9

Q ss_pred             CCccccccccccccccccccccccccCC
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTD  189 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htg  189 (212)
                      +..|.|..|+|.|.-...+.+|+...+.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            4459999999999999999999876544


No 103
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=46.50  E-value=15  Score=29.34  Aligned_cols=16  Identities=25%  Similarity=0.490  Sum_probs=9.7

Q ss_pred             cccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNL  180 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L  180 (212)
                      ++|+.||++|.....+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6666666666655443


No 104
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=46.05  E-value=15  Score=22.87  Aligned_cols=27  Identities=37%  Similarity=0.945  Sum_probs=17.5

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      +.|+.|+..  ....+.       +...|+|..|++
T Consensus        19 ~~CP~Cg~~--~~~~~~-------~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGST--KHYRLK-------TRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCe--eeEEeC-------CCCeEECCCCCC
Confidence            779999865  211221       256799999875


No 105
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=45.71  E-value=9.1  Score=27.16  Aligned_cols=40  Identities=28%  Similarity=0.658  Sum_probs=15.5

Q ss_pred             CCccccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      .+.|.|++|+..=    .+..-+....+.-...|.+|+..|...
T Consensus        20 ~~~F~CPfC~~~~----sV~v~idkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   20 PKVFDCPFCNHEK----SVSVKIDKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             SS----TTT--SS-----EEEEEETTTTEEEEEESSS--EEEEE
T ss_pred             CceEcCCcCCCCC----eEEEEEEccCCEEEEEecCCCCeEEEc
Confidence            4668899888321    111111111233356788888877644


No 106
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=44.80  E-value=11  Score=29.53  Aligned_cols=25  Identities=32%  Similarity=0.450  Sum_probs=21.0

Q ss_pred             cccccccccccccccccccccccCCCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERP  192 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekp  192 (212)
                      ..|-.|||.|+   +|++|+.+|.|.-|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            57999999996   68999999987654


No 107
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=44.21  E-value=15  Score=23.66  Aligned_cols=35  Identities=14%  Similarity=0.478  Sum_probs=19.9

Q ss_pred             cccccccccccccccccccccccCC------CcceeCCccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTD------ERPYSCDICGK  200 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htg------ekpf~C~~Cgk  200 (212)
                      |+|..||..|.-...-..+ .+-.|      ...|.|++|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~~-~i~pGt~f~~Lp~~w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPDE-GIPPGTPFEDLPDDWVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCccc-CcCCCCCHhHCCCCCCCCCCCC
Confidence            7899999887654322111 11111      12478999974


No 108
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=43.53  E-value=17  Score=26.84  Aligned_cols=39  Identities=31%  Similarity=0.732  Sum_probs=15.7

Q ss_pred             CCCccccccccccccccccccccccccCCCcc-eeCCccCccccCc
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTDERP-YSCDICGKAFRRQ  205 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekp-f~C~~Cgk~F~~~  205 (212)
                      +.|.-.|..|++++...+     ..+ .|+|. |.|++|-+.|.+-
T Consensus        11 g~ke~~CalCG~tWg~~y-----~Ev-~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   11 GTKEMGCALCGATWGDYY-----EEV-DGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             -SGGGS-SS---S---SS------B--TT--BSSS--SSSS-TTS-
T ss_pred             ccccccccccCCcHHHHH-----Hhh-cCCEEEEEcHHHHHHHHHH
Confidence            345567999999876432     222 35554 7889999998753


No 109
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.30  E-value=14  Score=34.14  Aligned_cols=31  Identities=19%  Similarity=0.567  Sum_probs=22.0

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQD  206 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~  206 (212)
                      -.|+.||.+...+           |.+-|+|..||..+....
T Consensus       351 p~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~~  381 (421)
T COG1571         351 PVCPRCGGRMKSA-----------GRNGFRCKKCGTRARETL  381 (421)
T ss_pred             CCCCccCCchhhc-----------CCCCcccccccccCCccc
Confidence            3699998765443           444799999998877543


No 110
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=42.83  E-value=12  Score=21.26  Aligned_cols=20  Identities=25%  Similarity=0.565  Sum_probs=10.7

Q ss_pred             ccccccccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHER  185 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r  185 (212)
                      |.|-.|++.| .....+.|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            4577777777 4445555543


No 111
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=42.30  E-value=21  Score=22.66  Aligned_cols=36  Identities=14%  Similarity=0.455  Sum_probs=19.5

Q ss_pred             cccccccccccccccccccccccCC------CcceeCCccCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTD------ERPYSCDICGKA  201 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htg------ekpf~C~~Cgk~  201 (212)
                      |+|..|+..|.-...-..+ .+-.|      -.-|.|++|+..
T Consensus         2 y~C~~CgyvYd~~~Gd~~~-~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPEN-GIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EEETTTSBEEETTTBBGGG-TB-TT--GGGS-TT-B-TTTSSB
T ss_pred             cCCCCCCEEEcCCcCCccc-CcCCCCCHHHCCCCCcCcCCCCc
Confidence            7899999887665443222 11111      234889999753


No 112
>KOG1146|consensus
Probab=42.22  E-value=8.1  Score=40.43  Aligned_cols=73  Identities=15%  Similarity=0.196  Sum_probs=49.3

Q ss_pred             CCCCCCCCCccccccccccCCCCCCCCCCccccccccccccccccccccccc-----------------cCCCcceeCCc
Q psy8696         135 SLFPGTSSTHSHLDRRLLRAPGRASRPKKQFICKFCNRQFTKSYNLLIHERT-----------------HTDERPYSCDI  197 (212)
Q Consensus       135 ~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~~~C~~C~k~F~~~~~L~~H~r~-----------------Htgekpf~C~~  197 (212)
                      ..+.|..|.+.+.....+. +   -.....|.|..|...|.....|..|.+.                 +...++| |.+
T Consensus      1259 Ge~~c~~~~~~~~~~~~~~-~---l~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~ 1333 (1406)
T KOG1146|consen 1259 GEGECGAVDELLTPSFGIS-T---LDVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLA 1333 (1406)
T ss_pred             CcchhhhccccccCcccee-e---cccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chH
Confidence            3445555554443333332 2   2345669999999999999888888742                 2234566 999


Q ss_pred             cCccccCcchhccCC
Q psy8696         198 CGKAFRRQDHLRDHR  212 (212)
Q Consensus       198 Cgk~F~~~~~L~~Hr  212 (212)
                      |...|.....|..|+
T Consensus      1334 c~~~~~~~~alqihm 1348 (1406)
T KOG1146|consen 1334 CEVLLSGREALQIHM 1348 (1406)
T ss_pred             HHhhcchhHHHHHHH
Confidence            999999999888875


No 113
>PRK12496 hypothetical protein; Provisional
Probab=41.47  E-value=14  Score=29.70  Aligned_cols=31  Identities=29%  Similarity=0.847  Sum_probs=20.7

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      ..|.|.-|++.|....            ..-.|++||....++
T Consensus       126 w~~~C~gC~~~~~~~~------------~~~~C~~CG~~~~r~  156 (164)
T PRK12496        126 WRKVCKGCKKKYPEDY------------PDDVCEICGSPVKRK  156 (164)
T ss_pred             eeEECCCCCccccCCC------------CCCcCCCCCChhhhc
Confidence            4588999999885421            112599999765544


No 114
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=41.39  E-value=16  Score=23.92  Aligned_cols=31  Identities=26%  Similarity=0.521  Sum_probs=20.3

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      |+|+.|+..+.-....       .|+ ...|+.||..|.
T Consensus         3 ~~CP~CG~~iev~~~~-------~Ge-iV~Cp~CGaele   33 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LGE-LVICDECGAELE   33 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cCC-EEeCCCCCCEEE
Confidence            6899999876443222       133 568999987653


No 115
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=40.97  E-value=21  Score=21.35  Aligned_cols=30  Identities=17%  Similarity=0.515  Sum_probs=18.7

Q ss_pred             cccccccccccccccccccccccCCCcceeCCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDIC  198 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~C  198 (212)
                      ..|+.|+..    ..+.+|=+...|...|.|..|
T Consensus         6 v~CP~C~s~----~~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQST----EGVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCC----CcceeCCCCCCCCEeEecCcC
Confidence            457777643    125566666666667888777


No 116
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=40.69  E-value=22  Score=26.41  Aligned_cols=12  Identities=33%  Similarity=0.899  Sum_probs=8.0

Q ss_pred             Cccccccccccc
Q psy8696         163 KQFICKFCNRQF  174 (212)
Q Consensus       163 k~~~C~~C~k~F  174 (212)
                      |+-.|++||..-
T Consensus         1 ~p~~CpYCg~~~   12 (102)
T PF11672_consen    1 KPIICPYCGGPA   12 (102)
T ss_pred             CCcccCCCCCee
Confidence            456788888643


No 117
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=40.07  E-value=19  Score=22.92  Aligned_cols=10  Identities=40%  Similarity=1.016  Sum_probs=4.9

Q ss_pred             cccccccccc
Q psy8696         165 FICKFCNRQF  174 (212)
Q Consensus       165 ~~C~~C~k~F  174 (212)
                      +.|..||+.|
T Consensus        19 ~~Cr~Cg~~~   28 (57)
T cd00065          19 HHCRNCGRIF   28 (57)
T ss_pred             cccCcCcCCc
Confidence            4455555544


No 118
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=39.51  E-value=17  Score=28.95  Aligned_cols=36  Identities=22%  Similarity=0.720  Sum_probs=26.2

Q ss_pred             CCccccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      ..+|.|. |+..|.+   .++|-.+-.|+ .|.|..|+-..
T Consensus       115 ~~~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC~~C~gkL  150 (156)
T COG3091         115 TYPYRCQ-CQQHYLR---IRRHNTVRRGE-VYRCGKCGGKL  150 (156)
T ss_pred             ceeEEee-cCCccch---hhhcccccccc-eEEeccCCceE
Confidence            4569999 9987654   35666666677 89999997543


No 119
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.47  E-value=18  Score=27.92  Aligned_cols=17  Identities=29%  Similarity=0.712  Sum_probs=12.4

Q ss_pred             CCccccccccccccccc
Q psy8696         162 KKQFICKFCNRQFTKSY  178 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~  178 (212)
                      ...|.|..|++.|....
T Consensus        51 ~qRyrC~~C~~tf~~~~   67 (129)
T COG3677          51 HQRYKCKSCGSTFTVET   67 (129)
T ss_pred             ccccccCCcCcceeeec
Confidence            55588888888886654


No 120
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=39.19  E-value=18  Score=28.17  Aligned_cols=34  Identities=21%  Similarity=0.579  Sum_probs=21.9

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      -.|.|..|+..+.      ++.+ |.....|.|..|+-.|.
T Consensus       111 ~~y~C~~C~~~~~------~~rr-~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      111 YPYRCTGCGQRYL------RVRR-SNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEEECCCCCCCCc------eEcc-ccCcceEEcCCCCCEEE
Confidence            3589988997763      2222 22226699999987654


No 121
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF07941 K_channel_TID:  Potassium channel Kv1.4 tandem inactivation domain;  InterPro: IPR012897 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The first Kv1 sequence (also known as Shaker) was found in Drosophila melanogaster (Fruit fly). Several vertebrate potassium channels with similar amino acid sequences were subsequently found and, together with the D. melanogaster Shaker channel, now constitute the Kv1 family. The family consists of at least 6 genes (Kv1.1, Kv1.2, Kv1.3, Kv1.4, Kv1.5 and Kv1.6) which each play distinct physiological roles. A conserved motif found towards the C terminus of these channels is required for efficient processing and surface expression []. Variations in this motif account for the differences in cell surface expression and localisation between family members. These channels are mostly expressed in the brain, but can also be found in non-excitable cells, such as lymphocytes [].  This entry features the tandem inactivation domain found at the N terminus of the Kv1.4 potassium channel. It is composed of two subdomains. Inactivation domain 1 (ID1, residues 1-38) consists of a flexible N terminus anchored at a 5-turn helix, and is thought to work by occluding the ion pathway, as is the case with a classical ball domain. Inactivation domain 2 (ID2, residues 40-50) is a 2.5 turn helix with a high proportion of hydrophobic residues that probably serves to attach ID1 to the cytoplasmic face of the channel. In this way, it can promote rapid access of ID1 to the receptor site in the open channel. ID1 and ID2 function together to bring about fast inactivation of the Kv1.4 channel, which is important for the role of the channel in short-term plasticity []. ; GO: 0005249 voltage-gated potassium channel activity, 0030955 potassium ion binding, 0006813 potassium ion transport, 0016021 integral to membrane; PDB: 1KN7_A 1ZTO_A.
Probab=38.49  E-value=9.5  Score=26.04  Aligned_cols=11  Identities=18%  Similarity=0.111  Sum_probs=4.9

Q ss_pred             CCcccccchHH
Q psy8696          49 TRSIHMYQGDE   59 (212)
Q Consensus        49 ~~~~~~~~~~~   59 (212)
                      +++-||=|++-
T Consensus        12 GCnsHlPYGYA   22 (75)
T PF07941_consen   12 GCNSHLPYGYA   22 (75)
T ss_dssp             TTTT-S-TTGG
T ss_pred             CccccCCchHH
Confidence            45666645553


No 123
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=38.40  E-value=20  Score=28.04  Aligned_cols=19  Identities=32%  Similarity=0.714  Sum_probs=13.6

Q ss_pred             cceeCCccCccccCcchhc
Q psy8696         191 RPYSCDICGKAFRRQDHLR  209 (212)
Q Consensus       191 kpf~C~~Cgk~F~~~~~L~  209 (212)
                      +-+.|..|+|.|-..++++
T Consensus       123 ~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             eEEECCCCCCEecccccHH
Confidence            3577888888887766654


No 124
>PHA02998 RNA polymerase subunit; Provisional
Probab=38.18  E-value=21  Score=29.31  Aligned_cols=37  Identities=22%  Similarity=0.475  Sum_probs=22.1

Q ss_pred             ccccccccccccccccccccccccCCCc----ceeCCccCccccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDER----PYSCDICGKAFRR  204 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgek----pf~C~~Cgk~F~~  204 (212)
                      .-.|+.|+..=.....+    ++.....    -|.|..|++.|.-
T Consensus       143 ~v~CPkCg~~~A~f~ql----QTRSADEPmT~FYkC~~CG~~wkp  183 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMI----QTRAADEPPLVRHACRDCKKHFKP  183 (195)
T ss_pred             CCCCCCCCCCceEEEEE----eeccCCCCceEEEEcCCCCCccCC
Confidence            36799998543332222    2222333    3899999998764


No 125
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=37.97  E-value=15  Score=27.44  Aligned_cols=15  Identities=20%  Similarity=0.512  Sum_probs=11.9

Q ss_pred             ccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSY  178 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~  178 (212)
                      ++.|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            578999999988743


No 126
>KOG4167|consensus
Probab=37.94  E-value=5.5  Score=39.25  Aligned_cols=27  Identities=30%  Similarity=0.481  Sum_probs=23.8

Q ss_pred             CCccccccccccccccccccccccccC
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      ...|.|..|+|.|..-..+..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            456999999999999999999999884


No 127
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=37.12  E-value=11  Score=20.75  Aligned_cols=9  Identities=22%  Similarity=0.859  Sum_probs=5.1

Q ss_pred             eCCccCccc
Q psy8696         194 SCDICGKAF  202 (212)
Q Consensus       194 ~C~~Cgk~F  202 (212)
                      .|++|++.+
T Consensus         3 ~CPiC~~~v   11 (26)
T smart00734        3 QCPVCFREV   11 (26)
T ss_pred             cCCCCcCcc
Confidence            456665555


No 128
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=34.85  E-value=19  Score=27.07  Aligned_cols=27  Identities=19%  Similarity=0.545  Sum_probs=18.7

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      -...|..|++.|.....            -+.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (115)
T TIGR00100        69 VECECEDCSEEVSPEID------------LYRCPKCHGI   95 (115)
T ss_pred             cEEEcccCCCEEecCCc------------CccCcCCcCC
Confidence            34789999987765321            3679999854


No 129
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=34.27  E-value=14  Score=23.86  Aligned_cols=43  Identities=23%  Similarity=0.450  Sum_probs=26.3

Q ss_pred             CCcccccc--ccccccccccccccccccCCCcceeCCc----cCccccCc
Q psy8696         162 KKQFICKF--CNRQFTKSYNLLIHERTHTDERPYSCDI----CGKAFRRQ  205 (212)
Q Consensus       162 ~k~~~C~~--C~k~F~~~~~L~~H~r~Htgekpf~C~~----Cgk~F~~~  205 (212)
                      ..+..|+.  |...+. +..|..|+...=..++..|.+    |...+.+.
T Consensus         7 ~~~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~~   55 (60)
T PF02176_consen    7 FRPVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPRE   55 (60)
T ss_dssp             TSEEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEHH
T ss_pred             CCEeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccchh
Confidence            34567877  444454 568889988655667889999    98877653


No 130
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=34.23  E-value=21  Score=26.27  Aligned_cols=21  Identities=24%  Similarity=0.593  Sum_probs=14.4

Q ss_pred             cccccCCCcceeCCccCccccC
Q psy8696         183 HERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       183 H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      .+..+.| ++++|..||..|.-
T Consensus        71 W~~l~~g-~~~rC~eCG~~fkL   91 (97)
T cd00924          71 WMWLEKG-KPKRCPECGHVFKL   91 (97)
T ss_pred             EEEEeCC-CceeCCCCCcEEEE
Confidence            3455555 68888888887763


No 131
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=34.10  E-value=19  Score=21.40  Aligned_cols=16  Identities=38%  Similarity=0.719  Sum_probs=8.0

Q ss_pred             cccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYNL  180 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L  180 (212)
                      -.|..|++.|...+-+
T Consensus         4 ~~C~eC~~~f~dSyL~   19 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLL   19 (34)
T ss_dssp             EE-TTT--EES-SSCC
T ss_pred             chHhHhCCHHHHHHHH
Confidence            3588899888776543


No 132
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=33.81  E-value=10  Score=34.28  Aligned_cols=42  Identities=24%  Similarity=0.374  Sum_probs=19.8

Q ss_pred             Cccccccccccccccccc---ccc-ccccCCCc-ceeCCccCccccC
Q psy8696         163 KQFICKFCNRQFTKSYNL---LIH-ERTHTDER-PYSCDICGKAFRR  204 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L---~~H-~r~Htgek-pf~C~~Cgk~F~~  204 (212)
                      +.+.|..|.+++......   ..| +..|...| -|+|..|++....
T Consensus       251 kav~C~~C~yt~~~~~~~C~~~~H~l~~~~a~KRFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  251 KAVTCKQCKYTAFKPSDRCKEEGHPLKWHDAVKRFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEEETTT--EESS--HHHHHTT--EEEEEEE-EEEE-T-TS-EEEE
T ss_pred             EEEEcCCCCCcccCcchhHHhcCCceEEeeeeeeeEECCCCCCeeee
Confidence            347899998765544432   234 33444444 4899999876543


No 133
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=33.77  E-value=21  Score=26.83  Aligned_cols=26  Identities=19%  Similarity=0.330  Sum_probs=17.8

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      -.+.|..|+..|....            ..|.|+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCC------------cCccCcCCCC
Confidence            3478999997775432            3456999984


No 134
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=33.76  E-value=28  Score=23.18  Aligned_cols=14  Identities=29%  Similarity=0.781  Sum_probs=8.5

Q ss_pred             CcceeCCccCcccc
Q psy8696         190 ERPYSCDICGKAFR  203 (212)
Q Consensus       190 ekpf~C~~Cgk~F~  203 (212)
                      .+.|.|..||..+.
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            44567777776543


No 135
>KOG3214|consensus
Probab=33.47  E-value=24  Score=26.20  Aligned_cols=41  Identities=29%  Similarity=0.566  Sum_probs=22.5

Q ss_pred             CCCccccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      -...|.|.+|+.--.-.-.    +..........|.+|+.+|...
T Consensus        20 ldt~FnClfcnHek~v~~~----~Dk~~~iG~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   20 LDTQFNCLFCNHEKSVSCT----LDKKHNIGKASCRICEESFQTT   60 (109)
T ss_pred             hheeeccCccccccceeee----ehhhcCcceeeeeehhhhhccc
Confidence            3556889888743211111    1111223346799999888754


No 136
>PRK05978 hypothetical protein; Provisional
Probab=33.37  E-value=26  Score=27.84  Aligned_cols=32  Identities=22%  Similarity=0.326  Sum_probs=18.8

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      -+|+.|++.=-.+..|+.+         -.|+.||..|...
T Consensus        34 grCP~CG~G~LF~g~Lkv~---------~~C~~CG~~~~~~   65 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPV---------DHCAACGEDFTHH   65 (148)
T ss_pred             CcCCCCCCCcccccccccC---------CCccccCCccccC
Confidence            4688888653333333322         2588888777654


No 137
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.35  E-value=20  Score=22.28  Aligned_cols=16  Identities=38%  Similarity=0.709  Sum_probs=10.5

Q ss_pred             cccccccccccccccc
Q psy8696         166 ICKFCNRQFTKSYNLL  181 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~  181 (212)
                      .|.+|++.|..+..+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            3777777777665444


No 138
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=33.20  E-value=24  Score=25.77  Aligned_cols=29  Identities=24%  Similarity=0.590  Sum_probs=20.4

Q ss_pred             CCccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      -+|-.|..||..|..- .         -.+|-+|+.|..
T Consensus        56 v~Pa~CkkCGfef~~~-~---------ik~pSRCP~CKS   84 (97)
T COG3357          56 VRPARCKKCGFEFRDD-K---------IKKPSRCPKCKS   84 (97)
T ss_pred             ecChhhcccCcccccc-c---------cCCcccCCcchh
Confidence            3567899999988651 1         135788998854


No 139
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=32.34  E-value=16  Score=30.82  Aligned_cols=24  Identities=38%  Similarity=0.958  Sum_probs=16.6

Q ss_pred             CCCcceeCCccCccccCcchhccC
Q psy8696         188 TDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       188 tgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      ..+..|.|..|+|.|.-..-.++|
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KH   96 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKH   96 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHH
T ss_pred             HcCCEECCCCCCcccCChHHHHHH
Confidence            355679999999999877666555


No 140
>PRK04351 hypothetical protein; Provisional
Probab=32.21  E-value=25  Score=27.84  Aligned_cols=35  Identities=20%  Similarity=0.625  Sum_probs=23.1

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCccccCc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      -.|.|..|+..+.+      +.+ | ..+.|.|..|+-.+...
T Consensus       111 y~Y~C~~Cg~~~~r------~Rr-~-n~~~yrCg~C~g~L~~~  145 (149)
T PRK04351        111 YLYECQSCGQQYLR------KRR-I-NTKRYRCGKCRGKLKLI  145 (149)
T ss_pred             EEEECCCCCCEeee------eee-c-CCCcEEeCCCCcEeeec
Confidence            45899889876533      222 2 34679999998766544


No 141
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=30.83  E-value=27  Score=21.08  Aligned_cols=14  Identities=29%  Similarity=0.852  Sum_probs=11.7

Q ss_pred             ceeCCccCccccCc
Q psy8696         192 PYSCDICGKAFRRQ  205 (212)
Q Consensus       192 pf~C~~Cgk~F~~~  205 (212)
                      ||+|..|++.|-.+
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            88999999988654


No 142
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=30.78  E-value=25  Score=20.18  Aligned_cols=25  Identities=28%  Similarity=0.765  Sum_probs=11.4

Q ss_pred             ccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         166 ICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      +|+.|+-.+..           .....|.|+.|+..
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCccccc
Confidence            47777766654           23446888888754


No 143
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=29.44  E-value=26  Score=26.32  Aligned_cols=28  Identities=21%  Similarity=0.440  Sum_probs=17.8

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      -.+.|..|+..|.....           ..+.|+.||..
T Consensus        69 ~~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs~   96 (114)
T PRK03681         69 AECWCETCQQYVTLLTQ-----------RVRRCPQCHGD   96 (114)
T ss_pred             cEEEcccCCCeeecCCc-----------cCCcCcCcCCC
Confidence            34789999976644211           12579999854


No 144
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=29.16  E-value=16  Score=26.88  Aligned_cols=25  Identities=16%  Similarity=0.309  Sum_probs=21.3

Q ss_pred             ccc----ccccccccccccccccccccCC
Q psy8696         165 FIC----KFCNRQFTKSYNLLIHERTHTD  189 (212)
Q Consensus       165 ~~C----~~C~k~F~~~~~L~~H~r~Htg  189 (212)
                      |.|    ..|+..+.....+.+|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            778    8899999999999999887654


No 145
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=29.05  E-value=35  Score=27.21  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=14.5

Q ss_pred             Ccccccccccccccccccc
Q psy8696         163 KQFICKFCNRQFTKSYNLL  181 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~  181 (212)
                      +.-.|..|++.|++.....
T Consensus        27 RRReC~~C~~RFTTfE~~E   45 (156)
T COG1327          27 RRRECLECGERFTTFERAE   45 (156)
T ss_pred             hhhcccccccccchhheee
Confidence            4457999999998876544


No 146
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=28.88  E-value=13  Score=33.75  Aligned_cols=22  Identities=32%  Similarity=0.576  Sum_probs=15.3

Q ss_pred             cccccccccccccccccccccc
Q psy8696         166 ICKFCNRQFTKSYNLLIHERTH  187 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~~H~r~H  187 (212)
                      .|.+|.+.|-.-..|.+|.|..
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~  243 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLR  243 (493)
T ss_pred             hhhhccceecChHHHHHHHHhh
Confidence            4777777777777777776653


No 147
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.47  E-value=28  Score=26.30  Aligned_cols=28  Identities=21%  Similarity=0.438  Sum_probs=17.8

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      -.+.|..|++.|.....           .-+.|+.||..
T Consensus        70 ~~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs~   97 (117)
T PRK00564         70 VELECKDCSHVFKPNAL-----------DYGVCEKCHSK   97 (117)
T ss_pred             CEEEhhhCCCccccCCc-----------cCCcCcCCCCC
Confidence            34789999977755321           11359999854


No 148
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=28.45  E-value=39  Score=22.19  Aligned_cols=15  Identities=20%  Similarity=0.702  Sum_probs=10.4

Q ss_pred             ccccccccccccccc
Q psy8696         165 FICKFCNRQFTKSYN  179 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~  179 (212)
                      ..|..|++.|.....
T Consensus         6 ~~C~~Cg~~~~~~dD   20 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDD   20 (54)
T ss_pred             ccChhhCCcccCCCC
Confidence            468888888865433


No 149
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=28.17  E-value=37  Score=20.49  Aligned_cols=32  Identities=19%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAF  202 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F  202 (212)
                      ..|..|+--      |.-+..+..+.+.|.|.+|+...
T Consensus         3 ~rC~~C~ay------lNp~~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    3 VRCRRCRAY------LNPFCQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             -B-TTT--B------S-TTSEEETTTTEEEETTT--EE
T ss_pred             cccCCCCCE------ECCcceEcCCCCEEECcCCCCcC
Confidence            456666532      22233444466778888887643


No 150
>KOG4173|consensus
Probab=28.01  E-value=6.1  Score=33.20  Aligned_cols=46  Identities=30%  Similarity=0.611  Sum_probs=28.5

Q ss_pred             ccccccccccccccccccccc-c---------CCCcceeCC--ccCccccCcchhccC
Q psy8696         166 ICKFCNRQFTKSYNLLIHERT-H---------TDERPYSCD--ICGKAFRRQDHLRDH  211 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~~H~r~-H---------tgekpf~C~--~Cgk~F~~~~~L~~H  211 (212)
                      .|.+|.+.|.+..-|-.|+-. |         .|.--|+|-  .|+..|.+...-++|
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH  165 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDH  165 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhH
Confidence            677777777777777777532 2         233347774  377777665554444


No 151
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=27.66  E-value=34  Score=18.21  Aligned_cols=6  Identities=50%  Similarity=1.453  Sum_probs=3.1

Q ss_pred             CCccCc
Q psy8696         195 CDICGK  200 (212)
Q Consensus       195 C~~Cgk  200 (212)
                      |..||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555554


No 152
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=27.44  E-value=27  Score=24.02  Aligned_cols=15  Identities=27%  Similarity=0.855  Sum_probs=7.5

Q ss_pred             ccCCCcceeCCccCcc
Q psy8696         186 THTDERPYSCDICGKA  201 (212)
Q Consensus       186 ~Htgekpf~C~~Cgk~  201 (212)
                      .+.+.|--+| .||+.
T Consensus        14 a~e~~kTkkC-~CG~~   28 (68)
T PF09082_consen   14 AKEGAKTKKC-VCGKT   28 (68)
T ss_dssp             EETT-SEEEE-TTTEE
T ss_pred             ecCCcceeEe-cCCCe
Confidence            3344455566 66654


No 153
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=27.05  E-value=41  Score=33.91  Aligned_cols=12  Identities=33%  Similarity=0.686  Sum_probs=7.5

Q ss_pred             cccccccccccc
Q psy8696         165 FICKFCNRQFTK  176 (212)
Q Consensus       165 ~~C~~C~k~F~~  176 (212)
                      -.|..|++.|..
T Consensus       461 dtC~~C~kkFfS  472 (1374)
T PTZ00303        461 DSCPSCGRAFIS  472 (1374)
T ss_pred             CcccCcCCcccc
Confidence            347777777654


No 154
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=26.78  E-value=42  Score=29.02  Aligned_cols=14  Identities=29%  Similarity=0.809  Sum_probs=9.7

Q ss_pred             cceeCCccCccccC
Q psy8696         191 RPYSCDICGKAFRR  204 (212)
Q Consensus       191 kpf~C~~Cgk~F~~  204 (212)
                      --|.|..|++.|+-
T Consensus       154 aef~C~~C~h~F~G  167 (278)
T PF15135_consen  154 AEFHCPKCRHNFRG  167 (278)
T ss_pred             eeeecccccccchh
Confidence            35778888777763


No 155
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=26.58  E-value=50  Score=20.53  Aligned_cols=12  Identities=25%  Similarity=0.847  Sum_probs=5.9

Q ss_pred             cccccccccccc
Q psy8696         164 QFICKFCNRQFT  175 (212)
Q Consensus       164 ~~~C~~C~k~F~  175 (212)
                      .|.|..|+..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            355555554443


No 156
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=26.22  E-value=36  Score=25.62  Aligned_cols=39  Identities=23%  Similarity=0.509  Sum_probs=21.6

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      ..|+.|+..=.....|+.-.---.-.+-|+|..||..|+
T Consensus        73 ~~CpkCg~~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEEEeeehhccCCCceEEEEecccCCEee
Confidence            678888865433333322111111223489999998875


No 157
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=26.17  E-value=53  Score=18.45  Aligned_cols=11  Identities=36%  Similarity=1.077  Sum_probs=7.2

Q ss_pred             ceeCCccCccc
Q psy8696         192 PYSCDICGKAF  202 (212)
Q Consensus       192 pf~C~~Cgk~F  202 (212)
                      =|.|..|++.+
T Consensus        27 Cf~C~~C~~~L   37 (39)
T smart00132       27 CFKCSKCGKPL   37 (39)
T ss_pred             CCCCcccCCcC
Confidence            36677777655


No 158
>PLN02294 cytochrome c oxidase subunit Vb
Probab=25.95  E-value=42  Score=27.31  Aligned_cols=22  Identities=14%  Similarity=0.484  Sum_probs=15.8

Q ss_pred             cccccCCCcceeCCccCccccCc
Q psy8696         183 HERTHTDERPYSCDICGKAFRRQ  205 (212)
Q Consensus       183 H~r~Htgekpf~C~~Cgk~F~~~  205 (212)
                      .+..+.| +|++|..||..|.-+
T Consensus       133 Wf~L~kG-kp~RCpeCG~~fkL~  154 (174)
T PLN02294        133 WFWLEKG-KSFECPVCTQYFELE  154 (174)
T ss_pred             EEEecCC-CceeCCCCCCEEEEE
Confidence            3444544 799999999988643


No 159
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=25.66  E-value=38  Score=27.37  Aligned_cols=17  Identities=35%  Similarity=0.862  Sum_probs=11.2

Q ss_pred             ceeCCccCccccCcchh
Q psy8696         192 PYSCDICGKAFRRQDHL  208 (212)
Q Consensus       192 pf~C~~Cgk~F~~~~~L  208 (212)
                      -|.|..||+.|-..+++
T Consensus       130 f~~C~~CgkiYW~GsHw  146 (165)
T COG1656         130 FYRCPKCGKIYWKGSHW  146 (165)
T ss_pred             eeECCCCcccccCchHH
Confidence            45677777777665554


No 160
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=24.99  E-value=52  Score=26.10  Aligned_cols=19  Identities=21%  Similarity=0.333  Sum_probs=13.7

Q ss_pred             ccccccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSYNLLI  182 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~  182 (212)
                      .=+|..|++.|++...+..
T Consensus        28 RReC~~C~~RFTTyErve~   46 (147)
T TIGR00244        28 RRECLECHERFTTFERAEL   46 (147)
T ss_pred             cccCCccCCccceeeeccc
Confidence            3568889988888766543


No 161
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=24.91  E-value=28  Score=26.00  Aligned_cols=26  Identities=27%  Similarity=0.708  Sum_probs=16.6

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      .+.|..|++.|.....            .+.|+.|+..
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs~   95 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF------------DFSCPRCGSP   95 (113)
T ss_dssp             EEEETTTS-EEECHHC------------CHH-SSSSSS
T ss_pred             cEECCCCCCEEecCCC------------CCCCcCCcCC
Confidence            4789999988865321            2569999865


No 162
>KOG0978|consensus
Probab=24.52  E-value=23  Score=34.95  Aligned_cols=21  Identities=38%  Similarity=0.623  Sum_probs=16.8

Q ss_pred             cceeCCccCccccCcchhccC
Q psy8696         191 RPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       191 kpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      |--+|+.|+..|.-.+-+..|
T Consensus       677 RqRKCP~Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIH  697 (698)
T ss_pred             hcCCCCCCCCCCCcccccccC
Confidence            345799999999988877666


No 163
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=24.51  E-value=29  Score=21.26  Aligned_cols=15  Identities=40%  Similarity=1.041  Sum_probs=9.3

Q ss_pred             cceeCCccCccccCc
Q psy8696         191 RPYSCDICGKAFRRQ  205 (212)
Q Consensus       191 kpf~C~~Cgk~F~~~  205 (212)
                      -||.|..|++.|-.+
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478899999888654


No 164
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=23.86  E-value=47  Score=20.16  Aligned_cols=28  Identities=18%  Similarity=0.441  Sum_probs=14.1

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKA  201 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~  201 (212)
                      |.|+.|+....         .......-+.|..||..
T Consensus         1 m~Cp~Cg~~~~---------~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    1 MKCPNCGSKEI---------VFDPERGELVCPNCGLV   28 (43)
T ss_dssp             ESBTTTSSSEE---------EEETTTTEEEETTT-BB
T ss_pred             CCCcCCcCCce---------EEcCCCCeEECCCCCCE
Confidence            46777775431         11122334678888754


No 165
>KOG0402|consensus
Probab=23.83  E-value=32  Score=24.74  Aligned_cols=29  Identities=24%  Similarity=0.682  Sum_probs=19.5

Q ss_pred             cccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      |.|.+||+.--.+.          -.--|.|.-|.+.|.
T Consensus        37 y~CsfCGK~~vKR~----------AvGiW~C~~C~kv~a   65 (92)
T KOG0402|consen   37 YTCSFCGKKTVKRK----------AVGIWKCGSCKKVVA   65 (92)
T ss_pred             hhhhhcchhhhhhh----------ceeEEecCCccceec
Confidence            89999997532221          123578999988775


No 166
>KOG4173|consensus
Probab=23.78  E-value=15  Score=30.85  Aligned_cols=46  Identities=28%  Similarity=0.550  Sum_probs=35.6

Q ss_pred             Ccccccc--ccccccccccccccccccCCCcceeCCccCccccCcchhccC
Q psy8696         163 KQFICKF--CNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDH  211 (212)
Q Consensus       163 k~~~C~~--C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~~~~L~~H  211 (212)
                      ..|.|++  |-+.|.....+..|..+-++.   .|.+|.+.|.+..-|..|
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~H  125 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAH  125 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHH
Confidence            4478987  888998888888886654443   699999999988777655


No 167
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=23.58  E-value=43  Score=18.47  Aligned_cols=10  Identities=40%  Similarity=0.963  Sum_probs=7.2

Q ss_pred             eCCccCcccc
Q psy8696         194 SCDICGKAFR  203 (212)
Q Consensus       194 ~C~~Cgk~F~  203 (212)
                      .|+.||..|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5777887774


No 168
>KOG1280|consensus
Probab=23.52  E-value=46  Score=30.15  Aligned_cols=39  Identities=18%  Similarity=0.457  Sum_probs=26.7

Q ss_pred             CCCcccccccccccccccccccccc-ccCCCcc-eeCCccC
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHER-THTDERP-YSCDICG  199 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r-~Htgekp-f~C~~Cg  199 (212)
                      ....|.|++|++.-.+...|..|.. .|....+ ..|.+|.
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3457999999998888888888854 4543322 4566664


No 169
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=23.42  E-value=42  Score=18.28  Aligned_cols=8  Identities=50%  Similarity=1.630  Sum_probs=4.5

Q ss_pred             ceeCCccC
Q psy8696         192 PYSCDICG  199 (212)
Q Consensus       192 pf~C~~Cg  199 (212)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            45555555


No 170
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.16  E-value=58  Score=21.97  Aligned_cols=42  Identities=17%  Similarity=0.275  Sum_probs=22.0

Q ss_pred             CCCCCCccccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         158 ASRPKKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       158 ~h~~~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      .+...+++-|..-+-.|....-+.   .+ -.+.-..|++|++.|+
T Consensus        18 I~~~~~~l~C~g~~~p~~HPrV~L---~m-g~~gev~CPYC~t~y~   59 (62)
T COG4391          18 IEIGDLPLMCPGPEPPNDHPRVFL---DM-GDEGEVVCPYCSTRYR   59 (62)
T ss_pred             EEeCCeeEEcCCCCCCCCCCEEEE---Ec-CCCCcEecCccccEEE
Confidence            345566777775444432221111   11 2234467888888775


No 171
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=22.91  E-value=56  Score=30.66  Aligned_cols=40  Identities=10%  Similarity=0.326  Sum_probs=24.0

Q ss_pred             CCCccccccccccccccccccccccccCC------CcceeCCccCcc
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHTD------ERPYSCDICGKA  201 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Htg------ekpf~C~~Cgk~  201 (212)
                      ..+.|+|..|+..|.-...-... .+-.|      -..|.|+.|+..
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~-~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQ-DVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCccc-CCCCCCChhhCCCCCcCcCCCCc
Confidence            45679999999888654322111 11112      124899999853


No 172
>KOG4167|consensus
Probab=22.79  E-value=1.5e+02  Score=29.62  Aligned_cols=73  Identities=14%  Similarity=0.060  Sum_probs=41.4

Q ss_pred             CCCCCCCCCCCccccccccccCCCCCCCCCCc--cccccccccccccccccccccccCCCcc--eeCCccCccccCc
Q psy8696         133 SSSLFPGTSSTHSHLDRRLLRAPGRASRPKKQ--FICKFCNRQFTKSYNLLIHERTHTDERP--YSCDICGKAFRRQ  205 (212)
Q Consensus       133 ~s~~~~~~~~~~~~~~~~~l~~h~~~h~~~k~--~~C~~C~k~F~~~~~L~~H~r~Htgekp--f~C~~Cgk~F~~~  205 (212)
                      ....+++..|...+...--...+..++....+  +.|..|++.|.....-..|...+.-..|  -.|.+|.+.|...
T Consensus       285 ~~~~~p~k~~St~p~~e~G~~s~~~~psa~wpqhlP~g~~~~~~p~s~g~s~~a~~~Qv~~P~g~~~si~~~~~~ll  361 (907)
T KOG4167|consen  285 TLPHRPLKSPSTIPLNEMGPQSQQLSPSAMWPQHLPDGRAQPGSPESSGQSKGAFGEQVDAPNGLTCSICLKEFKLL  361 (907)
T ss_pred             ccccccccccccchhhhcCCccccccchhhccccCcccccCCCCCCcccccccchHhhhcCCCCCccccccCCCCcC
Confidence            34455565555555554444555555555444  7788888766655555555544432222  4578888777543


No 173
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=22.65  E-value=40  Score=21.65  Aligned_cols=15  Identities=27%  Similarity=0.771  Sum_probs=11.2

Q ss_pred             CcceeCCccCccccC
Q psy8696         190 ERPYSCDICGKAFRR  204 (212)
Q Consensus       190 ekpf~C~~Cgk~F~~  204 (212)
                      .+.+.|..||..|..
T Consensus         2 Dk~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVF   16 (49)
T ss_pred             CeeEEcccCCCeEEE
Confidence            466788888887764


No 174
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.52  E-value=49  Score=26.51  Aligned_cols=17  Identities=35%  Similarity=0.731  Sum_probs=11.9

Q ss_pred             CCcceeCCccCccccCc
Q psy8696         189 DERPYSCDICGKAFRRQ  205 (212)
Q Consensus       189 gekpf~C~~Cgk~F~~~  205 (212)
                      -+.|.-|..||+.|.|.
T Consensus        65 ~~~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWT   81 (158)
T ss_pred             CCCChhHHhCCCCCchH
Confidence            34677788888887764


No 175
>KOG2482|consensus
Probab=21.85  E-value=28  Score=31.52  Aligned_cols=23  Identities=26%  Similarity=0.628  Sum_probs=20.9

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT  186 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~  186 (212)
                      .+.|-+|.+.|..+..|+.|||.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            37899999999999999999875


No 176
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=21.65  E-value=35  Score=21.31  Aligned_cols=37  Identities=22%  Similarity=0.430  Sum_probs=18.6

Q ss_pred             cccccccccccccccccccccCCCcceeCCc--cCccccCc
Q psy8696         167 CKFCNRQFTKSYNLLIHERTHTDERPYSCDI--CGKAFRRQ  205 (212)
Q Consensus       167 C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~--Cgk~F~~~  205 (212)
                      |+.||.....+.....+..  ..+.-|+|..  ||..|...
T Consensus         2 CP~Cg~~a~ir~S~~~s~~--~~~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSPL--TRELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             cCCCCCeeEEEEchhhCcc--eEEEEEEECCCcCCCEEEEE
Confidence            6677755443333322211  1234566754  77777643


No 177
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=21.63  E-value=18  Score=21.92  Aligned_cols=35  Identities=17%  Similarity=0.508  Sum_probs=18.9

Q ss_pred             cccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         167 CKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       167 C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      |++||+.........+.   .....-|-|..|.+.|..
T Consensus         1 Cd~CG~~I~~eP~~~k~---~~~~y~fCC~tC~~~fk~   35 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKI---GNKVYYFCCPTCLSQFKK   35 (37)
T ss_pred             CCccCCcccCCEEEEEE---CCeEEEEECHHHHHHHHh
Confidence            67788766554433221   222223557778777654


No 178
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=21.61  E-value=49  Score=25.19  Aligned_cols=32  Identities=19%  Similarity=0.420  Sum_probs=17.5

Q ss_pred             CccccccccccccccccccccccccCCCcceeCCccCc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGK  200 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk  200 (212)
                      -.+.| .|+..|.....-..|.     .-.+.|+.||.
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~~-----~~~~~CP~Cgs  100 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDHY-----AAVIECPVCGN  100 (124)
T ss_pred             eeEEe-eCcCcccccccchhcc-----ccCCcCcCCCC
Confidence            34789 8998776542111110     00257999984


No 179
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=21.44  E-value=64  Score=20.64  Aligned_cols=27  Identities=22%  Similarity=0.496  Sum_probs=16.7

Q ss_pred             ccccccccccccccccccccccCCCcceeCCccCcccc
Q psy8696         166 ICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR  203 (212)
Q Consensus       166 ~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~  203 (212)
                      .|+.|+..     .|..|      ...+.|..|+..+-
T Consensus        22 fCP~Cg~~-----~m~~~------~~r~~C~~Cgyt~~   48 (50)
T PRK00432         22 FCPRCGSG-----FMAEH------LDRWHCGKCGYTEF   48 (50)
T ss_pred             cCcCCCcc-----hhecc------CCcEECCCcCCEEe
Confidence            58888753     22222      25688999987653


No 180
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=21.42  E-value=44  Score=20.46  Aligned_cols=12  Identities=33%  Similarity=1.035  Sum_probs=7.9

Q ss_pred             cceeCCccCccc
Q psy8696         191 RPYSCDICGKAF  202 (212)
Q Consensus       191 kpf~C~~Cgk~F  202 (212)
                      ++..|..|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            456777777665


No 181
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=21.29  E-value=54  Score=27.31  Aligned_cols=37  Identities=16%  Similarity=0.383  Sum_probs=19.5

Q ss_pred             cccccccccccccccccccccccCCCc---ceeCCccCcccc
Q psy8696         165 FICKFCNRQFTKSYNLLIHERTHTDER---PYSCDICGKAFR  203 (212)
Q Consensus       165 ~~C~~C~k~F~~~~~L~~H~r~Htgek---pf~C~~Cgk~F~  203 (212)
                      -.|+.|+..+..  ....+.--|.|+.   -+.|+.||..++
T Consensus        15 ~~CPvCg~~l~~--~~~~~~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          15 IDCPVCGGTLKA--HMYLYDIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             ecCCcccceeeE--EEeeecCCccceEEEEEEEccccCCccc
Confidence            568888873322  1111222244543   356888887665


No 182
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=21.21  E-value=56  Score=28.89  Aligned_cols=39  Identities=23%  Similarity=0.622  Sum_probs=22.0

Q ss_pred             Ccccccccccccccccccccccccc-CC-CcceeCCccCcccc
Q psy8696         163 KQFICKFCNRQFTKSYNLLIHERTH-TD-ERPYSCDICGKAFR  203 (212)
Q Consensus       163 k~~~C~~C~k~F~~~~~L~~H~r~H-tg-ekpf~C~~Cgk~F~  203 (212)
                      ..|.|..|+..=.....+  ..|.- .+ ..-|.|..|+..|.
T Consensus       257 ~~~~C~~C~~~~~~~~q~--QtrsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       257 DLFTCGKCKQKKCTYYQL--QTRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             ccccCCCCCCccceEEEe--cccCCCCCCeEEEEcCCCCCeee
Confidence            348999998543333222  22221 11 12478999998765


No 183
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=20.80  E-value=71  Score=19.04  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=8.8

Q ss_pred             cceeCCccCcccc
Q psy8696         191 RPYSCDICGKAFR  203 (212)
Q Consensus       191 kpf~C~~Cgk~F~  203 (212)
                      .-+.|+.||..+-
T Consensus        31 p~~~C~~CGE~~~   43 (46)
T TIGR03831        31 PALVCPQCGEEYL   43 (46)
T ss_pred             CccccccCCCEee
Confidence            3467888887654


No 184
>PRK14873 primosome assembly protein PriA; Provisional
Probab=20.60  E-value=63  Score=31.79  Aligned_cols=11  Identities=27%  Similarity=0.866  Sum_probs=7.4

Q ss_pred             cceeCCccCcc
Q psy8696         191 RPYSCDICGKA  201 (212)
Q Consensus       191 kpf~C~~Cgk~  201 (212)
                      .|+.|+.|+..
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            46777777653


No 185
>KOG2071|consensus
Probab=20.47  E-value=40  Score=32.50  Aligned_cols=28  Identities=25%  Similarity=0.341  Sum_probs=22.2

Q ss_pred             CCCccccccccccccccccccccccccC
Q psy8696         161 PKKQFICKFCNRQFTKSYNLLIHERTHT  188 (212)
Q Consensus       161 ~~k~~~C~~C~k~F~~~~~L~~H~r~Ht  188 (212)
                      ...+.+|..||.+|.+......|+.+|.
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            3566899999999999888777776653


No 186
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=20.40  E-value=44  Score=21.21  Aligned_cols=23  Identities=17%  Similarity=0.375  Sum_probs=17.0

Q ss_pred             ccccccccccccccccccccccc
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERT  186 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~  186 (212)
                      .|+|-+|..+...+++|..|++.
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            36788887777777888888753


No 187
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=20.38  E-value=57  Score=23.64  Aligned_cols=41  Identities=22%  Similarity=0.510  Sum_probs=22.5

Q ss_pred             ccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         164 QFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       164 ~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ...|+.||..-.....++.....-.-..-|.|..|+..++.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~~~w~~  102 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCGYVWRE  102 (104)
T ss_pred             cCCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCCCeeEe
Confidence            36799998654433333221111111235899999987653


No 188
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=20.36  E-value=80  Score=23.29  Aligned_cols=36  Identities=25%  Similarity=0.446  Sum_probs=19.4

Q ss_pred             CCccccccccccccccccccccccccCCCcceeCCccCccccC
Q psy8696         162 KKQFICKFCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRR  204 (212)
Q Consensus       162 ~k~~~C~~C~k~F~~~~~L~~H~r~Htgekpf~C~~Cgk~F~~  204 (212)
                      ...|.|+.|+. ....  ..+    ..+.--..|..||..|.+
T Consensus        19 pt~f~CP~Cge-~~v~--v~~----~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         19 PKIFECPRCGK-VSIS--VKI----KKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             CcEeECCCCCC-eEee--eec----CCCcceEECCCCCCccCE
Confidence            35688999983 1111  111    113333678888876654


No 189
>COG1773 Rubredoxin [Energy production and conversion]
Probab=20.05  E-value=45  Score=21.98  Aligned_cols=11  Identities=27%  Similarity=1.189  Sum_probs=6.6

Q ss_pred             ceeCCccCccc
Q psy8696         192 PYSCDICGKAF  202 (212)
Q Consensus       192 pf~C~~Cgk~F  202 (212)
                      .|+|.+||..|
T Consensus         3 ~~~C~~CG~vY   13 (55)
T COG1773           3 RWRCSVCGYVY   13 (55)
T ss_pred             ceEecCCceEe
Confidence            46666666554


Done!